BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|255764473|ref|YP_003064846.2| ornithine carbamoyltransferase
[Candidatus Liberibacter asiaticus str. psy62]
         (306 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|255764473|ref|YP_003064846.2| ornithine carbamoyltransferase [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254547824|gb|ACT56906.2| ornithine carbamoyltransferase [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 306

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/306 (100%), Positives = 306/306 (100%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV
Sbjct: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA
Sbjct: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL
Sbjct: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
           NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV
Sbjct: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL
Sbjct: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300

Query: 301 WCFGII 306
           WCFGII
Sbjct: 301 WCFGII 306


>gi|315122119|ref|YP_004062608.1| ornithine carbamoyltransferase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495521|gb|ADR52120.1| ornithine carbamoyltransferase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 305

 Score =  552 bits (1423), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 263/304 (86%), Positives = 280/304 (92%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MTY KHF DLS +SSSNLS I+EVAKK KN   N  E KPLSGKVLAMIFEKPSTRTRVS
Sbjct: 1   MTYTKHFLDLSKVSSSNLSLIMEVAKKRKNPLANDLEEKPLSGKVLAMIFEKPSTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FEVAMK+LGG+TIFLSGSEMQLGRAETIGDTA+VLSRYVDAIVMRTTNHSRLLEL E+AT
Sbjct: 61  FEVAMKNLGGETIFLSGSEMQLGRAETIGDTARVLSRYVDAIVMRTTNHSRLLELAEHAT 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVINALTDNTHPCQIIAD+MTFEE R SVKGKLFSWSGDGNNIL+SLIEGA RF+Y LN
Sbjct: 121 VPVINALTDNTHPCQIIADVMTFEEVRESVKGKLFSWSGDGNNILNSLIEGAVRFDYRLN 180

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           IATPIGSEP+ EYLNWARNQGASV LFHDAV+AVK +HCVFTDTW SMNQEF+AREE+VF
Sbjct: 181 IATPIGSEPQGEYLNWARNQGASVVLFHDAVKAVKDSHCVFTDTWTSMNQEFRAREEYVF 240

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           +PFQVN  LMSMAHPDALFMHCLPAHRG+EV NEVLDGPQSVVFDEAENRLHTQKAILLW
Sbjct: 241 EPFQVNSKLMSMAHPDALFMHCLPAHRGKEVTNEVLDGPQSVVFDEAENRLHTQKAILLW 300

Query: 302 CFGI 305
           CF +
Sbjct: 301 CFDL 304


>gi|222084787|ref|YP_002543316.1| ornithine carbamoyltransferase protein [Agrobacterium radiobacter
           K84]
 gi|221722235|gb|ACM25391.1| ornithine carbamoyltransferase protein [Agrobacterium radiobacter
           K84]
          Length = 305

 Score =  474 bits (1221), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 217/305 (71%), Positives = 259/305 (84%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M  PKHF DLS +++++L  II+ A   K + +    +KPL+GK+LAMIFEKPSTRTRVS
Sbjct: 1   MASPKHFLDLSAVAAADLRSIIDDAIVRKRALKAGTADKPLAGKMLAMIFEKPSTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V M+ LGG+T+FLSG+EMQLGRAETIGDTAKVLSRYVDAI++RTT HSRLLEL E+AT
Sbjct: 61  FDVGMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTEHSRLLELAEHAT 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVINALTD+THPCQI+ADIMTFEEHRG +KGK  +W+GDGNN+LHSLIEGAARF+Y +N
Sbjct: 121 VPVINALTDDTHPCQIMADIMTFEEHRGPIKGKTIAWTGDGNNVLHSLIEGAARFDYRMN 180

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +A P+GSEP++ YLNWARNQGA + L HDA +AV G  CV TDTW+SMNQE +AR  +VF
Sbjct: 181 MAVPLGSEPKDHYLNWARNQGAEIMLSHDADRAVAGVDCVVTDTWVSMNQEHRARGHNVF 240

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+QVN +LM+ A  DALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK+IL W
Sbjct: 241 QPYQVNQALMAQAGKDALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKSILAW 300

Query: 302 CFGII 306
           C G I
Sbjct: 301 CLGAI 305


>gi|190890220|ref|YP_001976762.1| ornithine carbamoyltransferase [Rhizobium etli CIAT 652]
 gi|190695499|gb|ACE89584.1| ornithine carbamoyltransferase protein [Rhizobium etli CIAT 652]
          Length = 304

 Score =  470 bits (1209), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 215/302 (71%), Positives = 258/302 (85%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           PKHF DLS ++S++L  I+  A   K + +    +KPL+GK+LAMIFEKPSTRTRVSF+V
Sbjct: 3   PKHFLDLSAVTSADLRTIMNDALVRKQAFKAGQGDKPLAGKMLAMIFEKPSTRTRVSFDV 62

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M+ LGG+T+FLSG+EMQLGRAETIGDTAKVLSRYVDAI++RTT HSRLLEL E+ATVPV
Sbjct: 63  GMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTEHSRLLELAEHATVPV 122

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALTD+THPCQI+ADIMTFEEHRGS+KGK  +W+GDGNN+LHSL+EGAARF Y +N+A 
Sbjct: 123 INALTDDTHPCQIMADIMTFEEHRGSIKGKTIAWTGDGNNVLHSLVEGAARFGYRMNMAV 182

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P+GSEP++ YLNWARN+GA + L HDA +AV+G  CV TDTW+SMNQE +AR  +VFQP+
Sbjct: 183 PLGSEPKDHYLNWARNEGAEIMLCHDADRAVEGVDCVVTDTWVSMNQEHRARGHNVFQPY 242

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QVN +LM+ A  DALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK+IL WC G
Sbjct: 243 QVNAALMAKAGSDALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKSILAWCLG 302

Query: 305 II 306
            I
Sbjct: 303 AI 304


>gi|327190080|gb|EGE57196.1| ornithine carbamoyltransferase [Rhizobium etli CNPAF512]
          Length = 304

 Score =  469 bits (1206), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 214/302 (70%), Positives = 257/302 (85%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           PKHF DLS ++S++L  I+  A   K + +    +KPL+GK+LAMIFEKPSTRTRVSF+V
Sbjct: 3   PKHFLDLSAVTSADLRTIMNDALARKQAFKAGQGDKPLAGKMLAMIFEKPSTRTRVSFDV 62

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M+ LGG+T+FLSG+EMQLGRAETIGDTAKVLSRYVDAI++RTT HSRLLEL E+ATVPV
Sbjct: 63  GMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTEHSRLLELAEHATVPV 122

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALTD+THPCQI+ADIMTFEEHRG +KGK  +W+GDGNN+LHSL+EGAARF Y +N+A 
Sbjct: 123 INALTDDTHPCQIMADIMTFEEHRGPIKGKTIAWTGDGNNVLHSLVEGAARFGYRMNMAV 182

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P+GSEP++ YLNWARN+GA + L HDA +AV+G  CV TDTW+SMNQE +AR  +VFQP+
Sbjct: 183 PLGSEPKDHYLNWARNEGAEIMLCHDADRAVEGVDCVVTDTWVSMNQEHRARGHNVFQPY 242

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QVN +LM+ A  DALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK+IL WC G
Sbjct: 243 QVNAALMAKAGSDALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKSILAWCLG 302

Query: 305 II 306
            I
Sbjct: 303 AI 304


>gi|86356171|ref|YP_468063.1| ornithine carbamoyltransferase [Rhizobium etli CFN 42]
 gi|86280273|gb|ABC89336.1| ornithine carbamoyltransferase protein [Rhizobium etli CFN 42]
          Length = 304

 Score =  469 bits (1206), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 214/302 (70%), Positives = 257/302 (85%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           PKHF DLS ++S++L  I+  A   K + +    +KPL+GK+LAMIFEKPSTRTRVSF+V
Sbjct: 3   PKHFLDLSAVTSADLRTIMNDALSRKQAFKAGKGDKPLAGKMLAMIFEKPSTRTRVSFDV 62

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M+ LGG+T+FLSG+EMQLGRAETIGDTAKVLSRYVDAI++RTT HSRLLEL E+ATVPV
Sbjct: 63  GMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTEHSRLLELAEHATVPV 122

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALTD+THPCQI+ADIMTFEEHRG +KGK  +W+GDGNN+LHSL+EGAARF Y +N+A 
Sbjct: 123 INALTDDTHPCQIMADIMTFEEHRGPIKGKTIAWTGDGNNVLHSLVEGAARFGYRMNMAV 182

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P+GSEP++ YLNWARN+GA + L HDA +AV+G  CV TDTW+SMNQE +AR  +VFQP+
Sbjct: 183 PLGSEPKDHYLNWARNEGAEIMLCHDADRAVEGVDCVVTDTWVSMNQEHRARGHNVFQPY 242

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QVN +LM+ A  DALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK+IL WC G
Sbjct: 243 QVNAALMAKAGSDALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKSILAWCLG 302

Query: 305 II 306
            I
Sbjct: 303 AI 304


>gi|15964271|ref|NP_384624.1| ornithine carbamoyltransferase [Sinorhizobium meliloti 1021]
 gi|307307008|ref|ZP_07586747.1| ornithine carbamoyltransferase [Sinorhizobium meliloti BL225C]
 gi|307320662|ref|ZP_07600075.1| ornithine carbamoyltransferase [Sinorhizobium meliloti AK83]
 gi|32699470|sp|Q92S99|OTC_RHIME RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|15073448|emb|CAC45090.1| Probable ornithine carbamoyltransferase [Sinorhizobium meliloti
           1021]
 gi|306893697|gb|EFN24470.1| ornithine carbamoyltransferase [Sinorhizobium meliloti AK83]
 gi|306901948|gb|EFN32547.1| ornithine carbamoyltransferase [Sinorhizobium meliloti BL225C]
          Length = 303

 Score =  467 bits (1201), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 212/301 (70%), Positives = 258/301 (85%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF DLS +++++L  II+ A+  K++++     KPL+GK+LAMIFEKPSTRTRVSF+V 
Sbjct: 3   RHFLDLSAMTATDLRTIIDDARVRKSATKAGTAEKPLAGKMLAMIFEKPSTRTRVSFDVG 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+T+FLSG+EMQLGRAETIGDTAKVLSRYVDAI++RTT+H RLLE+ E+ATVPVI
Sbjct: 63  MRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTDHRRLLEMAEHATVPVI 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+THPCQI+ADI+TFEEHRG VKGK  +W+GDGNN+LHSLIEG+ARF Y +N+A P
Sbjct: 123 NGLTDDTHPCQIMADILTFEEHRGPVKGKTIAWTGDGNNVLHSLIEGSARFGYRMNMAVP 182

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
           +GSEP +++LNWARN GA V L H+A QAV GAHCV TDTWISMNQE +AR  +VFQP+Q
Sbjct: 183 LGSEPHDKFLNWARNNGAEVLLSHEAEQAVAGAHCVVTDTWISMNQEHRARGHNVFQPYQ 242

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGI 305
           VN +LM  A PDALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK+IL WC G 
Sbjct: 243 VNGALMKHAAPDALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKSILAWCMGA 302

Query: 306 I 306
           +
Sbjct: 303 V 303


>gi|209547785|ref|YP_002279702.1| ornithine carbamoyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533541|gb|ACI53476.1| ornithine carbamoyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 304

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 213/302 (70%), Positives = 255/302 (84%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           PKHF DLS ++S++L  I+  A   K + +    +KPL+GK+LAMIFEKPSTRTRVSF+V
Sbjct: 3   PKHFLDLSAVTSADLRTIMNDALARKQAFKAGKGDKPLAGKMLAMIFEKPSTRTRVSFDV 62

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M+ LGG+T+FLSG+EMQLGRAETIGDTAKVLSRYVDAI++RTT HSRL EL E+ATVPV
Sbjct: 63  GMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTEHSRLKELAEHATVPV 122

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALTD+THPCQI+ADIMTFEEHRG +KGK  +W+GDGNN+LHSL+EGAARF Y +N+A 
Sbjct: 123 INALTDDTHPCQIMADIMTFEEHRGPIKGKTIAWTGDGNNVLHSLVEGAARFGYRMNMAV 182

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P+GSEP++ YLNWARN+GA + L HDA +AV G  CV TDTW+SMNQE +AR  +VFQP+
Sbjct: 183 PLGSEPKDHYLNWARNEGAEIMLCHDADRAVDGVDCVVTDTWVSMNQEHRARGHNVFQPY 242

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QVN +LM+ A  DALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK+IL WC G
Sbjct: 243 QVNAALMAKAGSDALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKSILAWCLG 302

Query: 305 II 306
            I
Sbjct: 303 AI 304


>gi|116250322|ref|YP_766160.1| ornithine carbamoyltransferase [Rhizobium leguminosarum bv. viciae
           3841]
 gi|226739204|sp|Q1MLV9|OTC_RHIL3 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|115254970|emb|CAK06044.1| putative ornithine carbamoyltransferase [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 304

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 212/302 (70%), Positives = 256/302 (84%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           PKHF DLS ++S++L  I+  A   K + +    +KPL+GK+LAMIFEKPSTRTRVSF+V
Sbjct: 3   PKHFLDLSAVTSADLRTIMNDALARKQAFKAGTGDKPLAGKMLAMIFEKPSTRTRVSFDV 62

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M+ LGG+T+FLSG+EMQLGRAETIGDTAKVLSRYVDAI++RTT HSRLLEL ++ATVPV
Sbjct: 63  GMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTEHSRLLELAQHATVPV 122

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALTD+THPCQI+ADIMTFEEHRG +KGK  +W+GDGNN+LHSL+EGAARF Y +N+A 
Sbjct: 123 INALTDDTHPCQIMADIMTFEEHRGPIKGKTIAWTGDGNNVLHSLVEGAARFGYRMNMAV 182

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P+GSEP++ YLNWARN+GA + L HDA +AV G  CV TDTW+SMNQE +AR  +VFQP+
Sbjct: 183 PLGSEPKDHYLNWARNEGAEIMLCHDADRAVAGVDCVVTDTWVSMNQEHRARGHNVFQPY 242

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QVN +LM+ A  DALFMHCLPAHRGEEV ++V+DGPQSVVFDEAENRLH QK+IL WC G
Sbjct: 243 QVNAALMAKAGNDALFMHCLPAHRGEEVTDDVIDGPQSVVFDEAENRLHAQKSILAWCLG 302

Query: 305 II 306
            I
Sbjct: 303 AI 304


>gi|241202940|ref|YP_002974036.1| ornithine carbamoyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240856830|gb|ACS54497.1| ornithine carbamoyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 304

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 212/302 (70%), Positives = 256/302 (84%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           PKHF DLS ++S++L  I+  A   K + +    +KPL+GK+LAMIFEKPSTRTRVSF+V
Sbjct: 3   PKHFLDLSAVTSADLRTIMNDALARKQAFKAGQGDKPLAGKMLAMIFEKPSTRTRVSFDV 62

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M+ LGG+T+FLSG+EMQLGRAETIGDTAKVLSRYVDAI++RTT HSRL+EL ++ATVPV
Sbjct: 63  GMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTEHSRLVELAQHATVPV 122

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALTD+THPCQI+ADIMTFEEHRG +KGK  +W+GDGNN+LHSL+EGAARF Y +N+A 
Sbjct: 123 INALTDDTHPCQIMADIMTFEEHRGPIKGKTIAWTGDGNNVLHSLVEGAARFGYRMNMAV 182

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P+GSEP++ YLNWARN+GA + L HDA +AV G  CV TDTW+SMNQE +AR  +VFQP+
Sbjct: 183 PLGSEPKDHYLNWARNEGAEIMLCHDADRAVAGVDCVVTDTWVSMNQEHRARGHNVFQPY 242

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QVN +LM+ A  DALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK+IL WC G
Sbjct: 243 QVNAALMAKAGNDALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKSILAWCLG 302

Query: 305 II 306
            I
Sbjct: 303 AI 304


>gi|15887776|ref|NP_353457.1| ornithine carbamoyltransferase [Agrobacterium tumefaciens str. C58]
 gi|32699460|sp|Q8UI70|OTC_AGRT5 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|15155348|gb|AAK86242.1| ornithine carbamoyltransferase [Agrobacterium tumefaciens str. C58]
          Length = 305

 Score =  465 bits (1196), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 207/305 (67%), Positives = 255/305 (83%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M  PKHF DLS +   +L  I++ A+  K +++     KPL+GK+LAMIFEKPSTRTRVS
Sbjct: 1   MASPKHFLDLSAVGPQDLRTILDDARARKVATKAGTAEKPLAGKMLAMIFEKPSTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V M+ LGG+T+FLSG+EMQLGRAETIGDTAKVLSRYVDAI++RTT+HSRLLEL E+AT
Sbjct: 61  FDVGMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTDHSRLLELAEHAT 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD+THPCQI+ADIMTFEEHRG VKGK  +W+GDGNN+LHS +EG+ARF Y + 
Sbjct: 121 VPVINGLTDDTHPCQIMADIMTFEEHRGPVKGKTIAWTGDGNNVLHSFVEGSARFGYRMT 180

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +A P+GSEP ++++NWARN G  +AL+HDA +AV GA CV TDTW+SMNQE KAR  ++F
Sbjct: 181 MAVPMGSEPHDKFMNWARNNGGEIALYHDADKAVAGADCVVTDTWVSMNQEHKARGHNIF 240

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+QVN +LM+ A  DALFMHCLPAHRGEEV + V+DGPQSVVFDEAENRLH QK+++ W
Sbjct: 241 QPYQVNEALMAKAQKDALFMHCLPAHRGEEVTDAVIDGPQSVVFDEAENRLHAQKSVIAW 300

Query: 302 CFGII 306
           C G+I
Sbjct: 301 CMGVI 305


>gi|227820737|ref|YP_002824707.1| ornithine carbamoyltransferase [Sinorhizobium fredii NGR234]
 gi|227339736|gb|ACP23954.1| ornithine carbamoyltransferase [Sinorhizobium fredii NGR234]
          Length = 305

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 209/305 (68%), Positives = 257/305 (84%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT  +HF DLS ++ ++L  II+ A+  K +++     KPL+GK+LAMIFEKPSTRTRVS
Sbjct: 1   MTATRHFLDLSAMTGADLRTIIDDARVRKTATKAGTAEKPLAGKMLAMIFEKPSTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V M+ LGG+T+FLSG+EMQLGRAETIGDTAKVLSRYVDAI++RTT+H RLLEL E+AT
Sbjct: 61  FDVGMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTDHRRLLELAEHAT 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD+THPCQI+ADIMTFEEHRG V+GK  +W+GDGNN+LHSLIEG+ARF Y +N
Sbjct: 121 VPVINGLTDDTHPCQIMADIMTFEEHRGPVQGKTIAWTGDGNNVLHSLIEGSARFGYRMN 180

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +A P+GSEP++++LNWARN G  + L H+A QAV GAHCV TDTW+SMNQE +AR  +VF
Sbjct: 181 MAVPLGSEPQDKFLNWARNNGGEILLCHEAEQAVAGAHCVVTDTWVSMNQEHRARGHNVF 240

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+QVN +LM  A P+A+FMHCLPAHRGEEV +EV+DGPQSVVFD AENRLH QK+IL W
Sbjct: 241 QPYQVNAALMKHAVPEAVFMHCLPAHRGEEVTDEVIDGPQSVVFDAAENRLHAQKSILAW 300

Query: 302 CFGII 306
           C G +
Sbjct: 301 CLGAV 305


>gi|325291862|ref|YP_004277726.1| Ornithine carbamoyltransferase [Agrobacterium sp. H13-3]
 gi|325059715|gb|ADY63406.1| Ornithine carbamoyltransferase [Agrobacterium sp. H13-3]
          Length = 305

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 207/305 (67%), Positives = 257/305 (84%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M  PKHF DLS + S +L  I++ A+  K +++     KPL+GK+LAMIFEKPSTRTRVS
Sbjct: 1   MGSPKHFLDLSAVGSEDLRTILDDARTRKIATKTGTAEKPLAGKMLAMIFEKPSTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V M+ LGG+T+FLSG+EMQLGRAETIGDTAKVLSRYVDAI++RTT+HSRLLEL E+AT
Sbjct: 61  FDVGMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTDHSRLLELAEHAT 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD+THPCQI+ADI+TFEEHRG VKGK  +W+GDGNN+LHS +EG+ARF Y + 
Sbjct: 121 VPVINGLTDDTHPCQIMADILTFEEHRGPVKGKTIAWTGDGNNVLHSFVEGSARFGYRMA 180

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +A P+GSEP +++LNWARN G  ++L+HDA +AV GA CV TDTW+SMNQE KAR  ++F
Sbjct: 181 MAVPMGSEPHDKFLNWARNNGGEISLYHDADKAVAGADCVVTDTWVSMNQEHKARGHNIF 240

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+QVN +LM+ A+ +ALFMHCLPAHRGEEV + V+DGPQSVVFDEAENRLH QK+I+ W
Sbjct: 241 QPYQVNEALMAKANKEALFMHCLPAHRGEEVTDAVIDGPQSVVFDEAENRLHAQKSIIAW 300

Query: 302 CFGII 306
           C G+I
Sbjct: 301 CMGVI 305


>gi|150395356|ref|YP_001325823.1| ornithine carbamoyltransferase [Sinorhizobium medicae WSM419]
 gi|150026871|gb|ABR58988.1| ornithine carbamoyltransferase [Sinorhizobium medicae WSM419]
          Length = 303

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 209/301 (69%), Positives = 256/301 (85%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF DLS +++++L  II+ A+  K++++     KPL+GK+LAMIFEKPSTRTRVSF+V 
Sbjct: 3   RHFLDLSAMAATDLRTIIDDARVRKSATKAGTAEKPLAGKMLAMIFEKPSTRTRVSFDVG 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+T+FLSG+EMQLGRAETIGDTAKVLSRYVDAI++RTT+H RLLE+ E+ATVPVI
Sbjct: 63  MRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTDHRRLLEMAEHATVPVI 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+THPCQI+ADI+TFEEHRG VKGK  +W+GDGNN+LHSLIEG+ARF Y +N+A P
Sbjct: 123 NGLTDDTHPCQIMADILTFEEHRGPVKGKTIAWTGDGNNVLHSLIEGSARFGYRMNMAVP 182

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
           +GSEP +++LNWARN G  V L H+  QAV GAHCV TDTWISMNQE +AR  +VFQP+Q
Sbjct: 183 LGSEPHDKFLNWARNNGGEVLLSHEPEQAVAGAHCVVTDTWISMNQEHRARGHNVFQPYQ 242

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGI 305
           VN +LM  A PDA+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK+IL WC G 
Sbjct: 243 VNGALMKHAAPDAVFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKSILAWCMGA 302

Query: 306 I 306
           +
Sbjct: 303 V 303


>gi|222147383|ref|YP_002548340.1| ornithine carbamoyltransferase [Agrobacterium vitis S4]
 gi|221734373|gb|ACM35336.1| ornithine carbamoyltransferase [Agrobacterium vitis S4]
          Length = 305

 Score =  459 bits (1181), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 211/305 (69%), Positives = 251/305 (82%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M  PKHF DLS ++S +L  I+  A + K  +     +KPL+GK+LAMIFEKPSTRTRVS
Sbjct: 1   MASPKHFLDLSAMTSEDLHSILSDAHQRKTRTRAGTADKPLAGKMLAMIFEKPSTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V M+ LGG+T+FLSG+EMQLGRAETIGDTAKVLSRYVDAI++RTT+H+RLLEL E+AT
Sbjct: 61  FDVGMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTDHNRLLELAEHAT 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVINALTD THPCQI+ADIMT EEHRG ++GK  +W+GDGNN+LHSL+EGAARF Y +N
Sbjct: 121 VPVINALTDLTHPCQIMADIMTIEEHRGPIRGKTLAWTGDGNNVLHSLVEGAARFGYRMN 180

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +A P+GSEP ++ LNWARN G  + L HDA +AV GA  V TDTW+SMN E KAR  +VF
Sbjct: 181 MAVPMGSEPEDQILNWARNNGGEIMLCHDADRAVTGADAVITDTWVSMNLEHKARGHNVF 240

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QPFQVN +LM  A PDALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK+IL W
Sbjct: 241 QPFQVNPALMKQAKPDALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKSILAW 300

Query: 302 CFGII 306
           C G +
Sbjct: 301 CLGAV 305


>gi|218680988|ref|ZP_03528885.1| ornithine carbamoyltransferase [Rhizobium etli CIAT 894]
          Length = 272

 Score =  451 bits (1159), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 203/268 (75%), Positives = 239/268 (89%)

Query: 39  NKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSR 98
           +KPL+GK+LAMIFEKPSTRTRVSF+V M+ LGG+T+FLSG+EMQLGRAETIGDTAKVLSR
Sbjct: 5   DKPLAGKMLAMIFEKPSTRTRVSFDVGMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSR 64

Query: 99  YVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSW 158
           YVDAI++RTT HSRLLEL E+ATVPVINALTD+THPCQI+ADIMTFEEHRGS+KGK  +W
Sbjct: 65  YVDAIMIRTTEHSRLLELAEHATVPVINALTDDTHPCQIMADIMTFEEHRGSIKGKTIAW 124

Query: 159 SGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGA 218
           +GDGNN+LHSL+EGAARF Y +N+A P+GSEP++ YLNWARN+GA + L HDA +AV+G 
Sbjct: 125 TGDGNNVLHSLVEGAARFGYRMNMAVPLGSEPKDHYLNWARNEGAEIMLCHDADRAVEGV 184

Query: 219 HCVFTDTWISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLD 278
            CV TDTW+SMNQE +AR  +VFQP+QVN +LM+ A  DALFMHCLPAHRGEEV +EV+D
Sbjct: 185 DCVVTDTWVSMNQEHRARGHNVFQPYQVNAALMAKAGNDALFMHCLPAHRGEEVTDEVID 244

Query: 279 GPQSVVFDEAENRLHTQKAILLWCFGII 306
           GPQSVVFDEAENRLH QK+IL WC G I
Sbjct: 245 GPQSVVFDEAENRLHAQKSILAWCLGAI 272


>gi|163761280|ref|ZP_02168355.1| ornithine carbamoyltransferase [Hoeflea phototrophica DFL-43]
 gi|162281437|gb|EDQ31733.1| ornithine carbamoyltransferase [Hoeflea phototrophica DFL-43]
          Length = 307

 Score =  445 bits (1145), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 202/302 (66%), Positives = 247/302 (81%), Gaps = 3/302 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           P+HF DLS +S++ L  +I+ A+  K+SS     ++PL+GK+LAMIFEKPSTRTRVSF+V
Sbjct: 9   PRHFLDLSAVSAAELRAMIDAARAAKSSSGG---DRPLAGKMLAMIFEKPSTRTRVSFDV 65

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M+ LGG+T+FLSG+EMQLGRAETI DTAKVLSRYVD I++RT +H R+LEL E+ATVPV
Sbjct: 66  GMRQLGGETLFLSGTEMQLGRAETIADTAKVLSRYVDIIMIRTMDHERMLELAEHATVPV 125

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALTD+THPCQI+ADI+TFEEHRG +KGK  +W+GDGNN+LHSL+EGA RF Y + IAT
Sbjct: 126 INALTDDTHPCQIMADILTFEEHRGPIKGKTLAWTGDGNNVLHSLVEGAGRFGYRMQIAT 185

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P GSEP   +++WAR QGA + L  D  +A  GA C+ TDTW+SMNQE KAR  +VF P+
Sbjct: 186 PEGSEPDMRFVDWARAQGAEIDLSADPERAASGADCIITDTWVSMNQEHKARGHNVFLPY 245

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QVN  LM+ A+ DALFMHCLPAHRGEEV NEV+DGPQSVVFDEAENRLH QKAI+ WC G
Sbjct: 246 QVNEDLMAKANKDALFMHCLPAHRGEEVTNEVMDGPQSVVFDEAENRLHAQKAIMRWCMG 305

Query: 305 II 306
            +
Sbjct: 306 AL 307


>gi|239831154|ref|ZP_04679483.1| ornithine carbamoyltransferase [Ochrobactrum intermedium LMG 3301]
 gi|239823421|gb|EEQ94989.1| ornithine carbamoyltransferase [Ochrobactrum intermedium LMG 3301]
          Length = 312

 Score =  433 bits (1114), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 199/298 (66%), Positives = 240/298 (80%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF DLS + +S L  I+E AK  K   +     KP +GKVLAMIFEKPSTRTRVSF+V 
Sbjct: 8   KHFIDLSAVPASELRAIMEDAKARKARLKAGEMEKPFAGKVLAMIFEKPSTRTRVSFDVG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+GSEMQLGR+ETI DTAKVLSRYVDAI++RTT+H R+LEL EYATVPVI
Sbjct: 68  MRQLGGETIMLTGSEMQLGRSETIADTAKVLSRYVDAIMIRTTSHDRMLELAEYATVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+THPCQI+AD++T+EEHRG +KGK F+W GDGNN+LHSL+E AARF++ +NIATP
Sbjct: 128 NALTDDTHPCQIMADVLTYEEHRGPIKGKTFAWMGDGNNVLHSLVEAAARFDFNVNIATP 187

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            GSEP+++Y++WA+  GA++    D  +A  GA C+ TDTW+SM QE  AR  +VF P+Q
Sbjct: 188 EGSEPKSQYVDWAKANGANIMSTTDPERAASGADCIVTDTWVSMGQEDHARGHNVFMPYQ 247

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN  LM  A P ALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QKAIL WC 
Sbjct: 248 VNARLMEKADPKALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKAILAWCL 305


>gi|153007740|ref|YP_001368955.1| ornithine carbamoyltransferase [Ochrobactrum anthropi ATCC 49188]
 gi|151559628|gb|ABS13126.1| ornithine carbamoyltransferase [Ochrobactrum anthropi ATCC 49188]
          Length = 312

 Score =  433 bits (1113), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 199/298 (66%), Positives = 241/298 (80%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF DLS + +S L  I+E AK  K   +     +P +GKVLAMIFEKPSTRTRVSF+V 
Sbjct: 8   KHFIDLSAVPASELRAIMEDAKARKARLKAGEIERPFAGKVLAMIFEKPSTRTRVSFDVG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+GSEMQLGR+ETI DTAKVLSRYVDAI++RTT+H R+LEL EYATVPVI
Sbjct: 68  MRQLGGETIMLTGSEMQLGRSETIADTAKVLSRYVDAIMIRTTSHERMLELAEYATVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+THPCQI+AD++T+EEHRG +KGK F+W GDGNN+LHSL+E AARF++ +NIATP
Sbjct: 128 NALTDDTHPCQIMADVLTYEEHRGPIKGKTFAWMGDGNNVLHSLVEAAARFDFNVNIATP 187

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            GSEP+++Y++WA+  GAS+    D  +A  GA C+ TDTW+SM QE  AR  +VF P+Q
Sbjct: 188 EGSEPKSQYVDWAKANGASIMSTIDPERAANGADCIVTDTWVSMGQEDHARGHNVFMPYQ 247

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN  LM+ A P ALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QKAIL WC 
Sbjct: 248 VNARLMAKADPKALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKAILAWCL 305


>gi|225626828|ref|ZP_03784867.1| ornithine carbamoyltransferase [Brucella ceti str. Cudo]
 gi|225618485|gb|EEH15528.1| ornithine carbamoyltransferase [Brucella ceti str. Cudo]
          Length = 323

 Score =  432 bits (1112), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 198/298 (66%), Positives = 240/298 (80%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF DLS + ++ L  I+E AK  K   +     +P +GKVLAMIFEKPSTRTRVSF+V 
Sbjct: 19  KHFIDLSTVPATELRAILEDAKARKARLKAGEVERPYAGKVLAMIFEKPSTRTRVSFDVG 78

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+GSEMQLGR+ETI DTAKVLSRYVDAI++RTT H R+LEL EYATVPVI
Sbjct: 79  MRQLGGETIMLTGSEMQLGRSETIADTAKVLSRYVDAIMIRTTAHERMLELAEYATVPVI 138

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+THPCQI+AD++T+EEHRG +KGK F+W GDGNN+LHSL+E AARF++ +NIATP
Sbjct: 139 NALTDDTHPCQIMADVLTYEEHRGPIKGKTFAWMGDGNNVLHSLVEAAARFDFNVNIATP 198

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            GSEP+++Y++WAR  GA +    D  +A  GA C+ TDTW+SM QE  AR  +VF P+Q
Sbjct: 199 KGSEPKSQYIDWARANGAGIMSTTDPEKAASGADCIVTDTWVSMGQEDHARGHNVFIPYQ 258

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN +LM+ A P ALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QKAIL WC 
Sbjct: 259 VNANLMAKADPKALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKAILAWCL 316


>gi|110632370|ref|YP_672578.1| ornithine carbamoyltransferase [Mesorhizobium sp. BNC1]
 gi|110283354|gb|ABG61413.1| ornithine carbamoyltransferase [Chelativorans sp. BNC1]
          Length = 302

 Score =  432 bits (1112), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 202/299 (67%), Positives = 239/299 (79%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           ++F DLS +S+++L  I++ AK+ K   ++    KP  GKVLAMIF+KPSTRTRVSF+VA
Sbjct: 3   RNFIDLSAVSAADLRSILDDAKERKALLKSGKAGKPFEGKVLAMIFDKPSTRTRVSFDVA 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGGDTI L+G EMQLGR+ETI DTAKVLSRYVDAI++RTT H RLLEL E ATVPVI
Sbjct: 63  MRQLGGDTIMLTGMEMQLGRSETIADTAKVLSRYVDAIMIRTTAHERLLELAENATVPVI 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+THPCQI+ADIMTFEEHRG VK +LF+WSGDGNN+LHSL+E +ARF + LNIATP
Sbjct: 123 NGLTDDTHPCQIMADIMTFEEHRGDVKDRLFAWSGDGNNVLHSLLEASARFGFRLNIATP 182

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
           +GSEP   Y+ WA+  G  V L  D   AV+GA CV TDTWISM QE +AR  +VFQP+Q
Sbjct: 183 VGSEPSAHYVEWAKTNGGRVTLTSDPEAAVRGADCVVTDTWISMGQEHRARGHNVFQPYQ 242

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           VN  LMS A  +ALFMHCLPAHRGEEV + V+DGP SVVFDEAENRLH QKA+L WC G
Sbjct: 243 VNERLMSFAKKEALFMHCLPAHRGEEVTDGVIDGPHSVVFDEAENRLHAQKAVLAWCLG 301


>gi|254701120|ref|ZP_05162948.1| ornithine carbamoyltransferase [Brucella suis bv. 5 str. 513]
 gi|254707957|ref|ZP_05169785.1| ornithine carbamoyltransferase [Brucella pinnipedialis M163/99/10]
 gi|254709464|ref|ZP_05171275.1| ornithine carbamoyltransferase [Brucella pinnipedialis B2/94]
 gi|254713117|ref|ZP_05174928.1| ornithine carbamoyltransferase [Brucella ceti M644/93/1]
 gi|254716529|ref|ZP_05178340.1| ornithine carbamoyltransferase [Brucella ceti M13/05/1]
 gi|256030958|ref|ZP_05444572.1| ornithine carbamoyltransferase [Brucella pinnipedialis M292/94/1]
 gi|256060449|ref|ZP_05450620.1| ornithine carbamoyltransferase [Brucella neotomae 5K33]
 gi|256159004|ref|ZP_05456841.1| ornithine carbamoyltransferase [Brucella ceti M490/95/1]
 gi|256254362|ref|ZP_05459898.1| ornithine carbamoyltransferase [Brucella ceti B1/94]
 gi|256368763|ref|YP_003106269.1| ornithine carbamoyltransferase [Brucella microti CCM 4915]
 gi|260168093|ref|ZP_05754904.1| ornithine carbamoyltransferase [Brucella sp. F5/99]
 gi|261218325|ref|ZP_05932606.1| ornithine carbamoyltransferase [Brucella ceti M13/05/1]
 gi|261221524|ref|ZP_05935805.1| ornithine carbamoyltransferase [Brucella ceti B1/94]
 gi|261315448|ref|ZP_05954645.1| ornithine carbamoyltransferase [Brucella pinnipedialis M163/99/10]
 gi|261316987|ref|ZP_05956184.1| ornithine carbamoyltransferase [Brucella pinnipedialis B2/94]
 gi|261320826|ref|ZP_05960023.1| ornithine carbamoyltransferase [Brucella ceti M644/93/1]
 gi|261324441|ref|ZP_05963638.1| ornithine carbamoyltransferase [Brucella neotomae 5K33]
 gi|261751655|ref|ZP_05995364.1| ornithine carbamoyltransferase [Brucella suis bv. 5 str. 513]
 gi|261757544|ref|ZP_06001253.1| ornithine carbamoyltransferase [Brucella sp. F5/99]
 gi|265988024|ref|ZP_06100581.1| ornithine carbamoyltransferase [Brucella pinnipedialis M292/94/1]
 gi|265997487|ref|ZP_06110044.1| ornithine carbamoyltransferase [Brucella ceti M490/95/1]
 gi|255998921|gb|ACU47320.1| ornithine carbamoyltransferase [Brucella microti CCM 4915]
 gi|260920108|gb|EEX86761.1| ornithine carbamoyltransferase [Brucella ceti B1/94]
 gi|260923414|gb|EEX89982.1| ornithine carbamoyltransferase [Brucella ceti M13/05/1]
 gi|261293516|gb|EEX97012.1| ornithine carbamoyltransferase [Brucella ceti M644/93/1]
 gi|261296210|gb|EEX99706.1| ornithine carbamoyltransferase [Brucella pinnipedialis B2/94]
 gi|261300421|gb|EEY03918.1| ornithine carbamoyltransferase [Brucella neotomae 5K33]
 gi|261304474|gb|EEY07971.1| ornithine carbamoyltransferase [Brucella pinnipedialis M163/99/10]
 gi|261737528|gb|EEY25524.1| ornithine carbamoyltransferase [Brucella sp. F5/99]
 gi|261741408|gb|EEY29334.1| ornithine carbamoyltransferase [Brucella suis bv. 5 str. 513]
 gi|262551955|gb|EEZ07945.1| ornithine carbamoyltransferase [Brucella ceti M490/95/1]
 gi|264660221|gb|EEZ30482.1| ornithine carbamoyltransferase [Brucella pinnipedialis M292/94/1]
          Length = 312

 Score =  432 bits (1112), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 198/298 (66%), Positives = 240/298 (80%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF DLS + ++ L  I+E AK  K   +     +P +GKVLAMIFEKPSTRTRVSF+V 
Sbjct: 8   KHFIDLSTVPATELRAILEDAKARKARLKAGEVERPYAGKVLAMIFEKPSTRTRVSFDVG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+GSEMQLGR+ETI DTAKVLSRYVDAI++RTT H R+LEL EYATVPVI
Sbjct: 68  MRQLGGETIMLTGSEMQLGRSETIADTAKVLSRYVDAIMIRTTAHERMLELAEYATVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+THPCQI+AD++T+EEHRG +KGK F+W GDGNN+LHSL+E AARF++ +NIATP
Sbjct: 128 NALTDDTHPCQIMADVLTYEEHRGPIKGKTFAWMGDGNNVLHSLVEAAARFDFNVNIATP 187

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            GSEP+++Y++WAR  GA +    D  +A  GA C+ TDTW+SM QE  AR  +VF P+Q
Sbjct: 188 KGSEPKSQYIDWARANGAGIMSTTDPEKAASGADCIVTDTWVSMGQEDHARGHNVFIPYQ 247

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN +LM+ A P ALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QKAIL WC 
Sbjct: 248 VNANLMAKADPKALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKAILAWCL 305


>gi|254718495|ref|ZP_05180306.1| ornithine carbamoyltransferase [Brucella sp. 83/13]
 gi|265983465|ref|ZP_06096200.1| ornithine carbamoyltransferase [Brucella sp. 83/13]
 gi|306838302|ref|ZP_07471148.1| ornithine carbamoyltransferase [Brucella sp. NF 2653]
 gi|306842431|ref|ZP_07475083.1| ornithine carbamoyltransferase [Brucella sp. BO2]
 gi|306844941|ref|ZP_07477522.1| ornithine carbamoyltransferase [Brucella sp. BO1]
 gi|264662057|gb|EEZ32318.1| ornithine carbamoyltransferase [Brucella sp. 83/13]
 gi|306274573|gb|EFM56362.1| ornithine carbamoyltransferase [Brucella sp. BO1]
 gi|306287453|gb|EFM58930.1| ornithine carbamoyltransferase [Brucella sp. BO2]
 gi|306406593|gb|EFM62826.1| ornithine carbamoyltransferase [Brucella sp. NF 2653]
          Length = 312

 Score =  432 bits (1110), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 198/298 (66%), Positives = 239/298 (80%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF DLS + ++ L  I+E AK  K   +     +P +GKVLAMIFEKPSTRTRVSF+V 
Sbjct: 8   KHFIDLSTVPATELRAILEDAKARKARLKAGEVERPYAGKVLAMIFEKPSTRTRVSFDVG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+GSEMQLGR+ETI DTAKVLSRYVDAI++RTT H R+LEL EYATVPVI
Sbjct: 68  MRQLGGETIMLTGSEMQLGRSETIADTAKVLSRYVDAIMIRTTAHERMLELAEYATVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+THPCQI+AD++T+EEHRG +KGK F+W GDGNN+LHSL+E AARF++ +NIATP
Sbjct: 128 NALTDDTHPCQIMADVLTYEEHRGPIKGKTFAWMGDGNNVLHSLVEAAARFDFNVNIATP 187

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            GSEP+++Y++WAR  GA +    D  +A  GA C+ TDTW+SM QE  AR  +VF P+Q
Sbjct: 188 KGSEPKSQYIDWARANGAGIMSTTDPEKAASGADCIVTDTWVSMGQEDHARGHNVFIPYQ 247

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN  LM+ A P ALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QKAIL WC 
Sbjct: 248 VNAHLMAKADPKALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKAILAWCL 305


>gi|148559340|ref|YP_001258339.1| ornithine carbamoyltransferase [Brucella ovis ATCC 25840]
 gi|166918647|sp|A5VNP2|OTC_BRUO2 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|148370597|gb|ABQ60576.1| ornithine carbamoyltransferase [Brucella ovis ATCC 25840]
          Length = 312

 Score =  431 bits (1109), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 197/298 (66%), Positives = 240/298 (80%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF DLS + ++ L  I+E AK  K   +     +P +GKVLAMIFEKPSTRTRVSF+V 
Sbjct: 8   KHFIDLSTVPATELRAILEDAKARKARLKAGEVERPYAGKVLAMIFEKPSTRTRVSFDVG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+GSEMQLGR+ETI DTAKVLSRYVDAI++RTT H R+LEL EYATVPVI
Sbjct: 68  MRQLGGETIMLTGSEMQLGRSETIADTAKVLSRYVDAIMIRTTAHERMLELAEYATVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+THPCQI+AD++T+EEHRG +KGK F+W GDGNN+LHSL+E AARF++ +NIATP
Sbjct: 128 NALTDDTHPCQIMADVLTYEEHRGPIKGKTFAWMGDGNNVLHSLVEAAARFDFNVNIATP 187

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            GSEP+++Y++WAR  GA +    D  +A  GA C+ TDTW+SM QE  AR  +VF P+Q
Sbjct: 188 KGSEPKSQYIDWARANGAGIMSTTDPEKAASGADCIVTDTWVSMGQEDHARGHNVFIPYQ 247

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN +LM+ A P ALFMHCLPAHRGEEV +EV+DGPQ+VVFDEAENRLH QKAIL WC 
Sbjct: 248 VNANLMAKADPKALFMHCLPAHRGEEVTDEVIDGPQAVVFDEAENRLHAQKAILAWCL 305


>gi|294851690|ref|ZP_06792363.1| ornithine carbamoyltransferase [Brucella sp. NVSL 07-0026]
 gi|294820279|gb|EFG37278.1| ornithine carbamoyltransferase [Brucella sp. NVSL 07-0026]
          Length = 312

 Score =  431 bits (1109), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 198/298 (66%), Positives = 239/298 (80%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF DLS + ++ L  I+E AK  K   +     +P +GKVLAMIFEKPSTRTRVSF+V 
Sbjct: 8   KHFIDLSTVPATELRAILEDAKARKARLKAGEVERPYAGKVLAMIFEKPSTRTRVSFDVG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L GSEMQLGR+ETI DTAKVLSRYVDAI++RTT H R+LEL EYATVPVI
Sbjct: 68  MRQLGGETIMLMGSEMQLGRSETIADTAKVLSRYVDAIMIRTTAHERMLELAEYATVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+THPCQI+AD++T+EEHRG +KGK F+W GDGNN+LHSL+E AARF++ +NIATP
Sbjct: 128 NALTDDTHPCQIMADVLTYEEHRGPIKGKTFAWMGDGNNVLHSLVEAAARFDFNVNIATP 187

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            GSEP+++Y++WAR  GA +    D  +A  GA C+ TDTW+SM QE  AR  +VF P+Q
Sbjct: 188 KGSEPKSQYIDWARANGAGIMSTTDPEKAASGADCIVTDTWVSMGQEDHARGHNVFIPYQ 247

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN +LM+ A P ALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QKAIL WC 
Sbjct: 248 VNANLMAKADPKALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKAILAWCL 305


>gi|23501209|ref|NP_697336.1| ornithine carbamoyltransferase [Brucella suis 1330]
 gi|163842587|ref|YP_001626991.1| ornithine carbamoyltransferase [Brucella suis ATCC 23445]
 gi|32699451|sp|Q8G2L7|OTC_BRUSU RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|23347089|gb|AAN29251.1| ornithine carbamoyltransferase [Brucella suis 1330]
 gi|163673310|gb|ABY37421.1| ornithine carbamoyltransferase [Brucella suis ATCC 23445]
          Length = 312

 Score =  431 bits (1107), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 197/298 (66%), Positives = 239/298 (80%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF DLS + ++ L  I+E AK  K   +     +P +GKVLAMIFEKPSTRTRVSF+V 
Sbjct: 8   KHFIDLSTVPATELRAILEDAKARKARLKAGEVERPYAGKVLAMIFEKPSTRTRVSFDVG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+GSEMQLGR+E I DTAKVLSRYVDAI++RTT H R+LEL EYATVPVI
Sbjct: 68  MRQLGGETIMLTGSEMQLGRSEAIADTAKVLSRYVDAIMIRTTAHERMLELAEYATVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+THPCQI+AD++T+EEHRG +KGK F+W GDGNN+LHSL+E AARF++ +NIATP
Sbjct: 128 NALTDDTHPCQIMADVLTYEEHRGPIKGKTFAWMGDGNNVLHSLVEAAARFDFNVNIATP 187

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            GSEP+++Y++WAR  GA +    D  +A  GA C+ TDTW+SM QE  AR  +VF P+Q
Sbjct: 188 KGSEPKSQYIDWARANGAGIMSTTDPEKAASGADCIVTDTWVSMGQEDHARGHNVFIPYQ 247

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN +LM+ A P ALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QKAIL WC 
Sbjct: 248 VNANLMAKADPKALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKAILAWCL 305


>gi|161618283|ref|YP_001592170.1| ornithine carbamoyltransferase [Brucella canis ATCC 23365]
 gi|254703669|ref|ZP_05165497.1| ornithine carbamoyltransferase [Brucella suis bv. 3 str. 686]
 gi|260567078|ref|ZP_05837548.1| ornithine carbamoyltransferase [Brucella suis bv. 4 str. 40]
 gi|261754309|ref|ZP_05998018.1| ornithine carbamoyltransferase [Brucella suis bv. 3 str. 686]
 gi|161335094|gb|ABX61399.1| ornithine carbamoyltransferase [Brucella canis ATCC 23365]
 gi|260156596|gb|EEW91676.1| ornithine carbamoyltransferase [Brucella suis bv. 4 str. 40]
 gi|261744062|gb|EEY31988.1| ornithine carbamoyltransferase [Brucella suis bv. 3 str. 686]
          Length = 312

 Score =  430 bits (1106), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 197/298 (66%), Positives = 239/298 (80%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF DLS + ++ L  I+E AK  K   +     +P +GKVLAMIFEKPSTRTRVSF+V 
Sbjct: 8   KHFIDLSTVPATELRAILEDAKARKARLKAGEVEQPYAGKVLAMIFEKPSTRTRVSFDVG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+GSEMQLGR+E I DTAKVLSRYVDAI++RTT H R+LEL EYATVPVI
Sbjct: 68  MRQLGGETIMLTGSEMQLGRSEAIADTAKVLSRYVDAIMIRTTAHERMLELAEYATVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+THPCQI+AD++T+EEHRG +KGK F+W GDGNN+LHSL+E AARF++ +NIATP
Sbjct: 128 NALTDDTHPCQIMADVLTYEEHRGPIKGKTFAWMGDGNNVLHSLVEAAARFDFNVNIATP 187

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            GSEP+++Y++WAR  GA +    D  +A  GA C+ TDTW+SM QE  AR  +VF P+Q
Sbjct: 188 KGSEPKSQYIDWARANGAGIMSTTDPEKAASGADCIVTDTWVSMGQEDHARGHNVFIPYQ 247

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN +LM+ A P ALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QKAIL WC 
Sbjct: 248 VNANLMAKADPKALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKAILAWCL 305


>gi|237814786|ref|ZP_04593784.1| ornithine carbamoyltransferase [Brucella abortus str. 2308 A]
 gi|17983638|gb|AAL52801.1| ornithine carbamoyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|237789623|gb|EEP63833.1| ornithine carbamoyltransferase [Brucella abortus str. 2308 A]
          Length = 323

 Score =  428 bits (1101), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 197/298 (66%), Positives = 239/298 (80%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF DLS + ++ L  I+E AK  K   +     +P +GKVLAMIFEK STRTRVSF+V 
Sbjct: 19  KHFIDLSTVPATELRAILEDAKARKARLKAGEVERPYAGKVLAMIFEKLSTRTRVSFDVG 78

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+GSEMQLGR+ETI DTAKVLSRYVDAI++RTT H R+LEL EYATVPVI
Sbjct: 79  MRQLGGETIMLTGSEMQLGRSETIADTAKVLSRYVDAIMIRTTAHERMLELAEYATVPVI 138

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+THPCQI+AD++T+EEHRG +KGK F+W GDGNN+LHSL+E AARF++ +NIATP
Sbjct: 139 NALTDDTHPCQIMADVLTYEEHRGPIKGKTFAWMGDGNNVLHSLVEAAARFDFNVNIATP 198

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            GSEP+++Y++WAR  GA +    D  +A  GA C+ TDTW+SM QE  AR  +VF P+Q
Sbjct: 199 KGSEPKSQYIDWARANGAGIMSTTDPEKAASGADCIVTDTWVSMGQEDHARGHNVFIPYQ 258

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN +LM+ A P ALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QKAIL WC 
Sbjct: 259 VNANLMAKADPKALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKAILAWCL 316


>gi|62289296|ref|YP_221089.1| ornithine carbamoyltransferase [Brucella abortus bv. 1 str. 9-941]
 gi|82699226|ref|YP_413800.1| ornithine carbamoyltransferase [Brucella melitensis biovar Abortus
           2308]
 gi|161511125|ref|NP_540537.2| ornithine carbamoyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|189023549|ref|YP_001934317.1| ornithine carbamoyltransferase [Brucella abortus S19]
 gi|225851848|ref|YP_002732081.1| ornithine carbamoyltransferase [Brucella melitensis ATCC 23457]
 gi|254688614|ref|ZP_05151868.1| ornithine carbamoyltransferase [Brucella abortus bv. 6 str. 870]
 gi|254693096|ref|ZP_05154924.1| ornithine carbamoyltransferase [Brucella abortus bv. 3 str. Tulya]
 gi|254696737|ref|ZP_05158565.1| ornithine carbamoyltransferase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254729647|ref|ZP_05188225.1| ornithine carbamoyltransferase [Brucella abortus bv. 4 str. 292]
 gi|256044029|ref|ZP_05446940.1| ornithine carbamoyltransferase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256112825|ref|ZP_05453746.1| ornithine carbamoyltransferase [Brucella melitensis bv. 3 str.
           Ether]
 gi|256256862|ref|ZP_05462398.1| ornithine carbamoyltransferase [Brucella abortus bv. 9 str. C68]
 gi|256264637|ref|ZP_05467169.1| ornithine carbamoyltransferase [Brucella melitensis bv. 2 str.
           63/9]
 gi|260545949|ref|ZP_05821690.1| ornithine carbamoyltransferase [Brucella abortus NCTC 8038]
 gi|260563389|ref|ZP_05833875.1| ornithine carbamoyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|260754086|ref|ZP_05866434.1| ornithine carbamoyltransferase [Brucella abortus bv. 6 str. 870]
 gi|260757307|ref|ZP_05869655.1| ornithine carbamoyltransferase [Brucella abortus bv. 4 str. 292]
 gi|260761130|ref|ZP_05873473.1| ornithine carbamoyltransferase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883113|ref|ZP_05894727.1| ornithine carbamoyltransferase [Brucella abortus bv. 9 str. C68]
 gi|261213332|ref|ZP_05927613.1| ornithine carbamoyltransferase [Brucella abortus bv. 3 str. Tulya]
 gi|265990441|ref|ZP_06102998.1| ornithine carbamoyltransferase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265994269|ref|ZP_06106826.1| ornithine carbamoyltransferase [Brucella melitensis bv. 3 str.
           Ether]
 gi|297247713|ref|ZP_06931431.1| ornithine carbamoyltransferase [Brucella abortus bv. 5 str. B3196]
 gi|32699464|sp|Q8YFA2|OTC_BRUME RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|75497348|sp|Q57F56|OTC_BRUAB RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|123546920|sp|Q2YPH2|OTC_BRUA2 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|62195428|gb|AAX73728.1| ArgF, ornithine carbamoyltransferase [Brucella abortus bv. 1 str.
           9-941]
 gi|82615327|emb|CAJ10288.1| Aspartate carbamoyltransferase:Ornithine
           carbamoyltransferase:Aspartate/ornithine
           carbamoyltransferase:Aspartate/ornithine ca [Brucella
           melitensis biovar Abortus 2308]
 gi|189019121|gb|ACD71843.1| ornithine carbamoyltransferase [Brucella abortus S19]
 gi|225640213|gb|ACO00127.1| ornithine carbamoyltransferase [Brucella melitensis ATCC 23457]
 gi|260097356|gb|EEW81231.1| ornithine carbamoyltransferase [Brucella abortus NCTC 8038]
 gi|260153405|gb|EEW88497.1| ornithine carbamoyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|260667625|gb|EEX54565.1| ornithine carbamoyltransferase [Brucella abortus bv. 4 str. 292]
 gi|260671562|gb|EEX58383.1| ornithine carbamoyltransferase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260674194|gb|EEX61015.1| ornithine carbamoyltransferase [Brucella abortus bv. 6 str. 870]
 gi|260872641|gb|EEX79710.1| ornithine carbamoyltransferase [Brucella abortus bv. 9 str. C68]
 gi|260914939|gb|EEX81800.1| ornithine carbamoyltransferase [Brucella abortus bv. 3 str. Tulya]
 gi|262765382|gb|EEZ11171.1| ornithine carbamoyltransferase [Brucella melitensis bv. 3 str.
           Ether]
 gi|263001225|gb|EEZ13800.1| ornithine carbamoyltransferase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263095004|gb|EEZ18712.1| ornithine carbamoyltransferase [Brucella melitensis bv. 2 str.
           63/9]
 gi|297174882|gb|EFH34229.1| ornithine carbamoyltransferase [Brucella abortus bv. 5 str. B3196]
 gi|326408344|gb|ADZ65409.1| ornithine carbamoyltransferase [Brucella melitensis M28]
 gi|326538058|gb|ADZ86273.1| ornithine carbamoyltransferase [Brucella melitensis M5-90]
          Length = 312

 Score =  428 bits (1101), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 197/298 (66%), Positives = 239/298 (80%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF DLS + ++ L  I+E AK  K   +     +P +GKVLAMIFEK STRTRVSF+V 
Sbjct: 8   KHFIDLSTVPATELRAILEDAKARKARLKAGEVERPYAGKVLAMIFEKLSTRTRVSFDVG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+GSEMQLGR+ETI DTAKVLSRYVDAI++RTT H R+LEL EYATVPVI
Sbjct: 68  MRQLGGETIMLTGSEMQLGRSETIADTAKVLSRYVDAIMIRTTAHERMLELAEYATVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+THPCQI+AD++T+EEHRG +KGK F+W GDGNN+LHSL+E AARF++ +NIATP
Sbjct: 128 NALTDDTHPCQIMADVLTYEEHRGPIKGKTFAWMGDGNNVLHSLVEAAARFDFNVNIATP 187

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            GSEP+++Y++WAR  GA +    D  +A  GA C+ TDTW+SM QE  AR  +VF P+Q
Sbjct: 188 KGSEPKSQYIDWARANGAGIMSTTDPEKAASGADCIVTDTWVSMGQEDHARGHNVFIPYQ 247

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN +LM+ A P ALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QKAIL WC 
Sbjct: 248 VNANLMAKADPKALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKAILAWCL 305


>gi|319406504|emb|CBI80146.1| Ornithine carbamoyltransferase [Bartonella sp. 1-1C]
          Length = 313

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 188/301 (62%), Positives = 239/301 (79%), Gaps = 6/301 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIK---NSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           +HF D+S ++      +I+ AK +K    S EN+   KP +GK LAMIFEKPSTRTRVSF
Sbjct: 6   RHFTDISILTPQRARALIDYAKTLKAAFKSGENL---KPFAGKTLAMIFEKPSTRTRVSF 62

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           ++ M+ LGG+TI L+GSEMQLG +ETI DTA+VLSR+V+AI++RTT H R+LEL +YA +
Sbjct: 63  DLGMRQLGGETIMLTGSEMQLGHSETIADTARVLSRFVEAIIIRTTAHHRMLELAQYAQI 122

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVINALTD+THPCQI+ADI+T+EEHRG++ GK F+W GDGNN+LHSLIE  A FN+ L+I
Sbjct: 123 PVINALTDDTHPCQILADILTYEEHRGTIAGKTFAWMGDGNNVLHSLIEATALFNFHLHI 182

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQ 242
           ATP GSEP+ +Y+NWAR +GA + L H+  +A +   C+ TDTW+SM QEF A+   +FQ
Sbjct: 183 ATPQGSEPQEKYINWARERGAHIMLTHNPQKAAENVDCIITDTWVSMGQEFHAKNYSIFQ 242

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           P+QVN +LM+ A PDALFMHCLPAHRGEEV++ V+DGP SVVFDEAENRLH QKAIL WC
Sbjct: 243 PYQVNEALMAFAKPDALFMHCLPAHRGEEVVDAVIDGPHSVVFDEAENRLHAQKAILSWC 302

Query: 303 F 303
            
Sbjct: 303 L 303


>gi|319403590|emb|CBI77175.1| Ornithine carbamoyltransferase [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 313

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 189/300 (63%), Positives = 239/300 (79%), Gaps = 6/300 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIK---NSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
           HF D+S ++      +I+ AK +K    S EN+   KP SGK LAMIFEKPSTRTRVSF+
Sbjct: 7   HFTDISILTPQRARALIDYAKILKAAFKSGENL---KPFSGKTLAMIFEKPSTRTRVSFD 63

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           + M+ LGG+TI L+GSEMQLG +ETI DTA+VLSR+V+AI++RTT H R+LEL +YA +P
Sbjct: 64  LGMRQLGGETIMLTGSEMQLGHSETIADTARVLSRFVEAIIIRTTAHHRMLELAQYAQIP 123

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINALTD+THPCQI+ADI+T+EEHRG++ GK F+W GDGNN+LHSLIE  A FN+ L+IA
Sbjct: 124 VINALTDDTHPCQILADILTYEEHRGTIAGKTFAWMGDGNNVLHSLIEATALFNFHLHIA 183

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQP 243
           TP GSEP+ +Y+NWAR +GA + L H+  +A +   C+ TDTW+SM QEF+A+   +FQP
Sbjct: 184 TPQGSEPQEKYINWARERGAHIMLTHNPQKAAENVDCIITDTWVSMGQEFRAQNYSIFQP 243

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +QVN +LM+ A PDALFMHCLPAHRGEEV++ V+DGP SVVFDEAENRLH QKAIL WC 
Sbjct: 244 YQVNEALMACAKPDALFMHCLPAHRGEEVVDAVIDGPHSVVFDEAENRLHAQKAILSWCL 303


>gi|90418944|ref|ZP_01226855.1| ornithine carbamoyltransferase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337024|gb|EAS50729.1| ornithine carbamoyltransferase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 317

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 191/303 (63%), Positives = 237/303 (78%), Gaps = 2/303 (0%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M   PKHF D+S + S +L  II+ A + K    +    KPL+GKVLAMIF+KPSTRTRV
Sbjct: 3   MANGPKHFLDISAVPSRDLHDIIDDAARRKALGRD--GPKPLAGKVLAMIFDKPSTRTRV 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF+V M+ LGG+T+FLSG+EMQLGR+ETI DTA+VLSRYVDAI++RTT H RL E+ +YA
Sbjct: 61  SFDVGMRQLGGETLFLSGTEMQLGRSETIADTARVLSRYVDAIMIRTTTHDRLTEMAQYA 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVIN LTD+THPCQI+ D++TFEE RG V+GK F+W+GDGNN+L S +E +ARF++ L
Sbjct: 121 TVPVINGLTDDTHPCQIMTDLLTFEEKRGPVRGKTFAWTGDGNNVLSSFVEASARFSFNL 180

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            IATP GS P   ++  AR  GAS+ +  D V+AV GA CV TDTW+SM +E +AR  +V
Sbjct: 181 TIATPAGSGPDMRFVERARKDGASILITEDPVEAVTGADCVVTDTWVSMGREEQARGHNV 240

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F P+QVN  LM+ A P+ALFMHCLPAHRGEEV + V+DGPQSVVFDEAENRLH QK+IL 
Sbjct: 241 FMPYQVNERLMAHAKPEALFMHCLPAHRGEEVTDAVMDGPQSVVFDEAENRLHAQKSILA 300

Query: 301 WCF 303
           WCF
Sbjct: 301 WCF 303


>gi|121602135|ref|YP_989540.1| ornithine carbamoyltransferase [Bartonella bacilliformis KC583]
 gi|120614312|gb|ABM44913.1| ornithine carbamoyltransferase [Bartonella bacilliformis KC583]
          Length = 310

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 184/298 (61%), Positives = 232/298 (77%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF DLS ++      +I+ AK +K + +    +KP  GK LAMIFEKPSTRTRVSF++ 
Sbjct: 6   RHFTDLSILTPQTARTLIDYAKTLKKTFKEGKASKPFVGKTLAMIFEKPSTRTRVSFDIG 65

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGGDT+ L+GSEMQLG +ETI DTA+VLSR+VD I++RT  H R+LEL +YA VPVI
Sbjct: 66  MRQLGGDTLMLTGSEMQLGHSETIADTARVLSRFVDIILLRTAAHHRMLELAQYAQVPVI 125

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+THPCQI+ADI+T+EEHRG +  K+F+W GDGNN+LHSLIE  A F++ L  ATP
Sbjct: 126 NALTDDTHPCQILADILTYEEHRGPIASKIFAWVGDGNNVLHSLIEATALFDFHLRFATP 185

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            GSEP+  Y+NWAR +GA +   H+  + V+ A C+ TDTWISM QEF+AR   +FQP+Q
Sbjct: 186 QGSEPQARYINWARERGAHITCTHNPQETVENADCIITDTWISMGQEFRARNHSIFQPYQ 245

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN +L+ +A PDALFMHCLPAHRGEEV++ V+DGP SVVFDEAENRLH QKAIL WC 
Sbjct: 246 VNEALIKLAKPDALFMHCLPAHRGEEVVDSVIDGPHSVVFDEAENRLHIQKAILSWCL 303


>gi|319898298|ref|YP_004158391.1| Ornithine carbamoyltransferase (OTCase) [Bartonella clarridgeiae
           73]
 gi|319402262|emb|CBI75801.1| Ornithine carbamoyltransferase (OTCase) [Bartonella clarridgeiae
           73]
          Length = 310

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 183/298 (61%), Positives = 236/298 (79%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF D+S ++      +I+ AK +K + +    +KP +GK LAMIFEKPSTRTRVSF++ 
Sbjct: 6   RHFTDISILTPQQARALIDYAKILKTAFKAGESSKPFAGKTLAMIFEKPSTRTRVSFDLG 65

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+GSEMQLG +ETI DTA+VLSR+V+ I++RTT H R+LEL +YA +P+I
Sbjct: 66  MRQLGGETIMLTGSEMQLGNSETIADTARVLSRFVEIIILRTTAHHRMLELAQYAQIPII 125

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+THPCQI+ADI+T+EEHRG + GK F+W GDGNN+LHSLIE  A FN+ L+IATP
Sbjct: 126 NALTDDTHPCQILADILTYEEHRGPIVGKTFAWMGDGNNVLHSLIEATAIFNFHLHIATP 185

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            GSEP+ +Y+NWAR +GA + L  +  +A +   C+ TDTW+SM QEF+AR   +FQP+Q
Sbjct: 186 QGSEPQEKYVNWARERGAHIMLTQNPQKAAENVDCIITDTWVSMGQEFRARGRSIFQPYQ 245

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN +LM+ A PDALFMHCLPAHRGEEV++ V+DGP SVVFDEAENRLH QKAIL WC 
Sbjct: 246 VNEALMAYAKPDALFMHCLPAHRGEEVVDAVIDGPNSVVFDEAENRLHAQKAILSWCL 303


>gi|319785567|ref|YP_004145043.1| ornithine carbamoyltransferase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317171455|gb|ADV14993.1| ornithine carbamoyltransferase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 303

 Score =  411 bits (1057), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 188/299 (62%), Positives = 232/299 (77%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF DLS +S  +L  +++ A   K   +     KPL GKVLAMIF+KPSTRTRVSF+V 
Sbjct: 4   RHFTDLSTVSEGDLRLMLDDAVVRKARLKAGERTKPLEGKVLAMIFDKPSTRTRVSFDVG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+G+EMQLGR+ETI DTAKVLSRYVDAI++RTT+H RLLELTE ATVPVI
Sbjct: 64  MRQLGGETIMLTGTEMQLGRSETIADTAKVLSRYVDAIMIRTTSHERLLELTENATVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+THPCQ++ADIMTFEEHRG V GK  +W+GDGNN+LHSL+E +ARF + LN+A P
Sbjct: 124 NGLTDDTHPCQLMADIMTFEEHRGPVAGKTIAWTGDGNNVLHSLLEASARFRFNLNVAVP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            GSEP  ++++W++  G  +       +AV  A C+ TD W+SM QE +AR  +VF P+Q
Sbjct: 184 EGSEPAQKHIDWSQAHGGKLHFTRSPEEAVDQADCIVTDCWVSMGQEHRARGHNVFSPYQ 243

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           VN  LM+ A PDALFMHCLPAHRGEEV +EV+DGP SVVFDEAENRLH QKA+L WC G
Sbjct: 244 VNAKLMARAKPDALFMHCLPAHRGEEVTDEVIDGPHSVVFDEAENRLHAQKAVLAWCLG 302


>gi|13474701|ref|NP_106270.1| ornithine carbamoyltransferase [Mesorhizobium loti MAFF303099]
 gi|32699476|sp|Q98BB6|OTC_RHILO RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|14025456|dbj|BAB52056.1| ornithine carbamoyltransferase [Mesorhizobium loti MAFF303099]
          Length = 303

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 188/299 (62%), Positives = 232/299 (77%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF DLS +S  +L  +++ A   K   +     +PL GKVLAMIF+KPSTRTRVSF+V 
Sbjct: 4   RHFTDLSTVSEGDLRFMLDDAVVRKARLKAGERTRPLEGKVLAMIFDKPSTRTRVSFDVG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+G+EMQLGR+ETI DTAKVLSRYVDAI++RTT+H RLLELTE ATVPVI
Sbjct: 64  MRQLGGETIMLTGTEMQLGRSETIADTAKVLSRYVDAIMIRTTSHDRLLELTENATVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+THPCQ++ADIMTFEEHRG V GK  +W+GDGNN+LHSL+E +ARF + LN+A P
Sbjct: 124 NGLTDDTHPCQLMADIMTFEEHRGPVAGKTIAWTGDGNNVLHSLLEASARFRFNLNVAVP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            GSEP  ++++W++  G  +       +AV  A CV TD W+SM QE +AR  +VF P+Q
Sbjct: 184 EGSEPAQKHIDWSKAHGGKLHFTRSPEEAVDQADCVVTDCWVSMGQEHRARGHNVFSPYQ 243

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           VN  LM+ A PDALFMHCLPAHRGEEV +EV+DGP SVVFDEAENRLH QKA+L WC G
Sbjct: 244 VNAKLMAHAKPDALFMHCLPAHRGEEVTDEVIDGPHSVVFDEAENRLHAQKAVLAWCLG 302


>gi|240849780|ref|YP_002971168.1| ornithine carbamoyltransferase [Bartonella grahamii as4aup]
 gi|240266903|gb|ACS50491.1| ornithine carbamoyltransferase [Bartonella grahamii as4aup]
          Length = 311

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 182/298 (61%), Positives = 236/298 (79%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF DLS ++ +    +I+ AK +K S +    +KP  GK LAMIFEKPSTRTR+SF+++
Sbjct: 6   RHFTDLSILTPAIARALIDYAKILKASFKAGKGSKPFIGKTLAMIFEKPSTRTRISFDIS 65

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGGDTI L+GSEMQLG +ETI DTA+VLSR+VD +++RTT H R+LEL +YA +PVI
Sbjct: 66  MRQLGGDTIMLTGSEMQLGHSETIADTARVLSRFVDIVILRTTKHQRMLELAQYAQIPVI 125

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+THPCQI+ADI+T+EEHRG + GK+F+W GDGNN+LHSLIE AA F++ L IATP
Sbjct: 126 NALTDDTHPCQILADILTYEEHRGPIAGKIFAWMGDGNNVLHSLIEAAALFDFHLRIATP 185

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            GSEP+ ++++WAR +GA + L H   +A + A C+ TDTW+SM QEF+AR   +F P+Q
Sbjct: 186 KGSEPQEKFIHWARERGAHLTLTHSPQKAAQDADCIMTDTWVSMGQEFRARSHSIFLPYQ 245

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN +LM +A  DALFMHCLPAHRGEEV++ ++DG  SVVFDEAENRLH QKAIL WC 
Sbjct: 246 VNEALMKLAKSDALFMHCLPAHRGEEVVDSIIDGLHSVVFDEAENRLHVQKAILSWCL 303


>gi|260461908|ref|ZP_05810153.1| ornithine carbamoyltransferase [Mesorhizobium opportunistum
           WSM2075]
 gi|259032155|gb|EEW33421.1| ornithine carbamoyltransferase [Mesorhizobium opportunistum
           WSM2075]
          Length = 303

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 187/299 (62%), Positives = 232/299 (77%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF DLS +S  +L  ++  A   K   +    +KPL GKVLAMIF+KPSTRTRVSF+V 
Sbjct: 4   RHFTDLSAVSEGDLRFMLTDAVARKERLKAGERSKPLEGKVLAMIFDKPSTRTRVSFDVG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+G+EMQLGR+ETI DTAKVLSRYVDAI++RTT+H RLLELTE AT+PVI
Sbjct: 64  MRQLGGETIMLTGTEMQLGRSETIADTAKVLSRYVDAIMIRTTSHERLLELTENATIPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+THPCQ++ADIMTFEEHRG V GK  +W+GDGNN+LHSL+E +ARF + LN+A P
Sbjct: 124 NGLTDDTHPCQLMADIMTFEEHRGPVAGKTIAWTGDGNNVLHSLLEASARFRFNLNVAVP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            GSEP  ++++W++  G  +       +AV  A C+ TD W+SM QE +AR  +VF P+Q
Sbjct: 184 EGSEPAQKHIDWSQANGGKLHFTRSPEEAVDQADCIVTDCWVSMGQEHRARGHNVFSPYQ 243

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           VN  LM+ A PDALFMHCLPAHRGEEV +EV+DGP SVVFDEAENRLH QKA+L WC G
Sbjct: 244 VNAKLMARAKPDALFMHCLPAHRGEEVTDEVIDGPHSVVFDEAENRLHAQKAVLAWCLG 302


>gi|114704458|ref|ZP_01437366.1| ornithine carbamoyltransferase [Fulvimarina pelagi HTCC2506]
 gi|114539243|gb|EAU42363.1| ornithine carbamoyltransferase [Fulvimarina pelagi HTCC2506]
          Length = 308

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 192/299 (64%), Positives = 234/299 (78%), Gaps = 2/299 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF D++ + SS+L  II  A  +   + +  + KPL GKVLAMIF+KPSTRTRVSF+V 
Sbjct: 2   KHFLDIAAVDSSDLRTII--ADAMHRKTLDGRQAKPLEGKVLAMIFDKPSTRTRVSFDVG 59

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+T+FLSG+EMQLGR+ETI DTAKV+SRYVDAI++RTT H+RLLEL E ATVPVI
Sbjct: 60  MRQLGGETLFLSGTEMQLGRSETIADTAKVMSRYVDAIMIRTTEHARLLELAESATVPVI 119

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+THPCQI+ADI+TFEE RG VKGK F+W GDGNN+  S IE AARF + + IATP
Sbjct: 120 NGLTDDTHPCQIMADILTFEEKRGPVKGKTFAWVGDGNNVTASWIEAAARFEFKMTIATP 179

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            GSE    ++ WARN+GA +    D V+AV GA CV TDTW+SM +E +AR  +VF P+Q
Sbjct: 180 EGSEADARFVTWARNEGAEILTTTDPVEAVNGADCVITDTWVSMGREAQARGHNVFMPYQ 239

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           VN +LM  A  +ALFMHCLPAHRGEEV + V+DGPQSVVFDEAENRLH QK+I+ W FG
Sbjct: 240 VNENLMRHAKSEALFMHCLPAHRGEEVTDGVMDGPQSVVFDEAENRLHAQKSIIAWVFG 298


>gi|304392361|ref|ZP_07374302.1| ornithine carbamoyltransferase [Ahrensia sp. R2A130]
 gi|303295465|gb|EFL89824.1| ornithine carbamoyltransferase [Ahrensia sp. R2A130]
          Length = 305

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 181/299 (60%), Positives = 225/299 (75%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF DL+ +    L  I++ A  +K +++     +PL GKVLAMIF+KPSTRTRVSF+V 
Sbjct: 3   KHFLDLAAVDGGELRSILDGAVAMKTATKQGASPRPLEGKVLAMIFDKPSTRTRVSFDVG 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L G+  QLGR ET+ DTA+VLSRYVDAI++RTT+H RLLEL ++ATVPVI
Sbjct: 63  MRQLGGETIILDGASSQLGRGETVADTARVLSRYVDAIMIRTTSHDRLLELAQHATVPVI 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD THPCQI+AD+MT+EEHRG + GK ++W+GDGNN+LHS++E +ARF + L  ATP
Sbjct: 123 NGLTDETHPCQIMADVMTYEEHRGPIAGKTWAWTGDGNNVLHSMLEASARFGFRLRAATP 182

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
               P   Y+NWA  +G +V +  DA  AVK A CV TDTW SM  E ++   + F P+Q
Sbjct: 183 AKHGPMERYVNWAEVEGGNVTMLRDAEDAVKNADCVVTDTWESMGMEDESGGHNTFAPYQ 242

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           VN  LM+ A PDALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK IL WC G
Sbjct: 243 VNADLMAKAAPDALFMHCLPAHRGEEVTDEVMDGPQSVVFDEAENRLHAQKGILAWCLG 301


>gi|115526871|ref|YP_783782.1| ornithine carbamoyltransferase [Rhodopseudomonas palustris BisA53]
 gi|122294390|sp|Q07GY2|OTC_RHOP5 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|115520818|gb|ABJ08802.1| ornithine carbamoyltransferase [Rhodopseudomonas palustris BisA53]
          Length = 312

 Score =  388 bits (996), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 180/311 (57%), Positives = 225/311 (72%), Gaps = 5/311 (1%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIE--VAKKIKNSSE---NIFENKPLSGKVLAMIFEKPS 55
           M   P+HF DL  + +  L  +++  VA K K  S+   N    KPL GK LAMIFE+PS
Sbjct: 1   MSNAPRHFLDLDEMPTKELRAVLDAGVALKAKLKSQKARNTLREKPLEGKTLAMIFERPS 60

Query: 56  TRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLE 115
           TRTRVSF+V M+ LGG++I L+G+EMQLGR ETI DTA+VLSRYVDAI++R  NH  LLE
Sbjct: 61  TRTRVSFDVGMRQLGGESIMLTGAEMQLGRGETIADTARVLSRYVDAIMIRILNHDALLE 120

Query: 116 LTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAAR 175
           L E+ATVPVIN LT  +HPCQ++AD+MTFEEHRG ++G+  +W+GD NN+L S    A R
Sbjct: 121 LAEFATVPVINGLTRRSHPCQVMADLMTFEEHRGPIEGRTIAWTGDDNNVLASWAHAAER 180

Query: 176 FNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA 235
           FN+ L IATP    P     +W ++ GAS+ L  D  +AV+GA CV TDTW+SM  +   
Sbjct: 181 FNFTLRIATPPELAPGKPMRDWIKSSGASIVLGTDPEEAVRGADCVLTDTWVSMGDKDGE 240

Query: 236 REEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
              ++ +P+QVN  LMS+A PDALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH Q
Sbjct: 241 HRHNLLKPYQVNTQLMSLAKPDALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQ 300

Query: 296 KAILLWCFGII 306
           K IL WCFG +
Sbjct: 301 KGILAWCFGAV 311


>gi|86747910|ref|YP_484406.1| ornithine carbamoyltransferase [Rhodopseudomonas palustris HaA2]
 gi|86570938|gb|ABD05495.1| ornithine carbamoyltransferase [Rhodopseudomonas palustris HaA2]
          Length = 328

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 178/308 (57%), Positives = 223/308 (72%), Gaps = 3/308 (0%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIE--VAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRT 58
           M + P+HF DL+ + +S L  ++   VA K K  + N   +KPL+GK LAMIFEKPSTRT
Sbjct: 21  MTSAPRHFLDLTEVPTSELRNMLAAGVAMKAKRKA-NADADKPLAGKTLAMIFEKPSTRT 79

Query: 59  RVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTE 118
           RVSF+V M+ LGG++I L+G+EMQLGR ETI DTA+VLSR+VD I++R  NH  LLEL  
Sbjct: 80  RVSFDVGMRQLGGESIMLTGAEMQLGRGETIADTARVLSRFVDIIMIRILNHDSLLELAA 139

Query: 119 YATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNY 178
            ATVPVIN LT  +HPCQ++AD+MTFEEHRG +KG   +W+GD NN+L S    A RF++
Sbjct: 140 NATVPVINGLTRKSHPCQVMADVMTFEEHRGPIKGATVAWTGDDNNVLASWAHAAQRFDF 199

Query: 179 LLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE 238
            LNIATP    P     +W +  GA++ L  DA  AV+GA CV TDTW+SM  +      
Sbjct: 200 RLNIATPPQLAPNKAMRDWIKTSGAAITLGSDAEAAVRGADCVVTDTWVSMGDKDGEHRH 259

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
           ++ +PFQVN  LMS+AH DA+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK I
Sbjct: 260 NLLKPFQVNAKLMSLAHKDAIFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKGI 319

Query: 299 LLWCFGII 306
           L WC G +
Sbjct: 320 LAWCLGAV 327


>gi|91975376|ref|YP_568035.1| ornithine carbamoyltransferase [Rhodopseudomonas palustris BisB5]
 gi|91681832|gb|ABE38134.1| ornithine carbamoyltransferase [Rhodopseudomonas palustris BisB5]
          Length = 316

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 178/307 (57%), Positives = 220/307 (71%), Gaps = 1/307 (0%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSE-NIFENKPLSGKVLAMIFEKPSTRTR 59
           M   P+HF DLS + +S L  ++     IK   + NI  +KPL+GK LAMIFEKPSTRTR
Sbjct: 9   MNNAPRHFLDLSELPTSELRNMLAAGVAIKAKRKANIEPDKPLAGKTLAMIFEKPSTRTR 68

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V M+ LGG+ I L+G+EMQLGR ETI DTA+VLSR+VD I++R  NH  LLEL   
Sbjct: 69  VSFDVGMRQLGGEAIMLTGAEMQLGRGETIADTARVLSRFVDIIMIRILNHDSLLELAAN 128

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ATVPVIN LT  +HPCQ++AD+MTFEEHRGS+KG   +W+GD NN+L S    A RF + 
Sbjct: 129 ATVPVINGLTRKSHPCQVMADVMTFEEHRGSIKGATVAWTGDDNNVLASWAHAAQRFEFN 188

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L IATP    P     +W +  GA V L +DA +AV+GA CV TDTW+SM  +      +
Sbjct: 189 LKIATPPQLAPNKAMRDWIKASGAQVTLGNDAEEAVRGADCVVTDTWVSMGDKDGEHRHN 248

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + +P+QVN  LMS+AH DA+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK IL
Sbjct: 249 LLKPYQVNSKLMSLAHKDAIFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKGIL 308

Query: 300 LWCFGII 306
            WC G +
Sbjct: 309 AWCLGAV 315


>gi|182677152|ref|YP_001831298.1| ornithine carbamoyltransferase [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182633035|gb|ACB93809.1| ornithine carbamoyltransferase [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 319

 Score =  379 bits (972), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 174/308 (56%), Positives = 227/308 (73%), Gaps = 3/308 (0%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAK--KIKNSSENIFENKPLSGKVLAMIFEKPSTRT 58
           ++  PKHF DLS + + +L  I+++A   K K       + +PL GKVLAM+F++PSTRT
Sbjct: 9   LIVQPKHFLDLSRLEAKDLRAILDLAAGLKAKRRRGQKAKEQPLEGKVLAMVFDQPSTRT 68

Query: 59  RVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTE 118
           RVSF++AM+ LGG+TI L+G EMQLGR ETI DTA+VLSR+VDAIV+R  NH+ LLEL E
Sbjct: 69  RVSFDLAMRELGGETIMLTGQEMQLGRGETIADTARVLSRFVDAIVIRILNHADLLELAE 128

Query: 119 YATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNY 178
           YA VPVIN LT  +HPCQI+AD++TFEEHRG +KG+  +W+GD NN+L S IE A R ++
Sbjct: 129 YAEVPVINGLTKLSHPCQIMADLLTFEEHRGPIKGRTIAWTGDSNNVLASWIEAARRLDF 188

Query: 179 LLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKARE 237
            LN+A P    P  E + +A  QG  + +  D  +AV+GA  V +D W+SM ++E +AR 
Sbjct: 189 TLNVACPAELSPAPELVAFANAQGKRLNVLRDPFEAVRGADAVISDCWVSMGDEEEEARR 248

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
           + +  P+QVN  LM+ A  DA+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK 
Sbjct: 249 QALLSPYQVNAELMATAAKDAIFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKG 308

Query: 298 ILLWCFGI 305
           IL WCFG+
Sbjct: 309 ILAWCFGV 316


>gi|298294427|ref|YP_003696366.1| ornithine carbamoyltransferase [Starkeya novella DSM 506]
 gi|296930938|gb|ADH91747.1| ornithine carbamoyltransferase [Starkeya novella DSM 506]
          Length = 316

 Score =  377 bits (969), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 171/298 (57%), Positives = 219/298 (73%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF DL  +    L  ++ ++  +K+    I   KP +GKVLAM+F++PSTRTR+SF+VA
Sbjct: 14  KHFLDLDTLPPDELRALMRLSHDLKSRRHEIAAEKPFAGKVLAMVFDQPSTRTRISFDVA 73

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+G+EMQLGR ETI DTAKVLSRYVDAI++R  +H  L EL  +ATVPVI
Sbjct: 74  MRQLGGETIMLTGAEMQLGRGETIADTAKVLSRYVDAIMIRILDHRALEELAAHATVPVI 133

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT  +HPCQI+AD+MTFEEH+G + G+  +W+GD NN+L S I  A RF++ LN+ATP
Sbjct: 134 NGLTRESHPCQIMADVMTFEEHKGPIAGRTVAWTGDANNVLASWIHAAQRFDFALNVATP 193

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
               PR   ++WAR+ GA V   +DA +AV+GA CV TDTW+SM      R  ++ +P+Q
Sbjct: 194 PELAPRPALVDWARSNGAKVRFGNDADEAVEGADCVVTDTWVSMGDAEYERRHNLLRPYQ 253

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN +LM  A P A+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK IL WC 
Sbjct: 254 VNGALMRRAAPGAIFMHCLPAHRGEEVTDEVMDGPQSVVFDEAENRLHAQKGILAWCL 311


>gi|192293615|ref|YP_001994220.1| ornithine carbamoyltransferase [Rhodopseudomonas palustris TIE-1]
 gi|192287364|gb|ACF03745.1| ornithine carbamoyltransferase [Rhodopseudomonas palustris TIE-1]
          Length = 309

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 171/303 (56%), Positives = 220/303 (72%), Gaps = 1/303 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSE-NIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
           P+HF DL+ + +S L  ++  A  +K   + N   +KPL+GK LAMIF+KPSTRTRVSF+
Sbjct: 6   PRHFLDLTELPTSELRNMLSAAVAMKAKRKANADGDKPLAGKTLAMIFDKPSTRTRVSFD 65

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M+ LGG++I L+G+EMQLGR ETI DTA+VLSR+VD I++R  NH  LLEL   ATVP
Sbjct: 66  VGMRQLGGESIMLTGAEMQLGRGETIADTARVLSRFVDIIMIRILNHEALLELAANATVP 125

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LT  +HPCQ++AD+MTFEEHRG +KG+  +W+GD NN+L S    A RF + LNIA
Sbjct: 126 VINGLTRKSHPCQVMADVMTFEEHRGPIKGRTIAWTGDDNNVLASFAHAAQRFEFKLNIA 185

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQP 243
           TP    P     +W +  GA++ +  D  +AV+GA CV TDTW+SM  +      ++ +P
Sbjct: 186 TPPQLSPSKALRDWIKQSGAAITIGTDPEEAVRGADCVVTDTWVSMGDKDGEHRHNLLKP 245

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +QVN  LMS+AH DA+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK IL WC 
Sbjct: 246 YQVNAKLMSLAHKDAIFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKGILAWCL 305

Query: 304 GII 306
           G +
Sbjct: 306 GAV 308


>gi|316936253|ref|YP_004111235.1| ornithine carbamoyltransferase [Rhodopseudomonas palustris DX-1]
 gi|315603967|gb|ADU46502.1| ornithine carbamoyltransferase [Rhodopseudomonas palustris DX-1]
          Length = 311

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 171/303 (56%), Positives = 220/303 (72%), Gaps = 1/303 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSE-NIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
           P+HF DL+ + +S L  ++  A  +K   + N   +KPL+GK LAMIF+KPSTRTRVSF+
Sbjct: 8   PRHFLDLTELPTSELRSMLAAAVAMKAKRKANAEADKPLAGKTLAMIFDKPSTRTRVSFD 67

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M+ LGG++I L+G EMQLGR ETI DTA+VLSR+VD I++R  NH  LLEL   ATVP
Sbjct: 68  VGMRQLGGESIMLTGQEMQLGRGETIADTARVLSRFVDIIMIRILNHEALLELAANATVP 127

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LT  +HPCQ++AD+MTFEEHRG +KG+  +W+GD NN+L S    AA F++ LN+A
Sbjct: 128 VINGLTRKSHPCQVMADVMTFEEHRGPIKGRTIAWTGDDNNVLASFAHAAACFDFKLNVA 187

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQP 243
           TP    P     +W +  GA++ +  D  QAV+GA CV TDTW+SM  +      ++ +P
Sbjct: 188 TPPQLAPNKALRDWIKASGAAITIGTDPEQAVRGADCVVTDTWVSMGDKDGEHRHNLLKP 247

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +QVN  LMS+AH DA+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK IL WC 
Sbjct: 248 YQVNAKLMSLAHKDAIFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKGILAWCL 307

Query: 304 GII 306
           G +
Sbjct: 308 GAV 310


>gi|39937830|ref|NP_950106.1| ornithine carbamoyltransferase [Rhodopseudomonas palustris CGA009]
 gi|56404377|sp|Q6N0J0|OTC_RHOPA RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|39651690|emb|CAE30212.1| ornithine carbamoyltransferase [Rhodopseudomonas palustris CGA009]
          Length = 310

 Score =  375 bits (962), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 171/303 (56%), Positives = 219/303 (72%), Gaps = 1/303 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSE-NIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
           P+HF DL+ + +S L  ++  A  +K   + N    KPL+GK LAMIF+KPSTRTRVSF+
Sbjct: 7   PRHFLDLTELPTSELRNMLSAAVAMKAKRKANADGEKPLAGKTLAMIFDKPSTRTRVSFD 66

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M+ LGG++I L+G+EMQLGR ETI DTA+VLSR+VD I++R  NH  LLEL   ATVP
Sbjct: 67  VGMRQLGGESIMLTGAEMQLGRGETIADTARVLSRFVDIIMIRILNHEALLELAANATVP 126

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LT  +HPCQ++AD+MTFEEHRG +KG+  +W+GD NN+L S    A RF + LNIA
Sbjct: 127 VINGLTRKSHPCQVMADVMTFEEHRGPIKGRTIAWTGDDNNVLASFAHAAQRFEFKLNIA 186

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQP 243
           TP    P     +W +  GA++ +  D  +AV+GA CV TDTW+SM  +      ++ +P
Sbjct: 187 TPPQLSPSKALRDWIKASGAAITIGTDPEEAVRGADCVVTDTWVSMGDKDGEHRHNLLKP 246

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +QVN  LMS+AH DA+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK IL WC 
Sbjct: 247 YQVNAKLMSLAHKDAIFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKGILAWCL 306

Query: 304 GII 306
           G +
Sbjct: 307 GAV 309


>gi|90426386|ref|YP_534756.1| ornithine carbamoyltransferase [Rhodopseudomonas palustris BisB18]
 gi|90108400|gb|ABD90437.1| ornithine carbamoyltransferase [Rhodopseudomonas palustris BisB18]
          Length = 310

 Score =  375 bits (962), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 177/309 (57%), Positives = 219/309 (70%), Gaps = 4/309 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVA----KKIKNSSENIFENKPLSGKVLAMIFEKPSTR 57
           M+ P+HF DL+ + +  L  I++V+     K+K    N    KPL GK LAMIFEKPSTR
Sbjct: 1   MSTPRHFLDLTELPTKELRRILDVSVAMKTKLKAKDPNNKPGKPLEGKTLAMIFEKPSTR 60

Query: 58  TRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELT 117
           TRVSF+V M+ LGG+ I L+G+EMQLGR ET  DTAKVLSRYVDAI++R  +H  LLEL 
Sbjct: 61  TRVSFDVGMRQLGGEAIMLTGAEMQLGRGETFADTAKVLSRYVDAIMIRILSHEALLELA 120

Query: 118 EYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFN 177
            +ATVPVIN LT  +HP Q++AD+MTFEEHRG +KG+  +W+GD NN+L S +  A RF 
Sbjct: 121 AHATVPVINGLTRRSHPGQVMADLMTFEEHRGPIKGRTIAWTGDDNNVLASWVHAAERFQ 180

Query: 178 YLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE 237
           + L IATP    P     +W +  GAS+ L +DA  AVKGA CV TDTW+SM  +     
Sbjct: 181 FNLRIATPPQLAPNKAMKDWIKATGASIQLGNDAEAAVKGADCVITDTWVSMGDKEGEHR 240

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
            ++ +PFQVN  LMSMA  DA+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH  K 
Sbjct: 241 HNLLKPFQVNAKLMSMASKDAIFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAHKG 300

Query: 298 ILLWCFGII 306
           IL WCF  +
Sbjct: 301 ILAWCFDAV 309


>gi|27376210|ref|NP_767739.1| ornithine carbamoyltransferase [Bradyrhizobium japonicum USDA 110]
 gi|32699440|sp|Q89VE8|OTC_BRAJA RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|27349350|dbj|BAC46364.1| ornithine carbamoyltransferase [Bradyrhizobium japonicum USDA 110]
          Length = 307

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 170/306 (55%), Positives = 218/306 (71%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M   PKHF D++ +  S L  +++ +  +K   +     +PL GK LAMIFE+PSTRTRV
Sbjct: 1   MSKSPKHFLDINELPLSELKSMLDASSAMKAKQKAHQPVRPLEGKTLAMIFERPSTRTRV 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF+VAM+ LGG+ I L+G+EMQLGR ETI DTA+VLSRYVDAI++R  NH  LLEL   A
Sbjct: 61  SFDVAMRQLGGEPIMLTGAEMQLGRGETIADTARVLSRYVDAIMIRILNHDALLELAANA 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVIN LT  +HPCQ++AD++T++EHRG ++G+  +W+GD NN+L S    A RF + L
Sbjct: 121 TVPVINGLTRRSHPCQVMADLLTYQEHRGPIEGRTVAWTGDDNNVLASWAHAAERFKFQL 180

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
           N+ATP    P+    +W +  GA + L  D   AV+GA CV TDTW+SM  +      +V
Sbjct: 181 NVATPPELAPKKAMRDWIKASGAPIMLGTDPEAAVRGADCVVTDTWVSMGDKEGEHRHNV 240

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
            +P+QVN  LMS+A PDALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK IL 
Sbjct: 241 LKPYQVNAKLMSLAKPDALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKGILA 300

Query: 301 WCFGII 306
           WCF  +
Sbjct: 301 WCFDAV 306


>gi|158425651|ref|YP_001526943.1| ornithine carbamoyltransferase [Azorhizobium caulinodans ORS 571]
 gi|158332540|dbj|BAF90025.1| ornithine carbamoyltransferase [Azorhizobium caulinodans ORS 571]
          Length = 309

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 163/298 (54%), Positives = 225/298 (75%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF DL+++ + +L  ++E++K++K   +   E KPL+GK LAM+F+KPSTRTRVSF++A
Sbjct: 7   RHFLDLTDLEAVDLRGVLELSKQLKAKRKAGTEEKPLAGKSLAMVFDKPSTRTRVSFDLA 66

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+G+EMQLGR E+I DTA+VLSR+VDAI++R  +H  LLEL ++ATVPVI
Sbjct: 67  MRQLGGETIMLTGAEMQLGRGESIADTARVLSRFVDAIMIRILSHEDLLELAKFATVPVI 126

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT  +HPCQ++AD++TFEEH+GS++G+  +W+GD NN+L S +  AA+F++ +N+ATP
Sbjct: 127 NGLTRVSHPCQVMADVLTFEEHKGSIEGRSVAWTGDANNVLASWVHAAAQFDFTINVATP 186

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
               PR     + +   A V    D  +AV+G  CV TDTW+SM  +   R  ++ +P+Q
Sbjct: 187 KELSPRQALKEFVKRTQAKVRFMRDPEEAVEGVDCVITDTWVSMGDKEAERRHNLLKPYQ 246

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN  LM+ A PDA+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK IL WC 
Sbjct: 247 VNAKLMARAAPDAIFMHCLPAHRGEEVTDEVMDGPQSVVFDEAENRLHAQKGILAWCL 304


>gi|75674712|ref|YP_317133.1| ornithine carbamoyltransferase [Nitrobacter winogradskyi Nb-255]
 gi|123614122|sp|Q3SVB0|OTC_NITWN RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|74419582|gb|ABA03781.1| ornithine carbamoyltransferase [Nitrobacter winogradskyi Nb-255]
          Length = 308

 Score =  371 bits (953), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 170/305 (55%), Positives = 219/305 (71%), Gaps = 1/305 (0%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNS-SENIFENKPLSGKVLAMIFEKPSTRTR 59
           M   P+HF DL ++S+  L  I++ +  +K    E +  +KPL+GK LAMIF+KPSTRTR
Sbjct: 1   MSKAPRHFLDLLDMSTGELRAILDASVAMKKRRKEGLIADKPLAGKTLAMIFDKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V M+ LGG+ I L+G+EMQLGR ETI DTAKVLSR+VD I++R  +H  L EL  +
Sbjct: 61  VSFDVGMRQLGGEAIMLTGAEMQLGRGETIADTAKVLSRFVDIIMIRILSHDALTELAAH 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ATVPVIN LT  +HPCQ++AD+MTFEEHRG ++G+  +W+GD NN+L S    A RF++ 
Sbjct: 121 ATVPVINGLTRRSHPCQVMADVMTFEEHRGPIEGRTVAWTGDDNNVLASWAHAAERFSFN 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           LN+ATP    P     +W R+ GAS+ L  D   AV+GA C+ TDTW+SM  +      +
Sbjct: 181 LNVATPQELAPNKPLKDWIRSSGASIRLGTDPEAAVRGADCIVTDTWVSMGDKDGEHRHN 240

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + +P+QVN  LM +A  DALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK IL
Sbjct: 241 LLRPYQVNAELMRLAKSDALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKGIL 300

Query: 300 LWCFG 304
            WC G
Sbjct: 301 AWCLG 305


>gi|92116262|ref|YP_575991.1| ornithine carbamoyltransferase [Nitrobacter hamburgensis X14]
 gi|122418618|sp|Q1QQG6|OTC_NITHX RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|91799156|gb|ABE61531.1| ornithine carbamoyltransferase [Nitrobacter hamburgensis X14]
          Length = 308

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 168/305 (55%), Positives = 219/305 (71%), Gaps = 1/305 (0%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNS-SENIFENKPLSGKVLAMIFEKPSTRTR 59
           M T P+HF DL ++ ++ L  I++ +  +K    E    +KPL GK LAMIF+KPSTRTR
Sbjct: 1   MSTAPRHFLDLFDVPTTELRAILDASVAMKKRRKEGRIADKPLDGKTLAMIFDKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V M+ LGG+ I L+G+EMQLGR ETI DTA+VLSR+VD I++R  +H  L EL  +
Sbjct: 61  VSFDVGMRQLGGEAIMLTGAEMQLGRGETIADTARVLSRFVDIIMIRILSHDALTELAAH 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ATVPVIN LT  +HPCQ++AD+MTFEEHRG +KG+  +W+GD NN+L S    A RF++ 
Sbjct: 121 ATVPVINGLTRRSHPCQVMADVMTFEEHRGPIKGRTVAWTGDDNNVLASWAHAADRFSFN 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           LN+ATP    P     +W R+ GAS+ L  +   A +GA C+ TDTW+SM  +      +
Sbjct: 181 LNVATPPELAPNKLLKDWIRSSGASIKLGTNPEAAARGADCIVTDTWVSMGDKDGEHRHN 240

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + +P+QVN  LMS+A PDALFMHCLPAHRG+EV +EV+DGPQSVVFDEAENR+H QK IL
Sbjct: 241 LLKPYQVNAKLMSLAKPDALFMHCLPAHRGDEVTDEVIDGPQSVVFDEAENRMHAQKGIL 300

Query: 300 LWCFG 304
            WC G
Sbjct: 301 AWCLG 305


>gi|146343542|ref|YP_001208590.1| ornithine carbamoyltransferase [Bradyrhizobium sp. ORS278]
 gi|146196348|emb|CAL80375.1| ornithine carbamoyltransferase (OTCase) [Bradyrhizobium sp. ORS278]
          Length = 308

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 173/305 (56%), Positives = 219/305 (71%), Gaps = 1/305 (0%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNS-SENIFENKPLSGKVLAMIFEKPSTRTR 59
           M   P+HF DL+ +    L  ++ ++ ++K +   N    KPL GKVLAMIF+KPSTRTR
Sbjct: 1   MGNPPRHFLDLTEMPVEELRNMLALSSRMKQTLKSNEPSRKPLEGKVLAMIFDKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V M+ LGG+ I L+G+EMQLGR ETI DTA+VLSRYVDAI++R  +H  LLEL  +
Sbjct: 61  VSFDVGMRQLGGEAIMLTGTEMQLGRGETIADTARVLSRYVDAIMIRILSHEALLELAAH 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ATVPVIN LT  +HPCQ++AD+MTFEEHRGS++G+  +W+GD NN+L S    A RF + 
Sbjct: 121 ATVPVINGLTRRSHPCQVMADVMTFEEHRGSIEGRTVAWTGDDNNVLASWAHAAERFKFR 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           LN+ATP    P     ++ R   A + L HD   AVK A CV TDTW+SM  +      +
Sbjct: 181 LNVATPPQLSPGKPMKDFIRATRADIHLGHDPEGAVKNADCVITDTWVSMGDKDGEHRHN 240

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + +P+QVN  LMS+A P+ALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK IL
Sbjct: 241 LLKPYQVNAKLMSLAKPEALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKGIL 300

Query: 300 LWCFG 304
            WCFG
Sbjct: 301 AWCFG 305


>gi|148252345|ref|YP_001236930.1| ornithine carbamoyltransferase [Bradyrhizobium sp. BTAi1]
 gi|146404518|gb|ABQ33024.1| ornithine carbamoyltransferase [Bradyrhizobium sp. BTAi1]
          Length = 308

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 172/305 (56%), Positives = 219/305 (71%), Gaps = 1/305 (0%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNS-SENIFENKPLSGKVLAMIFEKPSTRTR 59
           M   P+HF DL+ +    L  ++ ++ ++K +   N    KPL GKVLAMIF+KPSTRTR
Sbjct: 1   MANTPRHFLDLTEMPVEELRNMLALSSRMKKTLKANEPAKKPLEGKVLAMIFDKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V M+ LGG+ I L+G+EMQLGR ETI DTA+VLSRYVDAI++R  +H  LLEL  +
Sbjct: 61  VSFDVGMRQLGGEAIMLTGTEMQLGRGETIADTARVLSRYVDAIMIRILSHEALLELAAH 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ATVPVIN LT  +HPCQ++AD+MTFEEHRGS++G+  +W+GD NN+L S    A RF + 
Sbjct: 121 ATVPVINGLTRRSHPCQVMADVMTFEEHRGSIEGRTVAWTGDDNNVLASWAHAAERFKFR 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           LN+ATP    P     ++ R   A + L HD   AV GA CV TDTW+SM  +      +
Sbjct: 181 LNVATPPQLSPGKPMKDFIRATKADIHLGHDPEAAVTGADCVVTDTWVSMGDKDGEHRHN 240

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + +P+QVN  LMS+A P+A+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK IL
Sbjct: 241 LLKPYQVNSKLMSLAKPEAIFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKGIL 300

Query: 300 LWCFG 304
            WCFG
Sbjct: 301 AWCFG 305


>gi|154250859|ref|YP_001411683.1| ornithine carbamoyltransferase [Parvibaculum lavamentivorans DS-1]
 gi|154154809|gb|ABS62026.1| ornithine carbamoyltransferase [Parvibaculum lavamentivorans DS-1]
          Length = 313

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 171/306 (55%), Positives = 225/306 (73%), Gaps = 7/306 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFE-----NKPLSGKVLAMIFEKPSTRTR 59
           P+HF DL  ++  +L  I+E +KK K +     +     ++PL G++LAMIFEKPSTRTR
Sbjct: 7   PRHFLDLDGVAPVDLRSILESSKKRKQARNGKGQAVPDSDRPLDGRLLAMIFEKPSTRTR 66

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+VAM+ LGG+T+ L+G + QLGR ETI DTA+VLSRYVDAI++RTT+H  L EL E+
Sbjct: 67  VSFDVAMRQLGGETLLLNGGDTQLGRGETIADTARVLSRYVDAIMIRTTDHEHLTELAEH 126

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ATVPVIN LT+ +HPCQI+AD+MTFEEH+G +KG+  +W GDGNN++ S I+ AA+  + 
Sbjct: 127 ATVPVINGLTNRSHPCQIMADVMTFEEHKGPIKGRRVAWVGDGNNVVTSWIQAAAQLEFE 186

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQ--EFKARE 237
           L IA P    P  E L+WA+++GAS+ +  D  +AVK A CV TDTW+SM    E  AR 
Sbjct: 187 LRIACPPELSPVPEALDWAKSKGASIIVTTDPFEAVKDADCVNTDTWVSMGDSVETAARR 246

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
            ++  P+QV+  LM+ A  DA+FMHCLPAHRGEE+  +V+DGP SVVFDEAENRLH QK 
Sbjct: 247 HNLLAPYQVDARLMAAAGKDAIFMHCLPAHRGEEMTVDVIDGPASVVFDEAENRLHAQKG 306

Query: 298 ILLWCF 303
           +L WCF
Sbjct: 307 VLAWCF 312


>gi|114328937|ref|YP_746094.1| ornithine carbamoyltransferase [Granulibacter bethesdensis CGDNIH1]
 gi|114317111|gb|ABI63171.1| ornithine carbamoyltransferase [Granulibacter bethesdensis CGDNIH1]
          Length = 316

 Score =  365 bits (938), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 166/301 (55%), Positives = 220/301 (73%), Gaps = 4/301 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF DL +I    L  +++ A   K +  +   ++PL+G+ LA+IFEKPSTRTR+SFE+A
Sbjct: 19  RHFLDLKDIEPDALRRMLDAAAGFKRADTS---SRPLAGRTLALIFEKPSTRTRISFELA 75

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGGD I LSG EMQLGR ET+ DTA+VLSRYVDA+++RT + ++L EL  +ATVPVI
Sbjct: 76  MRQLGGDVIMLSGKEMQLGRGETLADTARVLSRYVDAVMLRTGSSTKLHELARHATVPVI 135

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+ +HPCQI+ADI+TFEEHRG + G+  +W GDGNN+ HS IE AARF + L +A P
Sbjct: 136 NGLTELSHPCQIMADILTFEEHRGPIAGQTVAWIGDGNNVAHSWIEAAARFGFSLRLACP 195

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
              +P  + + WAR+ G  V L  D  +AV G  CV TD W+SM+ +   R E   +P+Q
Sbjct: 196 DTLQPHADIVAWARDNGGDVTLVADPKEAVAGVQCVVTDCWVSMSDDPSGRHEK-LRPYQ 254

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGI 305
           V+ +LM++A PDALFMHCLPAHRGEEV + V+DGP SVVFDEAENRLH QK +L+W  G+
Sbjct: 255 VDEALMALAAPDALFMHCLPAHRGEEVTDGVIDGPHSVVFDEAENRLHAQKGVLVWAMGM 314

Query: 306 I 306
           +
Sbjct: 315 L 315


>gi|85713647|ref|ZP_01044637.1| ornithine carbamoyltransferase [Nitrobacter sp. Nb-311A]
 gi|85699551|gb|EAQ37418.1| ornithine carbamoyltransferase [Nitrobacter sp. Nb-311A]
          Length = 308

 Score =  365 bits (938), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 167/304 (54%), Positives = 217/304 (71%), Gaps = 1/304 (0%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNS-SENIFENKPLSGKVLAMIFEKPSTRTR 59
           M   P+HF DL ++ +  L  I++ +  +K    + +  +KPL GK LAMIF+KPSTRTR
Sbjct: 1   MSKAPRHFLDLLDMGTGELRAILDASVAMKQRRKQGLIADKPLEGKTLAMIFDKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V M+ LGG+ I L+G+EMQLGR ETI DTA+VLSR+VD I++R  +H  L EL  +
Sbjct: 61  VSFDVGMRQLGGEAIMLTGAEMQLGRGETIADTARVLSRFVDIIMIRILSHDALTELATH 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ATVPVIN LT  +HPCQ++AD++TFEEHRG +KG+  +W+GD NN+L S    A RF++ 
Sbjct: 121 ATVPVINGLTRRSHPCQVMADVLTFEEHRGPIKGRTVAWTGDDNNVLASWAHAAERFSFN 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           LNIATP    P     +W R+ GAS+ +  D   AV+GA CV TDTW+SM  +      +
Sbjct: 181 LNIATPRELAPNKLLKDWIRSSGASIRVGTDPEAAVRGADCVVTDTWVSMGDKDGEHRHN 240

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + +P+QVN  LM +A P+ALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK IL
Sbjct: 241 LLRPYQVNAELMRLAKPEALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKGIL 300

Query: 300 LWCF 303
            WC 
Sbjct: 301 AWCL 304


>gi|170744571|ref|YP_001773226.1| ornithine carbamoyltransferase [Methylobacterium sp. 4-46]
 gi|168198845|gb|ACA20792.1| ornithine carbamoyltransferase [Methylobacterium sp. 4-46]
          Length = 314

 Score =  363 bits (933), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 167/306 (54%), Positives = 217/306 (70%), Gaps = 2/306 (0%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSE--NIFENKPLSGKVLAMIFEKPSTRTRV 60
           T P+HF DL+++S+  L  +++    +K+          +PL+GK+LAM+F++PSTRTRV
Sbjct: 7   TGPRHFLDLTDLSAGQLRGVLDACADLKSRRRKGQPPAERPLAGKILAMVFDRPSTRTRV 66

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF+VAM+ LGG+T+ L+G EMQLGR ETI DTA+VLSRYVDAI++R  +H  + EL  +A
Sbjct: 67  SFDVAMRELGGETLMLTGKEMQLGRGETIADTARVLSRYVDAIMIRILDHDMMRELARHA 126

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
            VPVIN LT  +HPCQI+AD++TFEEHRG ++G+  +WSGD NN+L S    AARF + L
Sbjct: 127 EVPVINGLTKLSHPCQIMADVLTFEEHRGPIRGRTVAWSGDANNVLASWAHAAARFEFRL 186

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            IATP     + E L+WAR +GA V +  D  +A  GA  V TD W+SM  E +A   ++
Sbjct: 187 RIATPPELPVKPELLDWARAEGAQVTVTADPFEAAAGADAVVTDCWVSMGDEDEAHRHNL 246

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
             P+QVN  LM  A  DA+FMHCLPAHRGEEV  EV+DGPQSVVFDEAENRLH QK IL 
Sbjct: 247 LMPYQVNGELMRAAAKDAVFMHCLPAHRGEEVTAEVIDGPQSVVFDEAENRLHAQKGILA 306

Query: 301 WCFGII 306
           WC G +
Sbjct: 307 WCLGAV 312


>gi|170748735|ref|YP_001754995.1| ornithine carbamoyltransferase [Methylobacterium radiotolerans JCM
           2831]
 gi|170655257|gb|ACB24312.1| ornithine carbamoyltransferase [Methylobacterium radiotolerans JCM
           2831]
          Length = 326

 Score =  362 bits (930), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 172/302 (56%), Positives = 225/302 (74%), Gaps = 2/302 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSEN--IFENKPLSGKVLAMIFEKPSTRTRVSF 62
           P+HF DL + S + L  +++ +  IK       +   +PL+GK LAM+F++PSTRTRVSF
Sbjct: 21  PRHFLDLKDFSGAELRRVLDASAAIKARRRKGELAAERPLTGKTLAMVFDRPSTRTRVSF 80

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           +VAM+ LGG+T+ L+GSEMQLGR ETIGDTA+VLSR+VDAI++R  +H ++LEL EYATV
Sbjct: 81  DVAMRELGGETLMLTGSEMQLGRGETIGDTAQVLSRFVDAIMIRILDHGQMLELAEYATV 140

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVINALT  +HPCQI+AD++TFEEHRG ++G+  +WSGD NN+L S +  AARF++ LNI
Sbjct: 141 PVINALTKVSHPCQIMADVLTFEEHRGPIRGRKVAWSGDANNVLASWVHAAARFDFTLNI 200

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQ 242
           A+P    P    L WA+ +GA V +  DA  AV G   V TD W+SM  + +A   ++  
Sbjct: 201 ASPPELAPPPALLAWAQQEGADVHVTTDAFAAVDGVDAVVTDCWVSMGDDDEAHRHNLLS 260

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           P+QVN +LM+ A+PDA+FMHCLPAHRGEEV  EV+DGP+SVVFDEAENRLH QK IL WC
Sbjct: 261 PYQVNDALMAAANPDAIFMHCLPAHRGEEVTAEVMDGPRSVVFDEAENRLHAQKGILAWC 320

Query: 303 FG 304
            G
Sbjct: 321 LG 322


>gi|154245167|ref|YP_001416125.1| ornithine carbamoyltransferase [Xanthobacter autotrophicus Py2]
 gi|154159252|gb|ABS66468.1| ornithine carbamoyltransferase [Xanthobacter autotrophicus Py2]
          Length = 309

 Score =  362 bits (928), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 162/298 (54%), Positives = 218/298 (73%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF DLS I +  L  +++ +K +K   +    ++PL+GK LAM+F+KPSTRTRVSF++A
Sbjct: 7   RHFLDLSEIPAEELRRVLDFSKDLKARRKAGEVDRPLAGKTLAMVFDKPSTRTRVSFDLA 66

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+G EMQLGR ETI DTA+VLSR+VDAI++R  +H  L EL ++ATVPVI
Sbjct: 67  MRQLGGETIMLTGQEMQLGRGETIADTARVLSRFVDAIMIRILDHDDLTELAKHATVPVI 126

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT  +HPCQ++AD++TFEEHRG++ G+  +W+GD NN+L S +  A RF++ L +ATP
Sbjct: 127 NGLTRISHPCQVMADVLTFEEHRGNITGRSVAWTGDANNVLASWVHAAQRFDFSLKVATP 186

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
               PR    ++ +   A V    D  +AV+G  CV TDTW+SM  +   R  ++ +P+Q
Sbjct: 187 KELSPRQALKDFVKRTKAKVKFMRDPEEAVEGVDCVVTDTWVSMGDKEAERRHNLLKPYQ 246

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN SLM+ A  +A+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK IL WCF
Sbjct: 247 VNRSLMARADKEAIFMHCLPAHRGEEVSDEVMDGPQSVVFDEAENRLHAQKGILAWCF 304


>gi|217977016|ref|YP_002361163.1| ornithine carbamoyltransferase [Methylocella silvestris BL2]
 gi|217502392|gb|ACK49801.1| ornithine carbamoyltransferase [Methylocella silvestris BL2]
          Length = 317

 Score =  361 bits (927), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 165/302 (54%), Positives = 221/302 (73%), Gaps = 6/302 (1%)

Query: 6   KHFADLSNISSSNLSCIIE--VAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
           +HFADLS+I++ +L  II+  +A K K        ++PL GKVLAMIF+KPSTRTRVSF+
Sbjct: 13  RHFADLSDIAAGDLRRIIDSSLAMKAKRRKGRRSVDRPLEGKVLAMIFDKPSTRTRVSFD 72

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           +AM+ LGG+T+ L+G EMQLGR ETI DTA+VLSR+VDAI++R   H  ++EL  +A VP
Sbjct: 73  LAMRELGGETVMLTGKEMQLGRGETIADTARVLSRFVDAIMIRILEHRDMIELARHADVP 132

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LT  +HPCQ++AD+MTFEEHRG +KG+  +WSGD NN+L S +  A RF++ L++A
Sbjct: 133 VINGLTKKSHPCQVMADVMTFEEHRGPIKGRKIAWSGDANNVLASWVHAAQRFDFSLSVA 192

Query: 184 TP--IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
            P   G  P  + L+WAR  GA + +  D  +AV+GA  V +D W+SM  + + + + + 
Sbjct: 193 APAEFGLPP--QLLDWARRSGAKLEVTRDPFEAVRGADAVVSDCWVSMGDKDEQQRQGLL 250

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
            P+QVN  LM+ A  +A+FMHCLPAHRGEEV +E++DGPQSVVFDEAENRLH QK IL W
Sbjct: 251 SPYQVNAKLMAAAGSEAIFMHCLPAHRGEEVTDEIIDGPQSVVFDEAENRLHAQKGILAW 310

Query: 302 CF 303
           C 
Sbjct: 311 CL 312


>gi|254472066|ref|ZP_05085467.1| ornithine carbamoyltransferase [Pseudovibrio sp. JE062]
 gi|211959268|gb|EEA94467.1| ornithine carbamoyltransferase [Pseudovibrio sp. JE062]
          Length = 312

 Score =  361 bits (926), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 169/304 (55%), Positives = 222/304 (73%), Gaps = 1/304 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-PLSGKVLAMIFEKPSTRTRV 60
           +T P+HF D+S+ SS  L  I++V+K+IK++   +   + PL+GKVLAM+FE+PSTRTR+
Sbjct: 4   LTKPQHFLDISDFSSDELRHIMDVSKQIKSTRNGVHRGQGPLAGKVLAMVFEQPSTRTRI 63

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF+V M+ LGG+T+ L+G+EMQLGR E+I DTA+VLSR+VD I++R  +H  + EL EYA
Sbjct: 64  SFDVGMRELGGETLMLTGAEMQLGRGESIPDTARVLSRFVDMIMIRMLDHDAVRELAEYA 123

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVIN LT  +HPCQI+ADIMTFEEHRGS+KGK  SW GD NN+L+S IE A++F++ +
Sbjct: 124 TVPVINGLTKISHPCQIMADIMTFEEHRGSIKGKTVSWVGDSNNVLYSWIEAASKFDFKI 183

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
           N+A P       E++  A   GA +++  D   AVK + CV TD W+SM         ++
Sbjct: 184 NVAAPNELTVPLEWIEKAYTSGAELSVTDDPFAAVKNSDCVITDCWVSMGDSDAETRHNM 243

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
              +QVN  LMS A+  ALFMHCLPAHRGEEV NEV+DGP SVVFDEAENRLH QK I+ 
Sbjct: 244 LAAYQVNERLMSEANDSALFMHCLPAHRGEEVTNEVIDGPHSVVFDEAENRLHAQKGIMA 303

Query: 301 WCFG 304
           WC G
Sbjct: 304 WCMG 307


>gi|254504688|ref|ZP_05116839.1| ornithine carbamoyltransferase [Labrenzia alexandrii DFL-11]
 gi|222440759|gb|EEE47438.1| ornithine carbamoyltransferase [Labrenzia alexandrii DFL-11]
          Length = 309

 Score =  361 bits (926), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 167/300 (55%), Positives = 214/300 (71%), Gaps = 1/300 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-PLSGKVLAMIFEKPSTRTRVSFEV 64
           K+F DL+     +L  I+E  KKIK + + +   + PL+GKVLAMIFE+PSTRTR+SF+V
Sbjct: 8   KNFLDLTQFEGDDLRAILETGKKIKATRDGVRRGEGPLAGKVLAMIFEQPSTRTRISFDV 67

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M+ LGG+T+ L+G+EMQLGR ETI DTAKVLSR+VD +++R  +H  L EL E AT+PV
Sbjct: 68  GMRELGGETLMLTGAEMQLGRGETIADTAKVLSRFVDGVMIRILDHEALNELAENATIPV 127

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LT  +HPCQI+ADIMTFEEHRG + G+  +W+GD NN+L S +  A R ++ L IAT
Sbjct: 128 INGLTKISHPCQIMADIMTFEEHRGGISGRSIAWTGDSNNVLASWVHAAPRLDFELRIAT 187

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P    P  + +  AR +G S+ +  D  +AVKG  CV TD W+SM  +      ++   +
Sbjct: 188 PAELAPPQDLIETARAKGGSILVTDDPYEAVKGTDCVVTDCWVSMGDDDAESRHNLLSAY 247

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QVN  LM+ A+ DALFMHCLPAHRGEEV NEV+DGP SVVFDEAENRLH QK IL WCFG
Sbjct: 248 QVNERLMAEANGDALFMHCLPAHRGEEVTNEVMDGPNSVVFDEAENRLHAQKGILAWCFG 307


>gi|328544889|ref|YP_004304998.1| Ornithine carbamoyltransferase (OTCase) [polymorphum gilvum
           SL003B-26A1]
 gi|326414631|gb|ADZ71694.1| Ornithine carbamoyltransferase (OTCase) [Polymorphum gilvum
           SL003B-26A1]
          Length = 309

 Score =  360 bits (924), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 167/302 (55%), Positives = 216/302 (71%), Gaps = 1/302 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-PLSGKVLAMIFEKPSTRTRVSFEV 64
           +HF DL+      L  I+E  K++K     +   + PL+GKVLAMIFE+PSTRTR+SF+V
Sbjct: 8   RHFLDLTEFDGDQLRAILERGKQLKAVRNGVRRGEGPLAGKVLAMIFEQPSTRTRISFDV 67

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M+ LGG+T+ L+G+EMQLGR ETI DTA+VLSR+VDAI++R  + + L EL   ATVPV
Sbjct: 68  GMRELGGETLMLTGAEMQLGRGETIADTARVLSRFVDAIMIRILDDNDLRELAANATVPV 127

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LT  +HPCQI+AD+MTFEEHRG +KG+  +W+GD NN+L S +  A R ++ L IAT
Sbjct: 128 INGLTKKSHPCQIMADLMTFEEHRGPIKGRSVAWTGDSNNVLASWVHAAPRMDFELRIAT 187

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P    P  + ++ AR +GAS+ +  D  +AVKG+ CV TD W+SM  +      ++  P+
Sbjct: 188 PPELSPPADLIDRARAEGASIMVTDDPFEAVKGSDCVVTDCWVSMGDDDTQSRHNLLSPY 247

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QVN  LM+ AH DALFMHCLPAHRGEEV +EV+DGP SVVFDEAENRLH QK IL WC G
Sbjct: 248 QVNARLMAHAHKDALFMHCLPAHRGEEVTSEVMDGPNSVVFDEAENRLHAQKGILAWCLG 307

Query: 305 II 306
            I
Sbjct: 308 GI 309


>gi|220927194|ref|YP_002502496.1| ornithine carbamoyltransferase [Methylobacterium nodulans ORS 2060]
 gi|219951801|gb|ACL62193.1| ornithine carbamoyltransferase [Methylobacterium nodulans ORS 2060]
          Length = 314

 Score =  360 bits (923), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 164/304 (53%), Positives = 216/304 (71%), Gaps = 2/304 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSE--NIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           P+HF DL+++S   L  +++   ++K           +PL+GKVLAM+F++PSTRTRVSF
Sbjct: 9   PRHFLDLTDLSPGQLRTVLDACAELKRHRRKGQPPAERPLAGKVLAMVFDRPSTRTRVSF 68

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           +VAM+ LGG+T+ L+G EMQLGR ET+ DTA+VLSRYVDAI++R  +H  + EL  +A V
Sbjct: 69  DVAMRELGGETLMLTGKEMQLGRGETVADTARVLSRYVDAIMIRILDHGMMQELAAHAEV 128

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVIN LT  +HPCQI+AD++TFEEHRG ++G+  +WSGD NN+L S    AARF++ LN+
Sbjct: 129 PVINGLTKVSHPCQIMADVLTFEEHRGPIRGRTVAWSGDANNVLASWAHAAARFDFRLNV 188

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQ 242
           A P     R + L WA+ +GA + +  D  +AV GA  V TD W+SM  E +A   ++  
Sbjct: 189 ACPPELAVRPDLLAWAKAEGAQINVTTDPFEAVAGADAVVTDCWVSMGDEDEAHRHNLLM 248

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           P+QVN  LM  A  DA+FMHCLPAHRGEEV  EV+DGPQSVVFDEAENRLH QK IL WC
Sbjct: 249 PYQVNGKLMQAAAKDAIFMHCLPAHRGEEVTAEVIDGPQSVVFDEAENRLHAQKGILAWC 308

Query: 303 FGII 306
            G +
Sbjct: 309 LGAV 312


>gi|240140893|ref|YP_002965373.1| ornithine carbamoyltransferase [Methylobacterium extorquens AM1]
 gi|240010870|gb|ACS42096.1| ornithine carbamoyltransferase [Methylobacterium extorquens AM1]
          Length = 316

 Score =  360 bits (923), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 164/302 (54%), Positives = 222/302 (73%), Gaps = 4/302 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVA---KKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           +HF DL ++S+  L  +++ +   K+++   +   E +PL+GK+LAM+F++PSTRTRVSF
Sbjct: 13  RHFLDLKDLSAETLRGVLDTSAAMKRVRVKGQRAVE-RPLTGKMLAMVFDRPSTRTRVSF 71

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           +VAM+ LGGDT+ L+G EMQLGR ET+ DTA+VLSR+VDAIV+RT +H  ++EL E+A V
Sbjct: 72  DVAMRELGGDTLMLTGKEMQLGRGETVSDTARVLSRFVDAIVIRTLDHGLVMELAEHAEV 131

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVINALT  +HPCQI+AD++TFEEHRG ++G+  +WSGD NN+L S +  AARF++ LN+
Sbjct: 132 PVINALTKASHPCQIMADLLTFEEHRGPIRGRTVAWSGDANNVLASWVHAAARFDFTLNV 191

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQ 242
           A P         ++WA+ +GA V    DA  AV+GA  V TD W+SM  + +    ++  
Sbjct: 192 AAPRELAMPPALVDWAKREGARVNATTDAYAAVEGADLVVTDCWVSMGDDDEHFRHNLLS 251

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           P++V+ +LM  A  DALFMHCLPAHRGEEV  EV+DGPQSVVFDEAENRLH QK IL WC
Sbjct: 252 PYRVDAALMKAASKDALFMHCLPAHRGEEVTAEVIDGPQSVVFDEAENRLHAQKGILAWC 311

Query: 303 FG 304
            G
Sbjct: 312 LG 313


>gi|118589320|ref|ZP_01546726.1| ornithine carbamoyltransferase [Stappia aggregata IAM 12614]
 gi|118438020|gb|EAV44655.1| ornithine carbamoyltransferase [Stappia aggregata IAM 12614]
          Length = 309

 Score =  360 bits (923), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 168/303 (55%), Positives = 222/303 (73%), Gaps = 2/303 (0%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-PLSGKVLAMIFEKPSTRTRVS 61
           TY ++F DL++     L  I++ ++KIK+S   +   + PL+GK+LAMIFE+PSTRTR+S
Sbjct: 6   TY-RNFLDLTDFEGDELRAILDTSRKIKSSRNGVHRGQGPLAGKILAMIFEQPSTRTRIS 64

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V M+ LGG+T+ L+G+EMQLGR ETI DTA+VLSR+VDAI++R  +H+ L EL E AT
Sbjct: 65  FDVGMRELGGETLMLTGAEMQLGRGETIADTARVLSRFVDAIMIRILDHNDLRELAENAT 124

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LT  +HPCQI+AD++TFEEHRGS+KGK  +W+GD NN+L S +  A RF++ L 
Sbjct: 125 VPVINGLTKLSHPCQIMADLLTFEEHRGSIKGKSVAWTGDSNNVLASWVHAAPRFDFELR 184

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           IATP    P  + +  AR +G S+ +  D  +AVKG  CV TD W+SM  +      ++ 
Sbjct: 185 IATPGELAPPMDLIEAARAKGGSIQVTTDPYEAVKGTDCVVTDCWVSMGDDDAESRHNLL 244

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
             +QVN  LM+ A+ DALFMHCLPAHRGEEV ++V+DGP SVVFDEAENRLH QK IL W
Sbjct: 245 SAYQVNKRLMAEANQDALFMHCLPAHRGEEVTSDVMDGPNSVVFDEAENRLHAQKGILAW 304

Query: 302 CFG 304
           CFG
Sbjct: 305 CFG 307


>gi|209883806|ref|YP_002287663.1| ornithine carbamoyltransferase [Oligotropha carboxidovorans OM5]
 gi|209872002|gb|ACI91798.1| ornithine carbamoyltransferase [Oligotropha carboxidovorans OM5]
          Length = 311

 Score =  359 bits (922), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 162/304 (53%), Positives = 216/304 (71%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           T  +HF DLS + + +L  I++ +  +K + +    ++PL  K LAMIFE+PSTRTRVSF
Sbjct: 7   TKLRHFLDLSELPTEDLRAILDASLAMKKNLKAGHPDRPLKDKTLAMIFERPSTRTRVSF 66

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           EV M+ LGG+ I L+G EMQLGR ET  DTA+VLSR+VD I++R  +H  L E+ E+ATV
Sbjct: 67  EVGMRQLGGEAIMLTGQEMQLGRGETFADTARVLSRFVDIIMIRILSHDALTEMVEHATV 126

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVIN LT  +HP Q++AD+MTFEEHRG +KG+  +W+GD NN+L S +  A RF + L +
Sbjct: 127 PVINGLTRRSHPTQVMADVMTFEEHRGPIKGRTIAWTGDDNNVLASWMHAAERFAFTLRV 186

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQ 242
           ATP    P+    +W +   AS+ L  D V+AV+ A CV TDTW+SM  +   +  ++ +
Sbjct: 187 ATPPELAPKKALKDWIKATQASIVLGTDPVEAVRNADCVITDTWMSMGDKDAEQRHNLLK 246

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           P+QVN  LMS+A PDA+FMHCLPAHRGEEV ++V+DGPQSVVFDEAENRLH  K IL WC
Sbjct: 247 PYQVNEKLMSLAKPDAIFMHCLPAHRGEEVTDDVIDGPQSVVFDEAENRLHAHKGILAWC 306

Query: 303 FGII 306
            G +
Sbjct: 307 LGAV 310


>gi|144900478|emb|CAM77342.1| Ornithine carbamoyltransferase [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 311

 Score =  359 bits (921), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 173/298 (58%), Positives = 209/298 (70%), Gaps = 1/298 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF DL    +  L  I+++    K   +     KPLSG+VLAMIFEKPSTRTRVSFE  
Sbjct: 14  RHFLDLDRFDTETLRRILDLGAAYKRGEQPFGRPKPLSGRVLAMIFEKPSTRTRVSFETG 73

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           MK LGGDTI LS  + QLGR ET+ DTA+VLSRYVDAI++RT + ++L EL+EYATVPVI
Sbjct: 74  MKQLGGDTIVLSKGDTQLGRGETVADTARVLSRYVDAIMIRTDDPAKLAELSEYATVPVI 133

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+THPCQ++ADIMTF EHRGS+ GK+ SW GDGNN+  S I+ AA FN+ + +A P
Sbjct: 134 NGLTDDTHPCQVMADIMTFTEHRGSLDGKVVSWVGDGNNVAASWIQAAAHFNFEMRLACP 193

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
               P    + WAR QGA V +  D V AVK +H V TDTW+SM      R   +  P+Q
Sbjct: 194 SELMPDVAAVEWARAQGARVVIGSDPVAAVKDSHLVITDTWVSMGCTDTNRHT-LLSPYQ 252

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN  LM+ A  DALFMHCLPAHR EEV + V+DG QSVV+DEAENRLH QK IL WC 
Sbjct: 253 VNDGLMAHAAGDALFMHCLPAHRNEEVTDSVMDGAQSVVWDEAENRLHVQKGILSWCL 310


>gi|163853474|ref|YP_001641517.1| ornithine carbamoyltransferase [Methylobacterium extorquens PA1]
 gi|254563403|ref|YP_003070498.1| ornithine carbamoyltransferase [Methylobacterium extorquens DM4]
 gi|163665079|gb|ABY32446.1| ornithine carbamoyltransferase [Methylobacterium extorquens PA1]
 gi|254270681|emb|CAX26685.1| ornithine carbamoyltransferase [Methylobacterium extorquens DM4]
          Length = 330

 Score =  358 bits (920), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 164/302 (54%), Positives = 222/302 (73%), Gaps = 4/302 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVA---KKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           +HF DL ++S+  L  +++ +   K+++   +   E +PL+GK+LAM+F++PSTRTRVSF
Sbjct: 27  RHFLDLKDLSAETLRGVLDTSAAMKRVRVKGQRAAE-RPLTGKMLAMVFDRPSTRTRVSF 85

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           +VAM+ LGGDT+ L+G EMQLGR ET+ DTA+VLSR+VDAIV+RT +H  ++EL E+A V
Sbjct: 86  DVAMRELGGDTLMLTGKEMQLGRGETVSDTARVLSRFVDAIVIRTLDHGLVMELAEHAEV 145

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVINALT  +HPCQI+AD++TFEEHRG ++G+  +WSGD NN+L S +  AARF++ LN+
Sbjct: 146 PVINALTKASHPCQIMADLLTFEEHRGPIQGRTVAWSGDANNVLASWVHAAARFDFTLNV 205

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQ 242
           A P         ++WA+ +GA V    DA  AV+GA  V TD W+SM  + +    ++  
Sbjct: 206 AAPRELAMPPALVDWAKREGARVNATTDAYAAVEGADLVVTDCWVSMGDDDEHFRHNLLS 265

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           P++V+ +LM  A  DALFMHCLPAHRGEEV  EV+DGPQSVVFDEAENRLH QK IL WC
Sbjct: 266 PYRVDAALMKAASKDALFMHCLPAHRGEEVTAEVIDGPQSVVFDEAENRLHAQKGILAWC 325

Query: 303 FG 304
            G
Sbjct: 326 LG 327


>gi|218532331|ref|YP_002423147.1| ornithine carbamoyltransferase [Methylobacterium chloromethanicum
           CM4]
 gi|218524634|gb|ACK85219.1| ornithine carbamoyltransferase [Methylobacterium chloromethanicum
           CM4]
          Length = 316

 Score =  358 bits (920), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 164/302 (54%), Positives = 222/302 (73%), Gaps = 4/302 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVA---KKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           +HF DL ++S+  L  +++ +   K+++   +   E +PL+GK+LAM+F++PSTRTRVSF
Sbjct: 13  RHFLDLKDLSAETLRGVLDTSAAMKRVRVKGQRAAE-RPLTGKMLAMVFDRPSTRTRVSF 71

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           +VAM+ LGGDT+ L+G EMQLGR ET+ DTA+VLSR+VDAIV+RT +H  ++EL E+A V
Sbjct: 72  DVAMRELGGDTLMLTGKEMQLGRGETVSDTARVLSRFVDAIVIRTLDHGLVMELAEHAEV 131

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVINALT  +HPCQI+AD++TFEEHRG ++G+  +WSGD NN+L S +  AARF++ LN+
Sbjct: 132 PVINALTKASHPCQIMADLLTFEEHRGPIQGRTVAWSGDANNVLASWVHAAARFDFTLNV 191

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQ 242
           A P         ++WA+ +GA V    DA  AV+GA  V TD W+SM  + +    ++  
Sbjct: 192 AAPRELAMPPALVDWAKREGARVNATTDAYAAVEGADLVVTDCWVSMGDDDEHFRHNLLS 251

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           P++V+ +LM  A  DALFMHCLPAHRGEEV  EV+DGPQSVVFDEAENRLH QK IL WC
Sbjct: 252 PYRVDAALMKAASKDALFMHCLPAHRGEEVTAEVIDGPQSVVFDEAENRLHAQKGILAWC 311

Query: 303 FG 304
            G
Sbjct: 312 LG 313


>gi|258541824|ref|YP_003187257.1| ornithine carbamoyltransferase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632902|dbj|BAH98877.1| ornithine carbamoyltransferase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256635959|dbj|BAI01928.1| ornithine carbamoyltransferase [Acetobacter pasteurianus IFO
           3283-03]
 gi|256639014|dbj|BAI04976.1| ornithine carbamoyltransferase [Acetobacter pasteurianus IFO
           3283-07]
 gi|256642068|dbj|BAI08023.1| ornithine carbamoyltransferase [Acetobacter pasteurianus IFO
           3283-22]
 gi|256645123|dbj|BAI11071.1| ornithine carbamoyltransferase [Acetobacter pasteurianus IFO
           3283-26]
 gi|256648178|dbj|BAI14119.1| ornithine carbamoyltransferase [Acetobacter pasteurianus IFO
           3283-32]
 gi|256651231|dbj|BAI17165.1| ornithine carbamoyltransferase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654222|dbj|BAI20149.1| ornithine carbamoyltransferase [Acetobacter pasteurianus IFO
           3283-12]
          Length = 328

 Score =  358 bits (918), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 167/309 (54%), Positives = 217/309 (70%), Gaps = 6/309 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSEN----IFENKPLSGKVLAMIFEKPSTR 57
           +  P+HF DL ++ ++ L  I++VA  +K   +N    +   +PL+G+ L +I  KPSTR
Sbjct: 10  LATPRHFLDLKDLDAATLRQILDVAASMKRMQQNRRFPLHPRQPLAGRQLGLILSKPSTR 69

Query: 58  TRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELT 117
           TRVSFEV ++ LGGD + LS  EMQ+GR E+I DTA+VLSR+VDAI++RT N   + EL 
Sbjct: 70  TRVSFEVGIRQLGGDAVVLSPQEMQIGRGESIADTARVLSRFVDAIMLRTGNTKTMHELA 129

Query: 118 EYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFN 177
           +++TVPVIN LT ++HP QI+ADIMTFEEHRG V+G+ F+W+GDGNN+L SLIEGA RF 
Sbjct: 130 QWSTVPVINGLTPHSHPVQILADIMTFEEHRGPVRGRTFAWTGDGNNVLVSLIEGAVRFG 189

Query: 178 YLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK--A 235
           + L  ATP   +P  + L+WAR +G  V    D   A KGA CV TDTWISM+   K  A
Sbjct: 190 FALRAATPADMKPPQDVLDWARAEGGDVEWTVDPKAAAKGADCVVTDTWISMSDSPKEAA 249

Query: 236 REEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
                 +P++VN  LM++A PDALFMHCLPAH GEEV  +V +GP SVVFDEAENRLH Q
Sbjct: 250 TRMSKLEPYRVNADLMALAAPDALFMHCLPAHIGEEVTKDVFEGPHSVVFDEAENRLHAQ 309

Query: 296 KAILLWCFG 304
           K +L W  G
Sbjct: 310 KGVLAWTMG 318


>gi|296444942|ref|ZP_06886904.1| ornithine carbamoyltransferase [Methylosinus trichosporium OB3b]
 gi|296257610|gb|EFH04675.1| ornithine carbamoyltransferase [Methylosinus trichosporium OB3b]
          Length = 316

 Score =  357 bits (917), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 169/308 (54%), Positives = 222/308 (72%), Gaps = 7/308 (2%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIK----NSSENIFENKPLSGKVLAMIFEKPSTR 57
           +T  +HF DLS I ++ L  I++ A  IK      + + F  +PL+GK LAMIF+KPSTR
Sbjct: 7   VTGARHFLDLSQIPATELRRILDNAAAIKARRVKGAPSAF--RPLAGKALAMIFDKPSTR 64

Query: 58  TRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELT 117
           TRVSF++AM+ LGGDTI L+G EMQLGR ETI DTA+VLSR+VDAIV+R   H +L EL 
Sbjct: 65  TRVSFDLAMRELGGDTIMLTGQEMQLGRGETIADTARVLSRFVDAIVIRILEHDQLTELA 124

Query: 118 EYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFN 177
            ++TVPVIN LT  +HPCQ++AD++TFEEHRG + G+  +W+GD NN+L S +  A RF+
Sbjct: 125 RFSTVPVINGLTKLSHPCQVMADVLTFEEHRGPIAGRTVAWTGDANNVLASWVHAAERFS 184

Query: 178 YLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAR 236
           + +N+ATP    P    +++AR  G ++ L  D  +AV GA  V +D W+SM ++E +AR
Sbjct: 185 FKINVATPPELAPSGALVDFARANGVALNLTADPYEAVAGADAVISDCWVSMGDEEEEAR 244

Query: 237 EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
              +  PFQVN  LM+ A   A+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK
Sbjct: 245 RHALLFPFQVNAKLMAAADKHAIFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQK 304

Query: 297 AILLWCFG 304
            +L WCFG
Sbjct: 305 GVLAWCFG 312


>gi|149204776|ref|ZP_01881739.1| ornithine carbamoyltransferase [Roseovarius sp. TM1035]
 gi|149141745|gb|EDM29798.1| ornithine carbamoyltransferase [Roseovarius sp. TM1035]
          Length = 308

 Score =  357 bits (917), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 159/306 (51%), Positives = 225/306 (73%), Gaps = 7/306 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSEN-----IFENKPLSGKVLAMIFEKPSTRTRVS 61
           HF D+   + ++L  +I+ A+++K + +        +++PL+G+++A+IFEKPSTRTRVS
Sbjct: 3   HFLDIHKTTETDLRAMIDQARRMKEARQGRPRGTPDDDQPLAGRMVALIFEKPSTRTRVS 62

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F++ ++ +GG ++ LSG++MQLG  ETI DTA+V+SRYVD I++RT + S LLE+ E+A 
Sbjct: 63  FDMGVRQMGGQSMVLSGADMQLGHGETIADTARVMSRYVDLIMIRTFDESVLLEMAEHAD 122

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD THPCQI+ADI+T+EEHRG +KGK   WSGDGNN+  S++  A +F + L 
Sbjct: 123 VPVINGLTDRTHPCQIMADILTYEEHRGPIKGKKVVWSGDGNNVCASMLHAAGQFGFDLT 182

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM--NQEFKAREEH 239
              P+  +P  E++  AR  G+++ +  D  +AV GA  V TDTW+SM  +Q  K R  +
Sbjct: 183 FTGPMQLDPEPEFIGLARKAGSTITIERDPFKAVDGADLVVTDTWVSMHDSQSTKERRHN 242

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + +P+QVN  LM+ A PDALFMHCLPAHRGEEV +EV+DGPQSV+FDEAENRLH QKA++
Sbjct: 243 MLRPYQVNDKLMAAAKPDALFMHCLPAHRGEEVTSEVMDGPQSVIFDEAENRLHAQKAVM 302

Query: 300 LWCFGI 305
            WC G+
Sbjct: 303 RWCLGV 308


>gi|46202842|ref|ZP_00208682.1| COG0078: Ornithine carbamoyltransferase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 316

 Score =  356 bits (914), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 162/304 (53%), Positives = 222/304 (73%), Gaps = 2/304 (0%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNS--SENIFENKPLSGKVLAMIFEKPSTRTRV 60
           ++ +HF DL + S+  L  +++ +  +K +       E +PL+GK+LAM+F++PSTRTRV
Sbjct: 10  SHVRHFLDLKDFSAETLRGVLDASAAMKRARVKGRRAEERPLTGKMLAMVFDRPSTRTRV 69

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF+VAM+ LGGDT+ L+G EMQLGR E++ DTA+VLSR+VDAIV+RT +H+ ++EL E+A
Sbjct: 70  SFDVAMRELGGDTLMLTGKEMQLGRGESVADTARVLSRFVDAIVIRTLDHTLMVELAEHA 129

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVINALT  +HPCQI+AD++TFEEHRG +KG+  +WSGD NN+L S +  AARF++ L
Sbjct: 130 TVPVINALTKVSHPCQIMADVLTFEEHRGPIKGRTIAWSGDANNVLASWVHAAARFDFTL 189

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
           N+A P         + WA  +GA V    DA  AV+GA  V TD W+SM  + +    ++
Sbjct: 190 NVAAPNELAMPPALVAWAEREGARVNATTDAYAAVEGADAVVTDCWVSMGDDDEHFRHNL 249

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
             P++V+ +LM+ A  DA+F+HCLPAHRGEEV  +V+DGPQSVVFDEAENRLH QK IL 
Sbjct: 250 LSPYRVDAALMAHAAKDAIFLHCLPAHRGEEVTADVIDGPQSVVFDEAENRLHAQKGILA 309

Query: 301 WCFG 304
           WC G
Sbjct: 310 WCLG 313


>gi|329114399|ref|ZP_08243161.1| Ornithine carbamoyltransferase [Acetobacter pomorum DM001]
 gi|326696475|gb|EGE48154.1| Ornithine carbamoyltransferase [Acetobacter pomorum DM001]
          Length = 333

 Score =  356 bits (914), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 167/309 (54%), Positives = 217/309 (70%), Gaps = 6/309 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSEN----IFENKPLSGKVLAMIFEKPSTR 57
           +  P+HF DL ++ ++ L  I++VA  +K   +     +   +PL+G+ L +I  KPSTR
Sbjct: 15  LATPRHFLDLKDLDAATLRQILDVAASMKRMQQKRRFPLHPRQPLAGRQLGLILSKPSTR 74

Query: 58  TRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELT 117
           TRVSFEV ++ LGGD + LS  EMQ+GR E+I DTA+VLSR+VDAI++RT N   L EL 
Sbjct: 75  TRVSFEVGIRQLGGDAVVLSPQEMQIGRGESIADTARVLSRFVDAIMLRTGNTKTLHELA 134

Query: 118 EYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFN 177
           +++TVPVIN LT ++HP QI+ADIMTFEEHRG V+G+ F+W+GDGNN+L SLIEGA RF 
Sbjct: 135 QWSTVPVINGLTPHSHPVQILADIMTFEEHRGPVRGRTFAWTGDGNNVLVSLIEGAVRFG 194

Query: 178 YLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK--A 235
           + L  ATP   +P  + L+WAR +G  V    D   AVKGA CV TDTWISM+   K  A
Sbjct: 195 FALRAATPADMKPPQDVLDWARAEGGDVEWTIDPKAAVKGADCVVTDTWISMSDSPKEAA 254

Query: 236 REEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
                 +P++VN  LM++A P+ALFMHCLPAH GEEV  +V +GP SVVFDEAENRLH Q
Sbjct: 255 SRMSKLEPYRVNADLMALAAPEALFMHCLPAHIGEEVTKDVFEGPHSVVFDEAENRLHAQ 314

Query: 296 KAILLWCFG 304
           K +L W  G
Sbjct: 315 KGVLAWTMG 323


>gi|307941511|ref|ZP_07656866.1| ornithine carbamoyltransferase [Roseibium sp. TrichSKD4]
 gi|307775119|gb|EFO34325.1| ornithine carbamoyltransferase [Roseibium sp. TrichSKD4]
          Length = 309

 Score =  356 bits (914), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 164/299 (54%), Positives = 213/299 (71%), Gaps = 1/299 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-PLSGKVLAMIFEKPSTRTRVSFEV 64
           +HF DL+      +  I+E+ K+IK +   +   + PL+GKVLAM+FE+PSTRTR+SF+V
Sbjct: 8   RHFLDLTEFGGEEIRAILELGKEIKKTRNGVHRGQGPLAGKVLAMVFEQPSTRTRISFDV 67

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M+ LGG+T+ L+G+EMQLGR ETI DTA+VLSR+VDAI++R  +H  L EL E ATVPV
Sbjct: 68  GMRELGGETLMLTGAEMQLGRGETIADTARVLSRFVDAIMIRILDHDDLNELAEAATVPV 127

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LT  +HPCQI+ADIMT+EEHRGS+KGK  +W+GD NN+L S +  A R ++ + IAT
Sbjct: 128 INGLTKLSHPCQIMADIMTYEEHRGSIKGKSVAWTGDSNNVLASWVHAAPRLDFEMRIAT 187

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P    P  E L  AR  G  + +  D  +A KGA C+ TD W+SM  + + +  ++   +
Sbjct: 188 PKELAPPTELLEQARAAGGEIIVTDDPFEAAKGADCIVTDCWVSMGDDDEEQRHNLLGAY 247

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           QVN  LM  A  D+LFMHCLPAHRGEEV +EV+DGP SVVFDEAENRLH QK IL WCF
Sbjct: 248 QVNNRLMKEAKADSLFMHCLPAHRGEEVTSEVMDGPHSVVFDEAENRLHAQKGILAWCF 306


>gi|296536734|ref|ZP_06898792.1| ornithine carbamoyltransferase [Roseomonas cervicalis ATCC 49957]
 gi|296262938|gb|EFH09505.1| ornithine carbamoyltransferase [Roseomonas cervicalis ATCC 49957]
          Length = 320

 Score =  355 bits (911), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 161/303 (53%), Positives = 221/303 (72%), Gaps = 6/303 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           P+HF +L++  ++ L  ++ +A   K         KPL+GK +A+IFEKPSTRTRVSFEV
Sbjct: 19  PRHFLELADFDAATLRHMLALAADAKAGR---VPEKPLAGKSVALIFEKPSTRTRVSFEV 75

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            ++ LGG  + LS  +MQLGR E++ DTA+VLSRYVDAI++RT + ++L  L E+ATVPV
Sbjct: 76  GIQKLGGHAVVLSARDMQLGRGESVADTARVLSRYVDAIMLRTDSVAKLRGLAEHATVPV 135

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD +HPCQ++ADI+TFEEHRG V GK+F+W+GDGNN+  S I+ AARF++ L +AT
Sbjct: 136 INGLTDVSHPCQLMADILTFEEHRGPVAGKVFAWTGDGNNVAQSFIQAAARFDFTLRLAT 195

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK---AREEHVF 241
           P    P  + ++WAR +GA V L  D V+AV+GA CV TDTW+SM+ E +   +   ++ 
Sbjct: 196 PPELAPPAQLVDWARREGARVELTSDPVEAVRGADCVVTDTWVSMSDEKEDGPSARHNML 255

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
            P+Q+N +L+  A P+A+ +HCLPAHRGEE+  EV++GPQSVVFDEAENRLH Q  +LLW
Sbjct: 256 APYQLNAALLRHAKPEAIVLHCLPAHRGEEITEEVIEGPQSVVFDEAENRLHAQNGVLLW 315

Query: 302 CFG 304
              
Sbjct: 316 ALA 318


>gi|188583745|ref|YP_001927190.1| ornithine carbamoyltransferase [Methylobacterium populi BJ001]
 gi|179347243|gb|ACB82655.1| ornithine carbamoyltransferase [Methylobacterium populi BJ001]
          Length = 316

 Score =  354 bits (909), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 163/301 (54%), Positives = 215/301 (71%), Gaps = 2/301 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNS--SENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
           +HF DL + S+  L  +++ +  +K +         +PL+GK+LAM+F++PSTRTRVSF+
Sbjct: 13  RHFLDLKDFSAQTLRGVLDASAAMKRARVKGQPAAERPLTGKMLAMVFDRPSTRTRVSFD 72

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VAM+ LGGDT+ L+G EMQLGR ET+ DTA+VLSR+VDAIV+RT +H  ++EL E+A VP
Sbjct: 73  VAMRELGGDTLMLTGKEMQLGRGETVSDTARVLSRFVDAIVIRTLDHGLVMELAEHAEVP 132

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINALT  +HPCQI+AD++TFEEHRG +KG+  +WSGD NN+L S +  AARF++ LN+A
Sbjct: 133 VINALTKASHPCQIMADVLTFEEHRGPIKGRTIAWSGDANNVLASWVHAAARFDFTLNVA 192

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQP 243
            P           WA  +GA V    DA  AV+GA  V TD W+SM  + +    ++  P
Sbjct: 193 APNELAMPPALTAWAEREGARVHATTDAYAAVEGADAVVTDCWVSMGDDDEHFRHNLLSP 252

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           ++V+ +LM  A  DA+FMHCLPAHRGEEV  EV+DGPQSVVFDEAENRLH QK IL WC 
Sbjct: 253 YRVDAALMKAAAKDAIFMHCLPAHRGEEVTAEVIDGPQSVVFDEAENRLHAQKGILAWCL 312

Query: 304 G 304
           G
Sbjct: 313 G 313


>gi|255264870|ref|ZP_05344212.1| ornithine carbamoyltransferase [Thalassiobium sp. R2A62]
 gi|255107205|gb|EET49879.1| ornithine carbamoyltransferase [Thalassiobium sp. R2A62]
          Length = 308

 Score =  354 bits (909), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 164/305 (53%), Positives = 222/305 (72%), Gaps = 7/305 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSEN-----IFENKPLSGKVLAMIFEKPSTRTRVS 61
           HF D+   + S+L  II+ A+ IK++        + +++PL+G ++A+IFEKPSTRTRVS
Sbjct: 3   HFLDIHKTNPSDLRQIIDTARDIKDARHGRPKSALDDDQPLAGHMVALIFEKPSTRTRVS 62

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG T+ LSG++MQLG  ETI DTA+VLSRYVD I++RT + S L E+ EYA 
Sbjct: 63  FDVGVRQMGGQTMVLSGADMQLGHGETIADTARVLSRYVDLIMIRTFDESVLTEMAEYAD 122

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD THPCQI+AD+MT+EEHRG + GK   W+GDGNN+  S +  AA+F + L 
Sbjct: 123 VPVINGLTDRTHPCQIMADVMTYEEHRGPIAGKKVVWTGDGNNVCASFLHAAAQFKFDLT 182

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE--H 239
            A P   +P  E++  AR+ G  +++  DA +AV+GA  V  DTW+SM+    ARE   +
Sbjct: 183 FAGPSQLDPEGEFVKLARDAGCKISIERDADKAVQGADLVVADTWVSMHDAQSARERRHN 242

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + +P+QVN +LM+ A PDALFMHCLPAHR EEV +EV+DGPQSV+FDEAENRLH QKAI+
Sbjct: 243 MLRPYQVNAALMAQAEPDALFMHCLPAHREEEVTSEVMDGPQSVIFDEAENRLHAQKAIM 302

Query: 300 LWCFG 304
            +C G
Sbjct: 303 KFCLG 307


>gi|218661302|ref|ZP_03517232.1| ornithine carbamoyltransferase [Rhizobium etli IE4771]
          Length = 249

 Score =  353 bits (905), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 162/247 (65%), Positives = 200/247 (80%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           PKHF DLS ++S++L  I+  A   K + +    +KPL+GK+LAMIFEKPSTRTRVSF+V
Sbjct: 3   PKHFLDLSAVTSADLRTIMNDALSRKQAFKAGTGDKPLAGKMLAMIFEKPSTRTRVSFDV 62

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M+ LGG+T+FLSG+EMQLGRAETIGDTAKVLSRYVDAI++RTT HSRLLEL E+ATVPV
Sbjct: 63  GMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTEHSRLLELAEHATVPV 122

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALTD+THPCQI+ADIMTFEEHRG +KGK  +W+GDGNN+LHSL+EGAARF Y +N+A 
Sbjct: 123 INALTDDTHPCQIMADIMTFEEHRGPIKGKTIAWTGDGNNVLHSLVEGAARFGYRMNMAV 182

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P+GSEP++ YLNWARN+GA + L HDA +AV+G  CV TDTW+SMNQE +          
Sbjct: 183 PLGSEPKDHYLNWARNEGAEIMLCHDADRAVEGVDCVVTDTWVSMNQEHRGPGSQRLSAL 242

Query: 245 QVNLSLM 251
             + +LM
Sbjct: 243 SGHAALM 249


>gi|163797271|ref|ZP_02191225.1| histidinol-phosphate aminotransferase [alpha proteobacterium
           BAL199]
 gi|159177566|gb|EDP62120.1| histidinol-phosphate aminotransferase [alpha proteobacterium
           BAL199]
          Length = 303

 Score =  352 bits (903), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 165/302 (54%), Positives = 216/302 (71%), Gaps = 3/302 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M   +HF DL  + +  L  ++E AK  K  + +    +PL GK+LAMIFEKPSTRTRVS
Sbjct: 1   MNAVRHFLDLDRLDAGTLRGMLEQAKAYK--AGDGVAARPLDGKILAMIFEKPSTRTRVS 58

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  MK LGG+ I LSG+++Q+GR ET+ DTA+VLSRYVD IV+RT  HS LLEL E+AT
Sbjct: 59  FESGMKRLGGEVIVLSGADLQIGRGETVSDTARVLSRYVDCIVIRTFLHSTLLELAEHAT 118

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD+THPCQ++AD+M FEEHRG +K ++ +WSGDGNN+  S I  A +F++ L 
Sbjct: 119 VPVINGLTDSTHPCQLLADVMAFEEHRGPIKDRVVAWSGDGNNMASSWIHAAVQFDFELR 178

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           IA P    P  E + WA+ +G  + + HD   AV+GA  V TDTW+SM  E   R  ++ 
Sbjct: 179 IACPPELMPPPEVIAWAKAKGGRITVLHDPAAAVRGADAVVTDTWVSMGDEDTNR-HNLL 237

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
             ++V+ +L++ A PDA+FMHCLPAHRGEEV   V+DGPQS+V+DEAENR+HTQ A+L W
Sbjct: 238 AAYRVDEALLAKAKPDAVFMHCLPAHRGEEVTAGVIDGPQSIVWDEAENRMHTQMAVLSW 297

Query: 302 CF 303
           C 
Sbjct: 298 CL 299


>gi|299134025|ref|ZP_07027218.1| ornithine carbamoyltransferase [Afipia sp. 1NLS2]
 gi|298590772|gb|EFI50974.1| ornithine carbamoyltransferase [Afipia sp. 1NLS2]
          Length = 307

 Score =  352 bits (903), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 159/301 (52%), Positives = 209/301 (69%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF DLS +   +L  I++ +  +K + +    ++PL  K LAMIFE+PSTRTRVSFEV 
Sbjct: 6   RHFLDLSELPVHDLRAILDASIAMKKNLKAGHPDRPLKDKTLAMIFERPSTRTRVSFEVG 65

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+ I L+G EMQLGR ET  DTA+VLSR+VD I++R  +H  L E+ E+ATVPVI
Sbjct: 66  MRQLGGEAIMLTGQEMQLGRGETFADTARVLSRFVDIIMIRILSHDALAEMVEFATVPVI 125

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT  +HP Q++AD+MTFEEHRG +KG+  +W GD NN++ S    A RF + L +ATP
Sbjct: 126 NGLTRRSHPTQVMADVMTFEEHRGPIKGRTVAWVGDDNNVMASWAHAAERFGFTLRVATP 185

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
               P     +W +   A + L  DA +AV+G  CV TDTW+SM  +      ++ +P+Q
Sbjct: 186 PQLAPNKRLRDWIKATNAPIVLGTDAQEAVRGTDCVVTDTWMSMGDKDAEHRHNLLKPYQ 245

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGI 305
           V+  LMS+A PDA+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH  K IL WC G 
Sbjct: 246 VDEKLMSLAKPDAIFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAHKGILAWCLGA 305

Query: 306 I 306
           +
Sbjct: 306 V 306


>gi|259418804|ref|ZP_05742721.1| ornithine carbamoyltransferase [Silicibacter sp. TrichCH4B]
 gi|259345026|gb|EEW56880.1| ornithine carbamoyltransferase [Silicibacter sp. TrichCH4B]
          Length = 308

 Score =  351 bits (901), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 160/306 (52%), Positives = 221/306 (72%), Gaps = 7/306 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNS-----SENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           HF D+   S ++L  II+ A ++K++          +++PL+G+++A+IFEKPSTRTRVS
Sbjct: 3   HFLDIHKTSPADLRTIIDQAGQMKSARLGRPKGTPDDDQPLAGRMVALIFEKPSTRTRVS 62

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG+T+ LSG +MQLG  ETI DTA+V+SRYVD I++RT + + L E+ EYA 
Sbjct: 63  FDVGVRQMGGETMVLSGKDMQLGHGETIADTARVMSRYVDLIMIRTFDETVLTEMAEYAD 122

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD THPCQI+ADI+T+EEHRG +KGK   W+GDGNN+  S I  A +F + L 
Sbjct: 123 VPVINGLTDRTHPCQIMADILTYEEHRGPIKGKKVVWTGDGNNVCASFIHAAGQFGFDLT 182

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM--NQEFKAREEH 239
              P   +P +E++  AR  G+ + +  DA +AV+GA  V  DTW+SM  +Q  K R  +
Sbjct: 183 FTGPSQLDPEDEFIGLARRAGSKITIERDAAKAVEGADLVVADTWVSMHDSQSSKERRHN 242

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + +P+QVN +LM+ A PDALFMHCLPAHR EEV + V+DGPQSV+FDEAENRLH QKA++
Sbjct: 243 MLRPYQVNDALMAHAKPDALFMHCLPAHREEEVTSAVMDGPQSVIFDEAENRLHAQKAVM 302

Query: 300 LWCFGI 305
            WC G+
Sbjct: 303 RWCLGV 308


>gi|83309416|ref|YP_419680.1| ornithine carbamoyltransferase [Magnetospirillum magneticum AMB-1]
 gi|82944257|dbj|BAE49121.1| Ornithine carbamoyltransferase [Magnetospirillum magneticum AMB-1]
          Length = 305

 Score =  351 bits (901), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 167/299 (55%), Positives = 209/299 (69%), Gaps = 4/299 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           P+HF DL    ++ L  I+++    K          PL+GK+LAMIFEKPSTRTRVSFEV
Sbjct: 10  PRHFLDLDGFDTATLRHILDLGLAYKQGKG---PKAPLAGKMLAMIFEKPSTRTRVSFEV 66

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            MK LGGD I L+  + QLGR ETI DTA+VLSR+VDA+++RT    +L EL +YA VPV
Sbjct: 67  GMKQLGGDVIMLAAGDTQLGRGETIADTARVLSRFVDAVMIRTNLPEKLTELAKYADVPV 126

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD +HPCQ++AD+MTFEEHRGS+KGK+ +W GDGNN+  S I  A  F   + +A 
Sbjct: 127 INGLTDQSHPCQVMADVMTFEEHRGSLKGKVVAWVGDGNNVAASWIHAAGHFGCEIRLAC 186

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P    P    ++WAR +GASV L     +AV GAH V TDTW+SM  +   R E + +P+
Sbjct: 187 PDSLMPSRAAVDWARAKGASVVLTTHPAEAVAGAHLVLTDTWVSMGCQDSNRHE-LLEPY 245

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           QVN +LM+ A PDALFMHCLPAHRGEEV + V+DG QSVV+DEAENR+H QK IL WC 
Sbjct: 246 QVNEALMAKAAPDALFMHCLPAHRGEEVTDPVMDGIQSVVWDEAENRMHVQKGILTWCL 304


>gi|148261523|ref|YP_001235650.1| ornithine carbamoyltransferase [Acidiphilium cryptum JF-5]
 gi|326405011|ref|YP_004285093.1| ornithine carbamoyltransferase [Acidiphilium multivorum AIU301]
 gi|146403204|gb|ABQ31731.1| ornithine carbamoyltransferase [Acidiphilium cryptum JF-5]
 gi|325051873|dbj|BAJ82211.1| ornithine carbamoyltransferase [Acidiphilium multivorum AIU301]
          Length = 313

 Score =  351 bits (901), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 161/300 (53%), Positives = 210/300 (70%), Gaps = 2/300 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           P+HF DLS + +  L  +++ A + K +   +    PL+G+ LA+IFEKPSTRTRVSFE+
Sbjct: 14  PRHFLDLSLLDTPTLRHMLDTATRFKRAGRAL--GHPLAGRALALIFEKPSTRTRVSFEI 71

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M+ LGG+ I LS  EMQ+GR ET+ DTA+VLSRYVD I++RT    +L EL  +ATVPV
Sbjct: 72  GMRRLGGEVIMLSSREMQIGRGETVADTARVLSRYVDGIMLRTDREEKLRELAAHATVPV 131

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LT+ +HPCQ++AD+MTFEE RG + G+  +W GDGNN+  S IE +ARF + L +A 
Sbjct: 132 INGLTERSHPCQVMADVMTFEEQRGPIAGQRIAWIGDGNNMAKSWIEASARFGFQLRLAC 191

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P    P  E L WAR QGA + L     +AV+GA CV TDTW+SM+ E      ++  P+
Sbjct: 192 PEELLPDAEALAWARAQGADIQLTTSPAEAVEGARCVTTDTWVSMSDEDVESRHNILAPY 251

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           +V+ +LM+ A PDA+FMHCLPAHRGEEV   V+DGPQSVVFDEAENRL  Q+ IL W  G
Sbjct: 252 RVDEALMARAAPDAIFMHCLPAHRGEEVSAGVIDGPQSVVFDEAENRLFAQQGILAWALG 311


>gi|254463226|ref|ZP_05076642.1| ornithine carbamoyltransferase [Rhodobacterales bacterium HTCC2083]
 gi|206679815|gb|EDZ44302.1| ornithine carbamoyltransferase [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 308

 Score =  351 bits (900), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 166/305 (54%), Positives = 218/305 (71%), Gaps = 7/305 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNS-----SENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           HF D+    +S LS II  A+++K++        +  ++PL+G ++A+IFEKPSTRTRVS
Sbjct: 3   HFLDIHKTDTSALSGIITNARRMKDARVGLPKATLDADQPLAGHMVALIFEKPSTRTRVS 62

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG+T+ LSGS+MQLG  ETI DTA+VLSRYVD I++RT + S LLE+ EYA 
Sbjct: 63  FDVGVRQMGGETMVLSGSDMQLGHGETIADTARVLSRYVDLIMIRTFDESVLLEMAEYAD 122

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD THPCQI+AD+MTFEEHRG +KGK   W GDGNN+  S +  A +F + + 
Sbjct: 123 VPVINGLTDRTHPCQIMADVMTFEEHRGPIKGKKVVWCGDGNNVCASFLHAAGQFGFDMV 182

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM--NQEFKAREEH 239
              P   +P +E++  ARN G SV++  DA +AV+ A  V  DTW+SM  +Q  K R  +
Sbjct: 183 FTGPKQLDPEDEFIGLARNAGVSVSIERDAQKAVENADLVVADTWVSMHDSQSAKERRHN 242

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + +P+QVN  LMS A PDALFMHCLPAHR EE  + V+DGP SV+FDEAENRLH QKAI+
Sbjct: 243 MLRPYQVNEELMSHAKPDALFMHCLPAHREEEATSTVMDGPNSVIFDEAENRLHAQKAIM 302

Query: 300 LWCFG 304
            WC G
Sbjct: 303 RWCLG 307


>gi|323135686|ref|ZP_08070769.1| ornithine carbamoyltransferase [Methylocystis sp. ATCC 49242]
 gi|322398777|gb|EFY01296.1| ornithine carbamoyltransferase [Methylocystis sp. ATCC 49242]
          Length = 314

 Score =  350 bits (899), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 162/305 (53%), Positives = 211/305 (69%), Gaps = 2/305 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFE--NKPLSGKVLAMIFEKPSTRTR 59
           MT P+HF D+ + S   L  I+++AK +K       E   +PL+GK L MIF+KPSTRTR
Sbjct: 6   MTRPRHFLDICDHSGEELRRILDLAKSLKAKRVKGVEPTGRPLAGKYLGMIFDKPSTRTR 65

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+VAM+ LGG+TI L+G+EMQ+GR ETI DTA+VLSR++DAI++R  +H  L EL  +
Sbjct: 66  VSFDVAMRDLGGETIMLTGNEMQIGRGETIADTARVLSRFLDAIMIRILSHEDLTELARH 125

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ATVPVIN LT  +HPCQI+AD++TFEEH G + G+  +W GD NN+L S +  AARF + 
Sbjct: 126 ATVPVINGLTKLSHPCQIMADVLTFEEHCGPISGRTVAWIGDANNVLASWVHAAARFGFA 185

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           +N+ATP    P  E ++WA+  G ++ +  D   AV G   V TD W+SM    +     
Sbjct: 186 INVATPAELSPAAELVDWAKANGVAMNVTRDPYAAVAGTDAVITDCWVSMGDRDEDFRRK 245

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           V  P+QV+  LM  A  DA+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK +L
Sbjct: 246 VLAPYQVDAKLMRAADKDAVFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKGVL 305

Query: 300 LWCFG 304
            WC  
Sbjct: 306 AWCLA 310


>gi|99080507|ref|YP_612661.1| ornithine carbamoyltransferase [Ruegeria sp. TM1040]
 gi|123379040|sp|Q1GIW7|OTC_SILST RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|99036787|gb|ABF63399.1| ornithine carbamoyltransferase [Ruegeria sp. TM1040]
          Length = 308

 Score =  349 bits (896), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 160/306 (52%), Positives = 219/306 (71%), Gaps = 7/306 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNS-----SENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           HF D+   +  +L  II+ A ++K +          + +PL+G ++A+IFEKPSTRTRVS
Sbjct: 3   HFLDIHKTAPEDLRQIIDQAGQMKTARLGRPKGTPDDEQPLAGHMVALIFEKPSTRTRVS 62

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG+T+ LSG +MQLG  ETI DTA+VLSRYVD I++RT + + L E+ EYA 
Sbjct: 63  FDVGVRQMGGETMVLSGKDMQLGHGETIADTARVLSRYVDMIMIRTFDETVLTEMAEYAD 122

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD THPCQI+ADI+T+EEHRG +KGK   W+GDGNN+  S +  A +F + L 
Sbjct: 123 VPVINGLTDRTHPCQIMADILTYEEHRGPIKGKKVVWTGDGNNVCASFLHAAGQFGFDLT 182

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM--NQEFKAREEH 239
              P   +P +E++ +ARN G+ + +  DA +AV+GA  V  DTW+SM  +Q  K R  +
Sbjct: 183 FTGPAQLDPEDEFIGFARNAGSKITIERDAAKAVEGADLVVADTWVSMHDSQSSKERRHN 242

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + +P+QVN +LM+ A PDALFMHCLPAHR EEV + V+DGPQSV+FDEAENRLH QKA++
Sbjct: 243 MLRPYQVNDALMAHAKPDALFMHCLPAHREEEVTSAVMDGPQSVIFDEAENRLHAQKAVM 302

Query: 300 LWCFGI 305
            WC G+
Sbjct: 303 RWCLGV 308


>gi|239787685|emb|CAX84193.1| Ornithine carbamoyltransferase [uncultured bacterium]
          Length = 301

 Score =  349 bits (896), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 163/298 (54%), Positives = 215/298 (72%), Gaps = 3/298 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF +L       L  ++++    K     +   +PL G++LAMIFEKPSTRTRVSFEV 
Sbjct: 4   RHFLNLDRFDEIQLRHMLKLGLAFKQ--RKVANPQPLQGRILAMIFEKPSTRTRVSFEVG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           MK LGGD + L  ++ QLGR ET+ DTA+VLSRYVDAI++RT + ++L EL ++A+VPVI
Sbjct: 62  MKQLGGDVVVLGQNDTQLGRGETVADTARVLSRYVDAIMIRTNDPAKLDELAKHASVPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD THPCQI+ADIMTFEEHRG + GK+ +WSGDGNN+ ++ I+ AA F + + +A P
Sbjct: 122 NGLTDTTHPCQIMADIMTFEEHRGPIGGKVVAWSGDGNNVANTWIQAAALFGFDMRLACP 181

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
               P    L WAR++GA++ L     +AVKGA  V TD W+SM  E + R++H+  P+ 
Sbjct: 182 ANLPPDAATLAWARSKGANILLTETPSEAVKGADAVITDAWVSMGFESENRQDHLV-PYA 240

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN +LM++A PDALFMHCLPAHRGEEV + V+DGP SVV+DEAENRLH QK IL+WC 
Sbjct: 241 VNEALMALAKPDALFMHCLPAHRGEEVTDGVIDGPWSVVWDEAENRLHAQKGILMWCL 298


>gi|83594606|ref|YP_428358.1| ornithine carbamoyltransferase [Rhodospirillum rubrum ATCC 11170]
 gi|83577520|gb|ABC24071.1| ornithine carbamoyltransferase [Rhodospirillum rubrum ATCC 11170]
          Length = 308

 Score =  349 bits (895), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 164/303 (54%), Positives = 212/303 (69%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           +M  P+HF +LS+  +  L  +++     K        + PL+GK LA+IFEKPSTRTRV
Sbjct: 3   VMKTPRHFLELSDFDAPALRAMLDRGLAFKAERRAGVVSAPLAGKTLALIFEKPSTRTRV 62

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFEV M+ LGG +I LS +E QLGR ETI DTA+VLSRYVD I++RT + ++L +L++ A
Sbjct: 63  SFEVGMRQLGGSSITLSPTETQLGRGETIADTARVLSRYVDGIMLRTNDPAKLRDLSQNA 122

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +VPVIN LTD  HPCQI+AD+MTFEEHRGS+ GK+ +W GDGNN+  S I+ +A F + +
Sbjct: 123 SVPVINGLTDAAHPCQIMADLMTFEEHRGSITGKVVTWVGDGNNVACSWIKASALFGFTM 182

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            +A P   EP    L+WAR  G +V +  D  +AV GA CV TDTW+SM  +  A    +
Sbjct: 183 RLACPAELEPPQGVLDWARANGGAVEVLRDPQEAVAGADCVVTDTWVSMGCDGAAARHAL 242

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
            +P+QV   LM+ A  DALFMHCLPAHRGEEV  +V+DGPQSVV+DEAENRLH QK IL 
Sbjct: 243 LRPYQVTAPLMAAAAADALFMHCLPAHRGEEVTEDVIDGPQSVVWDEAENRLHAQKGILA 302

Query: 301 WCF 303
           WC 
Sbjct: 303 WCM 305


>gi|312115101|ref|YP_004012697.1| ornithine carbamoyltransferase [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220230|gb|ADP71598.1| ornithine carbamoyltransferase [Rhodomicrobium vannielii ATCC
           17100]
          Length = 320

 Score =  346 bits (888), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 163/308 (52%), Positives = 213/308 (69%), Gaps = 11/308 (3%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLS-------GKVLAMIFEKPS 55
           + P+HF D+ +     L  I++ A+ +K     + +  P S       GKVLAM+FEK S
Sbjct: 14  SAPRHFLDIDDYDFDTLRLILDNARALKK----LIKTSPASDWPKVAEGKVLAMLFEKSS 69

Query: 56  TRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLE 115
           TRTRVSF+VAM+ LGG+TI L+ ++MQLGR ETI DTA+VLSRYVDAI+MR T+H  L+E
Sbjct: 70  TRTRVSFDVAMRQLGGETIVLNRNDMQLGRGETIADTARVLSRYVDAIMMRCTSHEALIE 129

Query: 116 LTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAAR 175
           L E++ VPVIN L+D +HPCQI+ADIMT EEH+G V     +W GD NN+  S +  A R
Sbjct: 130 LAEHSAVPVINGLSDRSHPCQILADIMTLEEHKGDVAPLKVAWIGDFNNVTASWVHAAVR 189

Query: 176 FNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA 235
           F + + +ATP   +P   +L+WA ++G  + +  D   AV GA CV TD W+SM QE  A
Sbjct: 190 FGFAMTLATPKLLQPPRSFLDWANDEGGRITVVEDPAVAVAGADCVVTDVWVSMGQENVA 249

Query: 236 REEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
             E +  P+QVN +LM  A  +A+FMHCLPAHRG EV ++V+DGPQSVVFDEAENRLH Q
Sbjct: 250 ERETLLAPYQVNAALMEKADKNAIFMHCLPAHRGREVTDDVIDGPQSVVFDEAENRLHAQ 309

Query: 296 KAILLWCF 303
           +AIL WCF
Sbjct: 310 RAILAWCF 317


>gi|162147258|ref|YP_001601719.1| ornithine carbamoyltransferase [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161785835|emb|CAP55406.1| putative Ornithine carbamoyltransferase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 331

 Score =  345 bits (886), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 158/304 (51%), Positives = 210/304 (69%), Gaps = 4/304 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIK----NSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           P+HF DL +   + L  I+++  +IK      +  +   +PL G+ L ++  KPSTRTRV
Sbjct: 14  PRHFLDLRDFDGATLRAILDLGSRIKRMQHGRTRPLHPRQPLLGRALGLMLSKPSTRTRV 73

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFEV M+ LGGD I LS ++MQLGR E++ DTA+VLSR+VDAIV+RT N + L +L  +A
Sbjct: 74  SFEVGMRQLGGDVILLSPNDMQLGRGESVADTARVLSRFVDAIVLRTGNTAALHDLARWA 133

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +VPVIN LT ++HP QI+ADIMTFEEHRG + G+  +W GDGNN+  S IE A  F + L
Sbjct: 134 SVPVINGLTPDSHPVQILADIMTFEEHRGPIAGRTVAWVGDGNNVATSFIEAACLFGFRL 193

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            +ATP G  P  + L WAR +GA + +  D   AV GA CV TDTW+SM+    A+    
Sbjct: 194 RLATPPGHTPSVQALAWARQRGADIVVTTDPRAAVAGADCVVTDTWVSMSDTDAAQRLIA 253

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F P++V+ +LM++A PDALFMHCLPAH G+EV  +V +GP SVVFDEAENRLH QK +L+
Sbjct: 254 FDPYRVDAALMALAAPDALFMHCLPAHIGDEVTEDVFEGPHSVVFDEAENRLHAQKGLLV 313

Query: 301 WCFG 304
           W  G
Sbjct: 314 WAMG 317


>gi|86136553|ref|ZP_01055132.1| ornithine carbamoyltransferase [Roseobacter sp. MED193]
 gi|85827427|gb|EAQ47623.1| ornithine carbamoyltransferase [Roseobacter sp. MED193]
          Length = 308

 Score =  345 bits (885), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 161/306 (52%), Positives = 216/306 (70%), Gaps = 7/306 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSEN-----IFENKPLSGKVLAMIFEKPSTRTRVS 61
           HF D+    ++ L  II+ AK +K + +        + +PL+G+++A+IFEKPSTRTR+S
Sbjct: 3   HFLDIHTTDTTALHGIIDQAKLMKQARQGRPKGMPDDEQPLAGQMVALIFEKPSTRTRIS 62

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG ++ LSG +MQLG  ETI DTA+V+SRYVD I++RT + + L E+ EYA 
Sbjct: 63  FDVGVRQMGGQSMVLSGKDMQLGHGETIADTARVMSRYVDLIMIRTFDEAVLQEMAEYAD 122

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD THPCQI+ADI T+EEHRGS+KGK   W+GDGNN+  S +  AA+F + L 
Sbjct: 123 VPVINGLTDRTHPCQIMADIQTYEEHRGSIKGKKVVWAGDGNNVCASFLHAAAKFGFDLT 182

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM--NQEFKAREEH 239
              P   +P  E++  AR  G+ V +  DA +AV+GA  V  DTW+SM  +Q  K R  +
Sbjct: 183 FTGPAQLDPEEEFVGLARKAGSKVVIERDAFKAVEGADLVVADTWVSMHDSQSSKERRHN 242

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + +P+QVN  LMS A  DALFMHCLPAHR EEV + V+DGPQSV+FDEAENRLH QKAI+
Sbjct: 243 MLRPYQVNDELMSHAKSDALFMHCLPAHREEEVTSAVMDGPQSVIFDEAENRLHAQKAIM 302

Query: 300 LWCFGI 305
            WC G+
Sbjct: 303 RWCLGV 308


>gi|58039689|ref|YP_191653.1| ornithine carbamoyltransferase [Gluconobacter oxydans 621H]
 gi|58002103|gb|AAW60997.1| Ornithine carbamoyltransferase [Gluconobacter oxydans 621H]
          Length = 342

 Score =  345 bits (885), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 158/304 (51%), Positives = 213/304 (70%), Gaps = 4/304 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIK----NSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           P+HF DL + S   +  II+++ K+K       + +  ++PL G+ L +I  +PSTRTRV
Sbjct: 35  PRHFLDLRDFSPEVIRQIIDLSAKVKALQNGRRQPLHPDRPLEGRSLGLILAQPSTRTRV 94

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFEV M  LGG    LS  +MQLGR ET+ DTA+VLSR++D IV+RT N + L EL +++
Sbjct: 95  SFEVGMGQLGGSVSVLSPGDMQLGRGETVADTARVLSRFLDVIVLRTGNDANLRELAKWS 154

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +VPVIN LT  +HP QI+A ++TFEEHRG ++GK  +W GDGNN+  SL+EGAA   + +
Sbjct: 155 SVPVINGLTPVSHPIQILAGVLTFEEHRGPIRGKTLAWIGDGNNVATSLMEGAALLGFNV 214

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            +ATP G  P  + + WAR  GA++ +F D  +AV GA  V TDTW+SM  + + +   V
Sbjct: 215 RLATPEGFAPNPDAVAWARAHGATIEIFRDPAEAVAGADAVLTDTWVSMGDKDREKRLKV 274

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           FQP+QV+ +LM+ A PDALF+HCLPAH GEEV +EV +GP SVVFDEAENRLHTQK +LL
Sbjct: 275 FQPYQVDGALMAKAAPDALFLHCLPAHIGEEVTSEVFEGPASVVFDEAENRLHTQKGLLL 334

Query: 301 WCFG 304
           W  G
Sbjct: 335 WALG 338


>gi|209544308|ref|YP_002276537.1| ornithine carbamoyltransferase [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209531985|gb|ACI51922.1| ornithine carbamoyltransferase [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 331

 Score =  345 bits (885), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 158/304 (51%), Positives = 209/304 (68%), Gaps = 4/304 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIK----NSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           P+HF DL +   + L  I+++  +IK      +  +   +PL G+ L ++  KPSTRTRV
Sbjct: 14  PRHFLDLRDFDGATLRAILDLGSRIKRMQHGRTRPLHPRQPLLGRALGLMLSKPSTRTRV 73

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFEV M+ LGGD I LS ++MQLGR E++ DTA+VLSR+VDAIV+RT N + L +L  +A
Sbjct: 74  SFEVGMRQLGGDVILLSPNDMQLGRGESVADTARVLSRFVDAIVLRTGNTAALHDLARWA 133

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +VPVIN LT ++HP QI+ADIMTFEEHRG + G+  +W GDGNN+  S IE A  F + L
Sbjct: 134 SVPVINGLTPDSHPVQILADIMTFEEHRGPIAGRTVAWVGDGNNVATSFIEAARLFGFRL 193

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            +ATP G  P  + L WAR  GA + +  D   AV GA CV TDTW+SM+    A+    
Sbjct: 194 RLATPPGHMPSTQALAWARQGGADIVVTTDPRAAVAGADCVVTDTWVSMSDTDAAQRLIA 253

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F P++V+ +LM++A PDALFMHCLPAH G+EV  +V +GP SVVFDEAENRLH QK +L+
Sbjct: 254 FDPYRVDAALMALAAPDALFMHCLPAHIGDEVTEDVFEGPHSVVFDEAENRLHAQKGLLV 313

Query: 301 WCFG 304
           W  G
Sbjct: 314 WAMG 317


>gi|114764001|ref|ZP_01443242.1| ornithine carbamoyltransferase [Pelagibaca bermudensis HTCC2601]
 gi|114543593|gb|EAU46607.1| ornithine carbamoyltransferase [Roseovarius sp. HTCC2601]
          Length = 308

 Score =  345 bits (884), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 161/305 (52%), Positives = 213/305 (69%), Gaps = 7/305 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSEN-----IFENKPLSGKVLAMIFEKPSTRTRVS 61
           HF D+      +L  II+ AK IK+           ++ PL  +++A+IFEKPSTRTRVS
Sbjct: 3   HFLDIHKTDKDDLRSIIDAAKAIKDKRNGRPRAAPDDDLPLKDRMVALIFEKPSTRTRVS 62

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG T+ LSGS+MQLG  ETI DTA+VLSR+VD I++RT + + L E+ EYA 
Sbjct: 63  FDVGVRQMGGQTMVLSGSDMQLGHGETIADTARVLSRFVDMIMIRTFDEAVLTEMAEYAD 122

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD THPCQI+ADI+TFEEHRG + GK   W GDGNN+  S +  A +F + L 
Sbjct: 123 VPVINGLTDRTHPCQIMADILTFEEHRGPIAGKKVVWCGDGNNVCASFLHAAGQFGFDLT 182

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKAREEH 239
              P+  +P  E++  ARNQG+++ +  D  +AV+GA  V  DTW+SM+  Q  K R  +
Sbjct: 183 FTGPVQLDPEMEFVGLARNQGSTITIERDPFKAVEGADLVVADTWVSMHDAQSAKERRHN 242

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + +P+QVN  LM  A  DALFMHCLPAHRGEEV +E++DGPQSV++DEAENRLH QKAI+
Sbjct: 243 MLRPYQVNDKLMEAAGKDALFMHCLPAHRGEEVTSEIMDGPQSVIWDEAENRLHAQKAIM 302

Query: 300 LWCFG 304
            WC G
Sbjct: 303 RWCVG 307


>gi|296117453|ref|ZP_06836040.1| ornithine carbamoyltransferase [Gluconacetobacter hansenii ATCC
           23769]
 gi|295975974|gb|EFG82765.1| ornithine carbamoyltransferase [Gluconacetobacter hansenii ATCC
           23769]
          Length = 329

 Score =  345 bits (884), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 159/303 (52%), Positives = 209/303 (68%), Gaps = 4/303 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIK----NSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           P+HF DL ++ ++ L  I++VA  IK      +  +    PL G++L ++  KPSTRTRV
Sbjct: 14  PRHFLDLRDLDAATLRAILDVAAGIKRMQHGRARPLHPRLPLHGRMLGLMLSKPSTRTRV 73

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFEV M+ LGGD I LS  +MQLGR E+I DTA+VLSR+VDA+V+RT     L EL +++
Sbjct: 74  SFEVGMRQLGGDVILLSPGDMQLGRGESIADTARVLSRFVDALVLRTGRTQNLRELAKWS 133

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +VPVIN LT ++HP QI+ADIMTFEEHRG + G+  +W GDGNN+  S IE AA F + L
Sbjct: 134 SVPVINGLTPDSHPVQILADIMTFEEHRGPITGRTLAWVGDGNNVATSFIEAAALFGFRL 193

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            +ATP    P    + WAR QGA + +  DA+ AV GA  V TDTW+SM+     +  H 
Sbjct: 194 RLATPPTHLPCTRAVEWARAQGADITVGTDAMTAVAGADAVITDTWVSMSDNASEQRAHA 253

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+P++V+ +LM+ A PDALF+HCLPAH GEEV  +V DGP SVVFDEAENRLH QK +L+
Sbjct: 254 FEPYRVDAALMARAAPDALFLHCLPAHIGEEVTADVFDGPNSVVFDEAENRLHAQKGLLV 313

Query: 301 WCF 303
           W  
Sbjct: 314 WAL 316


>gi|85703319|ref|ZP_01034423.1| ornithine carbamoyltransferase [Roseovarius sp. 217]
 gi|85672247|gb|EAQ27104.1| ornithine carbamoyltransferase [Roseovarius sp. 217]
          Length = 291

 Score =  344 bits (883), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 152/270 (56%), Positives = 205/270 (75%), Gaps = 2/270 (0%)

Query: 38  ENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLS 97
           + +PL+G+++A+IFEKPSTRTRVSF+V ++ +GG T+ LSG++MQLG  ETI DTA+V+S
Sbjct: 22  DEQPLAGRMVALIFEKPSTRTRVSFDVGVRQMGGQTLVLSGADMQLGHGETIADTARVMS 81

Query: 98  RYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFS 157
           RYVD I++RT + S LLE+ E+A VPVIN LTD THPCQI+ADI+T+EEHRG ++GK   
Sbjct: 82  RYVDLIMIRTFDESVLLEMAEHADVPVINGLTDRTHPCQIMADILTYEEHRGPIQGKKVV 141

Query: 158 WSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKG 217
           WSGDGNN+  SL+  A +F + L    P+  +P  E++  AR  G+++ +  D  +AV G
Sbjct: 142 WSGDGNNVCASLLHAAGQFGFDLTFTGPMQLDPEPEFIGLARKAGSTITIERDPFKAVDG 201

Query: 218 AHCVFTDTWISM--NQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINE 275
           A  V TDTW+SM  +Q  K R  ++ +P+QVN  LM+ A PDALFMHCLPAHRGEEV ++
Sbjct: 202 ADLVVTDTWVSMHDSQSMKERRHNMLRPYQVNDKLMAAAKPDALFMHCLPAHRGEEVTSD 261

Query: 276 VLDGPQSVVFDEAENRLHTQKAILLWCFGI 305
           V+DGP SV+FDEAENRLH QKA++ WC G+
Sbjct: 262 VMDGPTSVIFDEAENRLHAQKAVMRWCLGV 291


>gi|23016456|ref|ZP_00056212.1| COG0078: Ornithine carbamoyltransferase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 305

 Score =  343 bits (881), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 162/298 (54%), Positives = 208/298 (69%), Gaps = 4/298 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF DL+   ++ L  I+++    K          PL+GK+LAMIFEKPSTRTRVSFEV 
Sbjct: 11  RHFLDLNEFDTATLRHILDLGLAYKQGKG---PKAPLAGKMLAMIFEKPSTRTRVSFEVG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           MK LGGD I L+  + QLGR ETI DTA+VLSR+VD +++RT    ++ EL +YA VPVI
Sbjct: 68  MKQLGGDVIMLAAGDTQLGRGETIADTARVLSRFVDVVMIRTNLPEKMTELAKYADVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD +HPCQ++AD+MTFEEHRGS+KGK+ +W GDGNN+  S I  A  F   + +A P
Sbjct: 128 NGLTDESHPCQVMADVMTFEEHRGSLKGKVVAWVGDGNNVAASWIHAAGHFGCEIRLACP 187

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
               P  + ++WAR +G SV L     +AV GAH V TDTW+SM  +   R E + +P+Q
Sbjct: 188 ESLMPSRKAVDWARARGTSVVLTTHPAEAVAGAHLVLTDTWVSMGCQDDNRHE-LLEPYQ 246

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN +LM+ A PDALFMHCLPAHRGEEV + ++DG QSVV+DEAENR+H QK IL WC 
Sbjct: 247 VNEALMAKASPDALFMHCLPAHRGEEVTDAIMDGHQSVVWDEAENRMHVQKGILTWCL 304


>gi|56695865|ref|YP_166216.1| ornithine carbamoyltransferase [Ruegeria pomeroyi DSS-3]
 gi|81350432|sp|Q5LUT9|OTC_SILPO RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|56677602|gb|AAV94268.1| ornithine carbamoyltransferase [Ruegeria pomeroyi DSS-3]
          Length = 308

 Score =  343 bits (881), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 157/305 (51%), Positives = 214/305 (70%), Gaps = 7/305 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNS-----SENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           HF D+    +++L  +I+ A  +K +          + +PL  +++A+IFEKPSTRTRVS
Sbjct: 3   HFLDIHKTDAADLRAMIDQAGAMKQARLGRPKAAPDDEQPLKDRMVALIFEKPSTRTRVS 62

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG T+ LSG++MQLG  ETI DTA+VLSRYVD I++RT + S L E+ EYA 
Sbjct: 63  FDVGVRQMGGQTMVLSGNDMQLGHGETIADTARVLSRYVDMIMIRTFDESVLAEMAEYAD 122

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD +HPCQI+AD++T+EEHRG + GK   W+GDGNN+  S +  A +F + L 
Sbjct: 123 VPVINGLTDRSHPCQIMADVLTYEEHRGPIAGKKVVWTGDGNNVCSSFLHAAGQFGFDLT 182

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKAREEH 239
            + P   +P  EY+ +AR +G+ + +  DAV+AV+GA  V  DTW+SM+  Q  K R  +
Sbjct: 183 FSGPAQFDPEEEYMGFARQKGSKIVIERDAVKAVEGADLVVADTWVSMHDAQSAKERRHN 242

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + +P+QVN  LM  A PDALFMHCLPAHR EE  +EV+DGP SV+FDEAENRLH QKAI+
Sbjct: 243 LLRPYQVNAELMRHAKPDALFMHCLPAHREEEATSEVMDGPHSVIFDEAENRLHAQKAIM 302

Query: 300 LWCFG 304
            WC G
Sbjct: 303 RWCLG 307


>gi|260177209|gb|ACX33932.1| putative ornithine carbamoyltransferase [uncultured prokaryote AT5]
          Length = 302

 Score =  343 bits (880), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 162/298 (54%), Positives = 210/298 (70%), Gaps = 2/298 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F DL +I    L  +IE ++ IK   E       L G+ LAMIF+KPSTRTRVSF+VA
Sbjct: 4   RDFLDLIDIPRQELRGMIESSRAIKARRERAARA--LEGRTLAMIFDKPSTRTRVSFDVA 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG  + L+G EMQLGR ETI DTA+VLSRYVD I++RT +H  L EL  +ATVPVI
Sbjct: 62  MRQLGGTAMLLTGQEMQLGRGETIADTARVLSRYVDIIMIRTLDHDMLTELARHATVPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT  +HPCQ++AD+MTFEEH G ++GK  +W+GD NN+L S +  A RF++ L +ATP
Sbjct: 122 NGLTRRSHPCQVLADVMTFEEHCGPIRGKTVAWTGDANNVLASWMHAAERFDFRLRVATP 181

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
               P+    +WA+  GA++ +  D  +AVKG  CV TDTW+SM  +   R  ++ + +Q
Sbjct: 182 PELAPKKWLRDWAKTSGAAIDIGSDPEEAVKGCDCVVTDTWVSMGDKDGQRRHNLLKRYQ 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN  L+++A P A+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK IL WC 
Sbjct: 242 VNARLLALASPRAVFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKGILAWCL 299


>gi|254465437|ref|ZP_05078848.1| ornithine carbamoyltransferase [Rhodobacterales bacterium Y4I]
 gi|206686345|gb|EDZ46827.1| ornithine carbamoyltransferase [Rhodobacterales bacterium Y4I]
          Length = 308

 Score =  343 bits (880), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 160/305 (52%), Positives = 211/305 (69%), Gaps = 7/305 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNS-----SENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           HF D+     ++L  II+ AK  K +        + +  PL  K++A+IFEKPSTRTRVS
Sbjct: 3   HFLDIHKTGPADLRAIIDQAKATKQARLGRPKAALDDELPLKDKMVALIFEKPSTRTRVS 62

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG T+ LSG +MQLG  ETI DTA+VLSRYVD I++RT + + L E+ EY+ 
Sbjct: 63  FDVGVRQMGGQTMVLSGKDMQLGHGETIADTARVLSRYVDMIMIRTFDETVLTEMAEYSD 122

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD THPCQI+AD++T+EEHRG ++GK   W GDGNN+  S +  A +F + L 
Sbjct: 123 VPVINGLTDRTHPCQIMADVLTYEEHRGPIRGKKVVWCGDGNNVCASFLHAAGQFGFDLT 182

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM--NQEFKAREEH 239
            A P   +P  E++  AR  G+ V +  DA +AV+GA  V TDTW+SM  +Q  K R  +
Sbjct: 183 FAGPAQLDPEEEFVGLARKAGSKVVIERDAAKAVEGADLVVTDTWVSMHDSQSSKERRHN 242

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + +P+QVN  LMS A PDALFMHCLPAHR EE  ++V+DGP SV+FDEAENRLH QKAI+
Sbjct: 243 MLRPYQVNAELMSHAKPDALFMHCLPAHREEEATSQVMDGPNSVIFDEAENRLHAQKAIM 302

Query: 300 LWCFG 304
            WC G
Sbjct: 303 RWCAG 307


>gi|260427506|ref|ZP_05781485.1| ornithine carbamoyltransferase [Citreicella sp. SE45]
 gi|260421998|gb|EEX15249.1| ornithine carbamoyltransferase [Citreicella sp. SE45]
          Length = 329

 Score =  343 bits (879), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 161/303 (53%), Positives = 214/303 (70%), Gaps = 7/303 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSEN-----IFENKPLSGKVLAMIFEKPSTRTRVS 61
           HF D+     + L  II+ AK IKN+        + ++ PL   ++A+IFEKPSTRTR S
Sbjct: 24  HFLDIHKTDKAALRSIIDSAKDIKNARSGRRRAALDDDLPLKDHMVALIFEKPSTRTRTS 83

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG T+ LSGS+MQLG  ETI DTA+V+SR+VD I++RT + S L+E+ EYA+
Sbjct: 84  FDVGVRQMGGQTMVLSGSDMQLGHGETIADTARVMSRFVDMIMIRTFDESVLIEMAEYAS 143

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD THPCQI+AD+MTFEEHRG ++GK   W GDGNN+  S +  A +F + L 
Sbjct: 144 VPVINGLTDRTHPCQIMADVMTFEEHRGPIEGKKVVWCGDGNNVCASFLHAAGQFGFDLT 203

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE--H 239
              P+  +P  E++  AR  GA+V +  D  +AV+GA  V  DTW+SM+    ARE   +
Sbjct: 204 FTGPVQLDPEMEFVGLARQAGAAVTIERDPFKAVEGADLVVADTWVSMHDAQSARERRHN 263

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + +P+QVN +LM  A  DALFMHCLPAHRGEEV +EV+DGPQSV++DEAENRLH QKAI+
Sbjct: 264 MLRPYQVNEALMEAAGKDALFMHCLPAHRGEEVTSEVMDGPQSVIWDEAENRLHAQKAIM 323

Query: 300 LWC 302
            WC
Sbjct: 324 RWC 326


>gi|254477141|ref|ZP_05090527.1| ornithine carbamoyltransferase [Ruegeria sp. R11]
 gi|214031384|gb|EEB72219.1| ornithine carbamoyltransferase [Ruegeria sp. R11]
          Length = 308

 Score =  341 bits (875), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 157/305 (51%), Positives = 216/305 (70%), Gaps = 7/305 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSEN-----IFENKPLSGKVLAMIFEKPSTRTRVS 61
           HF D+    +++L  II+ A+  K++ +      + + +PL  +++A+IFEKPSTRTRVS
Sbjct: 3   HFLDIHKTDAADLRAIIDQARITKDARQGRPKAALDDEQPLKDRMVALIFEKPSTRTRVS 62

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG T+ LSG++MQLG  ETI DTA+VLSRYVD I++RT + + L E+ EYA+
Sbjct: 63  FDVGVRQMGGQTMVLSGNDMQLGHGETIADTARVLSRYVDMIMIRTFDETVLTEMAEYAS 122

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD THPCQI+AD++T+EEHRGS+KGK   W GDGNN+  S I  A +F + L 
Sbjct: 123 VPVINGLTDRTHPCQIMADVLTYEEHRGSIKGKKVVWCGDGNNVCASFIHAAGQFGFDLT 182

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM--NQEFKAREEH 239
              P   +P  E++  AR  G+ + +  D  +AV+GA  V  DTW+SM  +Q  K R  +
Sbjct: 183 FTGPAQLDPEEEFVGLARKAGSQIIIERDVNKAVEGADLVVADTWVSMHDSQSSKERRHN 242

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + + +QVN +LM+ A PDALFMHCLPAHR EEV + V+DGPQSV+FDEAENRLH QKAI+
Sbjct: 243 MLRSYQVNEALMAQAKPDALFMHCLPAHREEEVTSAVMDGPQSVIFDEAENRLHAQKAIM 302

Query: 300 LWCFG 304
            +C G
Sbjct: 303 RYCLG 307


>gi|114773339|ref|ZP_01450543.1| ornithine carbamoyltransferase [alpha proteobacterium HTCC2255]
 gi|114546273|gb|EAU49184.1| ornithine carbamoyltransferase [alpha proteobacterium HTCC2255]
          Length = 307

 Score =  341 bits (874), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 163/308 (52%), Positives = 220/308 (71%), Gaps = 11/308 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIK-------NSSENIFENKPLSGKVLAMIFEKPSTRT 58
           KHF D++  + ++L+ I++ AKK K       N + +I  ++ LSGK++A+IFEKPSTRT
Sbjct: 2   KHFLDINKTNVNDLNQILDQAKKTKATRAGFANGANDI--DQTLSGKMVALIFEKPSTRT 59

Query: 59  RVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTE 118
           RVSF++ ++ +GG T+ LSG+EMQ+G  E+I DTA+VLSRYVD I++RT   + LLEL E
Sbjct: 60  RVSFDMGVRQMGGQTMVLSGAEMQIGHGESIADTARVLSRYVDMIMIRTFAEATLLELAE 119

Query: 119 YATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNY 178
           Y+TVPVIN LTD +HPCQI+ADIMTF+E  GS+ GK   W GDGNN+  S +  A +F +
Sbjct: 120 YSTVPVINGLTDRSHPCQIMADIMTFQEKHGSISGKKVVWLGDGNNVCTSFLHAAGKFGF 179

Query: 179 LLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM--NQEFKAR 236
            L  A P   +P  E + +AR+ G++V +  DA +AVK A  + TDTW+SM  +Q  +AR
Sbjct: 180 NLTFAGPEVLDPETEAMGYARSNGSTVEIERDASKAVKDADLIVTDTWLSMHDDQAARAR 239

Query: 237 EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
             ++ +P+QVN  LM  A  DA+FMHCLPAHR EEV +EV+DG  SVVFDEAENRLH QK
Sbjct: 240 RHNLLRPYQVNAELMKQASKDAIFMHCLPAHREEEVTSEVMDGANSVVFDEAENRLHVQK 299

Query: 297 AILLWCFG 304
           AI+ WC G
Sbjct: 300 AIMQWCLG 307


>gi|119384771|ref|YP_915827.1| ornithine carbamoyltransferase [Paracoccus denitrificans PD1222]
 gi|254772729|sp|A1B3N7|OTC_PARDP RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|119374538|gb|ABL70131.1| ornithine carbamoyltransferase [Paracoccus denitrificans PD1222]
          Length = 308

 Score =  341 bits (874), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 159/305 (52%), Positives = 212/305 (69%), Gaps = 7/305 (2%)

Query: 8   FADLSNISSSNLSCIIEVAKKIKNSSENIFENKP-----LSGKVLAMIFEKPSTRTRVSF 62
           F D+ N   S+L  +I+ A+++K++     +  P     L  +++A+IFEKPSTRTRVSF
Sbjct: 4   FLDIHNTDRSDLRGMIDSARRMKDARSGQPKGTPDADLPLKNRMVALIFEKPSTRTRVSF 63

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           ++ ++ +GG T+ LSG EMQLG  ETI DTA+VLSRYVD I++RT   + LLE+ EYA+V
Sbjct: 64  DLGVRQMGGQTMVLSGKEMQLGHGETIADTARVLSRYVDLIMIRTFEEATLLEMAEYASV 123

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVIN LT+ THPCQ++AD+MTFEEHRG + GK   WSGDGNN+  S+I  A +F Y    
Sbjct: 124 PVINGLTNRTHPCQVMADVMTFEEHRGPIAGKKVVWSGDGNNVCCSMIHAAGQFGYDFTF 183

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE--HV 240
             P   +P  E L++AR QG    +  D  +AV+GA  V TDTW+SM+    ARE   + 
Sbjct: 184 TGPPTLDPEREALDFARAQGVQAVIERDPAKAVEGADLVVTDTWVSMHDPQSARERRHNQ 243

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
            +P+QVN +LM+ A PDALFMHCLPAHR +E  + V+DGP SV+FDEAENRLH QKAI+ 
Sbjct: 244 LRPYQVNEALMAHAKPDALFMHCLPAHRDDEATSAVMDGPNSVIFDEAENRLHAQKAIMR 303

Query: 301 WCFGI 305
           WC G+
Sbjct: 304 WCLGL 308


>gi|126731531|ref|ZP_01747337.1| ornithine carbamoyltransferase [Sagittula stellata E-37]
 gi|126708067|gb|EBA07127.1| ornithine carbamoyltransferase [Sagittula stellata E-37]
          Length = 308

 Score =  340 bits (873), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 157/303 (51%), Positives = 213/303 (70%), Gaps = 7/303 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENI-----FENKPLSGKVLAMIFEKPSTRTRVS 61
           HF D+     + L  II+ A+ +K++ +        +  PL  +++A+IFEKPSTRTR S
Sbjct: 3   HFLDIHKTDKTALRGIIDNARAVKDARKGKPKVEPDDELPLKNRMVALIFEKPSTRTRTS 62

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG T+ LSGS+MQLG  ETI DTA+V+SRYVD I++RT + S L E+ EYA+
Sbjct: 63  FDVGVRQMGGQTMVLSGSDMQLGHGETIADTARVMSRYVDMIMIRTFDESVLEEMAEYAS 122

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD THPCQI+AD+MTFEEHRG + GK   W GDGNN+  S +  A +F + L 
Sbjct: 123 VPVINGLTDRTHPCQIMADVMTFEEHRGPIAGKKVVWCGDGNNVCASFLHAAGQFGFDLT 182

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE--H 239
            + P+  +P  E++ WAR QG+ V +  D  +AV+GA  V  DTW+SM+    ARE   +
Sbjct: 183 FSGPVQLDPEPEFVGWARQQGSKVTIERDPAKAVEGADLVVADTWVSMHDAQSARERRHN 242

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + +P+QVN +LM+ A  DALFMHCLPAHR EEV +E++DGP SV++DEAENRLH QKAI+
Sbjct: 243 MLRPYQVNAALMAQAKEDALFMHCLPAHREEEVTSEIMDGPHSVIWDEAENRLHAQKAIM 302

Query: 300 LWC 302
            WC
Sbjct: 303 RWC 305


>gi|260431030|ref|ZP_05785001.1| ornithine carbamoyltransferase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260414858|gb|EEX08117.1| ornithine carbamoyltransferase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 314

 Score =  340 bits (873), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 155/306 (50%), Positives = 213/306 (69%), Gaps = 7/306 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNS-----SENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           HF D+    ++ L  +I+ A  +K +          + +PL+G+++A+IFEKPSTRTRVS
Sbjct: 9   HFLDIHKTDAAALRSMIDQAGAMKQARLGRPKAAPDDEQPLAGRMVALIFEKPSTRTRVS 68

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG T+ LSG +MQLG  ETI DTA+VLSRYVD I++RT + + L E+ EY+ 
Sbjct: 69  FDVGVRQMGGQTMVLSGKDMQLGHGETIADTARVLSRYVDMIMIRTFDETILTEMAEYSD 128

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD THPCQI+AD++T+EEHRG + GK   W+GDGNN+  S +  A +F + L 
Sbjct: 129 VPVINGLTDRTHPCQIMADVLTYEEHRGPIAGKKVVWTGDGNNVCASFLHAAGQFGFDLT 188

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM--NQEFKAREEH 239
              P   +P  E++ +AR +G+ V +  D  +AV+GA  V  DTW+SM  +Q  K R  +
Sbjct: 189 FTGPAQFDPEEEFIGFARQKGSKVVIERDPYKAVEGADLVVADTWVSMHDSQSAKERRHN 248

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + +P+QVN  LMS A PDALFMHCLPAHR EE  +EV+DGP SV+FDEAENRLH QKA++
Sbjct: 249 LLRPYQVNADLMSHAKPDALFMHCLPAHREEEATSEVMDGPNSVIFDEAENRLHAQKAVM 308

Query: 300 LWCFGI 305
            WC G+
Sbjct: 309 RWCLGV 314


>gi|294678650|ref|YP_003579265.1| ornithine carbamoyltransferase [Rhodobacter capsulatus SB 1003]
 gi|294477470|gb|ADE86858.1| ornithine carbamoyltransferase [Rhodobacter capsulatus SB 1003]
          Length = 308

 Score =  340 bits (871), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 156/305 (51%), Positives = 217/305 (71%), Gaps = 7/305 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNS-----SENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           HF D+   S ++L  +I+ A+ +K +        + +++PL+G ++A+IFEKPSTRTRVS
Sbjct: 3   HFLDIHTTSPADLRSMIDSARAMKTARLGRPKGALDDDQPLAGCMVALIFEKPSTRTRVS 62

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG T+ LSG EMQLG  ETI DTA+VLSRYVD I++RT   + LLE+ EYA+
Sbjct: 63  FDVGVRQMGGQTMVLSGKEMQLGHGETIADTARVLSRYVDLIMIRTFEEATLLEMAEYAS 122

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LT+ THPCQI+ADIMT+EEHRG + G+   WSGDGNN+  S ++ A +F + L 
Sbjct: 123 VPVINGLTNRTHPCQIMADIMTYEEHRGPIAGRKVVWSGDGNNVCASFLQAAGQFGFDLT 182

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKAREEH 239
              P   +P  +++ +AR++G +V +  D  +AV+GA  V TDTW+SM+  +  K R  +
Sbjct: 183 FTGPQALDPERDWIEFARSKGVNVVIERDPAKAVEGADLVVTDTWVSMHDPESAKERRHN 242

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             +P+QVN +LM+ A PDALFMHCLPAHR +E  + V+DGP SV+FDEAENRLH QKAI+
Sbjct: 243 QLRPYQVNETLMAKAKPDALFMHCLPAHRNDEATSAVMDGPHSVIFDEAENRLHAQKAIM 302

Query: 300 LWCFG 304
            W  G
Sbjct: 303 RWALG 307


>gi|126461490|ref|YP_001042604.1| ornithine carbamoyltransferase [Rhodobacter sphaeroides ATCC 17029]
 gi|332557441|ref|ZP_08411763.1| ornithine carbamoyltransferase [Rhodobacter sphaeroides WS8N]
 gi|254772731|sp|A3PHL6|OTC_RHOS1 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|126103154|gb|ABN75832.1| ornithine carbamoyltransferase [Rhodobacter sphaeroides ATCC 17029]
 gi|332275153|gb|EGJ20468.1| ornithine carbamoyltransferase [Rhodobacter sphaeroides WS8N]
          Length = 308

 Score =  339 bits (870), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 155/306 (50%), Positives = 215/306 (70%), Gaps = 7/306 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSE-----NIFENKPLSGKVLAMIFEKPSTRTRVS 61
           HF D+    ++ L  +++ A  +K + +      + E++PL+G+++A+IFEKPSTRTRVS
Sbjct: 3   HFLDIHKTDTAELRQMMDSAHAMKAARKGRPKGQLDEDQPLAGRMVALIFEKPSTRTRVS 62

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG T+ LSG EMQLG  ETI DTA+VLSRYVD I++RT   + LLE+ E+AT
Sbjct: 63  FDVGVRQMGGQTMVLSGKEMQLGHGETIADTARVLSRYVDLIMIRTFEEATLLEMAEHAT 122

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LT+ THPCQI+AD+MT+EEHRG + G+   W+GDGNN+  S +  A +F +   
Sbjct: 123 VPVINGLTNRTHPCQIMADVMTYEEHRGPIAGRKVVWAGDGNNVCASFLHAAGQFGFDFT 182

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE--H 239
              P   +P  E++ +AR +G  V++  D  +AV GA  V TDTW+SM+    ARE   +
Sbjct: 183 FTGPSTLDPEAEFVGYAREKGRRVSIERDPAKAVAGADLVVTDTWVSMHDPQSARERRHN 242

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             +P+QVN +LM+ A PDALFMHCLPAHR +E  + V+DGP SV+FDEAENRLH QKAI+
Sbjct: 243 QLRPYQVNEALMAQAKPDALFMHCLPAHRDDEATSAVMDGPHSVIFDEAENRLHAQKAIM 302

Query: 300 LWCFGI 305
            WC G+
Sbjct: 303 RWCLGL 308


>gi|146279136|ref|YP_001169295.1| ornithine carbamoyltransferase [Rhodobacter sphaeroides ATCC 17025]
 gi|145557377|gb|ABP71990.1| ornithine carbamoyltransferase [Rhodobacter sphaeroides ATCC 17025]
          Length = 328

 Score =  339 bits (870), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 155/305 (50%), Positives = 215/305 (70%), Gaps = 7/305 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSE-----NIFENKPLSGKVLAMIFEKPSTRTRVS 61
           HF D+    +  L  +++ A  +K + +      + +++PL+G+++A+IFEKPSTRTRVS
Sbjct: 23  HFLDIHKTDTDALRQMMDSAHAMKAARQGRPKGQLDDDQPLAGRMVALIFEKPSTRTRVS 82

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG T+ LSG EMQLG  ETI DTA+VLSRYVD I++RT   + LLE+ E+AT
Sbjct: 83  FDVGVRQMGGQTMVLSGKEMQLGHGETIADTARVLSRYVDLIMIRTFEEATLLEMAEHAT 142

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LT+ THPCQI+AD+MT+EEHRGS+ G+   W+GDGNN+  S +  A +F +   
Sbjct: 143 VPVINGLTNRTHPCQIMADVMTYEEHRGSISGRKVVWAGDGNNVCASFLHAAGQFGFDFT 202

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE--H 239
              P   +P  E++ +AR +G  V++  D  +AV+GA  V TDTW+SM+    ARE   +
Sbjct: 203 FTGPPTLDPEAEFVGYAREKGRRVSIERDPARAVEGADLVVTDTWVSMHDPQSARERRHN 262

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             +P+QVN +LM+ A PDALFMHCLPAHR +E  + V+DGP SV+FDEAENRLH QKAI+
Sbjct: 263 QLRPYQVNEALMAKARPDALFMHCLPAHRDDEATSAVMDGPHSVIFDEAENRLHAQKAIM 322

Query: 300 LWCFG 304
            WC G
Sbjct: 323 RWCLG 327


>gi|77462556|ref|YP_352060.1| ornithine carbamoyltransferase [Rhodobacter sphaeroides 2.4.1]
 gi|123592692|sp|Q3J4X5|OTC_RHOS4 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|77386974|gb|ABA78159.1| ornithine carbamoyltransferase [Rhodobacter sphaeroides 2.4.1]
          Length = 308

 Score =  339 bits (870), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 155/306 (50%), Positives = 215/306 (70%), Gaps = 7/306 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSE-----NIFENKPLSGKVLAMIFEKPSTRTRVS 61
           HF D+    ++ L  +++ A  +K + +      + E++PL+G+++A+IFEKPSTRTRVS
Sbjct: 3   HFLDIHKTDTAELRQMMDSAHAMKAARKGRPKGQLDEDQPLAGRMVALIFEKPSTRTRVS 62

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG T+ LSG EMQLG  ETI DTA+VLSRYVD I++RT   + LLE+ E+AT
Sbjct: 63  FDVGVRQMGGQTMVLSGKEMQLGHGETIADTARVLSRYVDLIMIRTFEEATLLEMAEHAT 122

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LT+ THPCQI+AD+MT+EEHRG + G+   W+GDGNN+  S +  A +F +   
Sbjct: 123 VPVINGLTNRTHPCQIMADVMTYEEHRGPIAGRKVVWAGDGNNVCASFLHAAGQFGFDFT 182

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE--H 239
              P   +P  E++ +AR +G  V++  D  +AV GA  V TDTW+SM+    ARE   +
Sbjct: 183 FTGPSTLDPEAEFVGYAREKGRRVSIERDPAKAVAGADLVVTDTWVSMHDPQSARERRHN 242

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             +P+QVN +LM+ A PDALFMHCLPAHR +E  + V+DGP SV+FDEAENRLH QKAI+
Sbjct: 243 QLRPYQVNETLMAQAKPDALFMHCLPAHRDDEATSAVMDGPHSVIFDEAENRLHAQKAIM 302

Query: 300 LWCFGI 305
            WC G+
Sbjct: 303 RWCLGL 308


>gi|163734103|ref|ZP_02141544.1| ornithine carbamoyltransferase [Roseobacter litoralis Och 149]
 gi|161392639|gb|EDQ16967.1| ornithine carbamoyltransferase [Roseobacter litoralis Och 149]
          Length = 308

 Score =  338 bits (868), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 160/306 (52%), Positives = 216/306 (70%), Gaps = 7/306 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSEN-----IFENKPLSGKVLAMIFEKPSTRTRVS 61
           HF D+     ++L  II+ A  +KN+          + +PL   ++A+IFEKPSTRTRVS
Sbjct: 3   HFLDIHLTDPADLRGIIDQAATMKNARLGRPRGAPDDTQPLKDHMVALIFEKPSTRTRVS 62

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG T+ LSGS+MQLG  ETI DTA+VLSRYVD I++RT + + L E+ E+AT
Sbjct: 63  FDVGVRQMGGQTMVLSGSDMQLGHGETIADTARVLSRYVDLIMIRTFDEAVLTEMAEFAT 122

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD THPCQI+ADI+TFEEHRG + GK   WSGDGNN+  S +  A +F + L 
Sbjct: 123 VPVINGLTDRTHPCQIMADILTFEEHRGPIAGKKVVWSGDGNNVCSSFLHAAGQFGFDLT 182

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE--H 239
              P   +P  E+++ AR++G +VA+  D  +AV+GA  V TDTW+SM+    ARE   +
Sbjct: 183 FTGPPTLDPEPEFIDLARSKGVNVAVERDPAKAVEGADLVVTDTWVSMHDAQSARERRHN 242

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             +P++V+ +LMS A P+ALFMHCLPAHR +E  +EV+DGPQSV+FDEAENRLH QKAI+
Sbjct: 243 QLRPYRVDAALMSHAKPEALFMHCLPAHRDDEATSEVMDGPQSVIFDEAENRLHAQKAIM 302

Query: 300 LWCFGI 305
            WC  +
Sbjct: 303 RWCLAV 308


>gi|300021558|ref|YP_003754169.1| ornithine carbamoyltransferase [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299523379|gb|ADJ21848.1| ornithine carbamoyltransferase [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 318

 Score =  338 bits (867), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 155/303 (51%), Positives = 207/303 (68%), Gaps = 3/303 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENI---FENKPLSGKVLAMIFEKPSTRTRVS 61
           P+HF D++++ S  L  II+ A  +K + + +      K +   VL +IFEKPSTRTRVS
Sbjct: 15  PRHFLDIADLDSKTLRKIIDNAHAMKRAGKRVPAELRPKGIEDDVLVLIFEKPSTRTRVS 74

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+VAM+ LGG  + L+  ++QLGR E++ DTA+VLSRY D I++R   H+ L EL  +AT
Sbjct: 75  FDVAMRQLGGQALTLNHDDLQLGRGESVADTARVLSRYADGIMIRANAHATLAELARHAT 134

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           +PVIN LT+ +HPCQI+ADI TFEEH G +KG+  +W GDGNN+  S +  A RF + L 
Sbjct: 135 IPVINGLTEKSHPCQIMADIQTFEEHLGPIKGRTVAWVGDGNNVAVSWMHAAVRFGFKLR 194

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +A P    P  E L+W + +  +V +  D  +AVKGA CV TDTW+SM Q   A+ + + 
Sbjct: 195 LACPKSLYPEAEALDWVQREKGNVEIGTDPSEAVKGADCVVTDTWVSMGQSGAAKRKKIL 254

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
            P+ V+  LMS A   A+FMHCLPA+RG EV  EVL+GPQSV+FDEAENRLH QKAIL W
Sbjct: 255 APYAVDAKLMSKASKSAIFMHCLPAYRGHEVSEEVLEGPQSVIFDEAENRLHAQKAILAW 314

Query: 302 CFG 304
           CFG
Sbjct: 315 CFG 317


>gi|221638411|ref|YP_002524673.1| ornithine carbamoyltransferase [Rhodobacter sphaeroides KD131]
 gi|254772732|sp|B9KMW0|OTC_RHOSK RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|221159192|gb|ACM00172.1| Ornithine carbamoyltransferase [Rhodobacter sphaeroides KD131]
          Length = 308

 Score =  338 bits (867), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 155/306 (50%), Positives = 214/306 (69%), Gaps = 7/306 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSE-----NIFENKPLSGKVLAMIFEKPSTRTRVS 61
           HF D+    ++ L  +++ A  +K + +        E++PL+G+++A+IFEKPSTRTRVS
Sbjct: 3   HFLDIHKTDTAELRQMMDSAHAMKAARKGRPKGQFDEDQPLAGRMVALIFEKPSTRTRVS 62

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG T+ LSG EMQLG  ETI DTA+VLSRYVD I++RT   + LLE+ E+AT
Sbjct: 63  FDVGVRQMGGQTMVLSGKEMQLGHGETIADTARVLSRYVDLIMIRTFEEATLLEMAEHAT 122

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LT+ THPCQI+AD+MT+EEHRG + G+   W+GDGNN+  S +  A +F +   
Sbjct: 123 VPVINGLTNRTHPCQIMADVMTYEEHRGPIAGRKVVWAGDGNNVCASFLHAAGQFGFDFT 182

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE--H 239
              P   +P  E++ +AR +G  V++  D  +AV GA  V TDTW+SM+    ARE   +
Sbjct: 183 FTGPPTLDPEAEFVGYAREKGRRVSIERDPAKAVAGADLVVTDTWVSMHDPQSARERRHN 242

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             +P+QVN +LM+ A PDALFMHCLPAHR +E  + V+DGP SV+FDEAENRLH QKAI+
Sbjct: 243 QLRPYQVNEALMAQAKPDALFMHCLPAHRDDEATSAVMDGPHSVIFDEAENRLHAQKAIM 302

Query: 300 LWCFGI 305
            WC G+
Sbjct: 303 RWCLGL 308


>gi|163744067|ref|ZP_02151434.1| ornithine carbamoyltransferase [Phaeobacter gallaeciensis 2.10]
 gi|161382683|gb|EDQ07085.1| ornithine carbamoyltransferase [Phaeobacter gallaeciensis 2.10]
          Length = 335

 Score =  338 bits (867), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 159/305 (52%), Positives = 213/305 (69%), Gaps = 7/305 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNS-----SENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           HF D+    +++L  II+ A   K +          +  PL  +++A+IFEKPSTRTRVS
Sbjct: 30  HFLDIHKTDATDLRAIIDQASATKQARLGRPKAAPDDELPLKDRMVALIFEKPSTRTRVS 89

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG T+ LSG++MQLG  ETI DTA+VLSRYVD I++RT + + L E+ EYA+
Sbjct: 90  FDVGVRQMGGQTMVLSGNDMQLGHGETIADTARVLSRYVDMIMIRTFDETVLTEMAEYAS 149

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD THPCQI+AD++T+EEHRG +KGK   W GDGNN+  S +  AA+F + L 
Sbjct: 150 VPVINGLTDRTHPCQIMADVLTYEEHRGPIKGKKVVWCGDGNNVCASFLHAAAQFGFDLT 209

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM--NQEFKAREEH 239
              P   +P  E++  ARN G+ V +  DA +AV+GA  V  DTW+SM  +Q  K R  +
Sbjct: 210 FTGPAQLDPEPEFIGLARNAGSQVIIERDAAKAVEGADLVVADTWVSMHDSQSSKERRHN 269

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + + +QVN +LM+ A PDALFMHCLPAHR EEV + V+DGPQSV+FDEAENRLH QKAI+
Sbjct: 270 MLRGYQVNDALMAHAKPDALFMHCLPAHREEEVTSAVMDGPQSVIFDEAENRLHAQKAIM 329

Query: 300 LWCFG 304
            +C G
Sbjct: 330 RYCLG 334


>gi|163737716|ref|ZP_02145133.1| ornithine carbamoyltransferase [Phaeobacter gallaeciensis BS107]
 gi|161389242|gb|EDQ13594.1| ornithine carbamoyltransferase [Phaeobacter gallaeciensis BS107]
          Length = 308

 Score =  337 bits (865), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 159/305 (52%), Positives = 213/305 (69%), Gaps = 7/305 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNS-----SENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           HF D+    +++L  II+ A   K +          +  PL  +++A+IFEKPSTRTRVS
Sbjct: 3   HFLDIHKTDATDLRAIIDQASATKQARLGRPKAAPDDELPLKDRMVALIFEKPSTRTRVS 62

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG T+ LSG++MQLG  ETI DTA+VLSRYVD I++RT + + L E+ EYA+
Sbjct: 63  FDVGVRQMGGQTMVLSGNDMQLGHGETIADTARVLSRYVDMIMIRTFDETVLTEMAEYAS 122

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD THPCQI+AD++T+EEHRG +KGK   W GDGNN+  S +  AA+F + L 
Sbjct: 123 VPVINGLTDRTHPCQIMADVLTYEEHRGPIKGKKVVWCGDGNNVCASFLHAAAQFGFDLT 182

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM--NQEFKAREEH 239
              P   +P  E++  ARN G+ V +  DA +AV+GA  V  DTW+SM  +Q  K R  +
Sbjct: 183 FTGPAQLDPEPEFIGLARNAGSQVIIERDAAKAVEGADLVVADTWVSMHDSQSSKERRHN 242

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + + +QVN +LM+ A PDALFMHCLPAHR EEV + V+DGPQSV+FDEAENRLH QKAI+
Sbjct: 243 MLRGYQVNDALMAHAKPDALFMHCLPAHREEEVTSAVMDGPQSVIFDEAENRLHAQKAIM 302

Query: 300 LWCFG 304
            +C G
Sbjct: 303 RYCLG 307


>gi|110678980|ref|YP_681987.1| ornithine carbamoyltransferase [Roseobacter denitrificans OCh 114]
 gi|122972889|sp|Q169P2|OTC_ROSDO RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|109455096|gb|ABG31301.1| ornithine carbamoyltransferase [Roseobacter denitrificans OCh 114]
          Length = 308

 Score =  337 bits (864), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 158/306 (51%), Positives = 217/306 (70%), Gaps = 7/306 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSEN-----IFENKPLSGKVLAMIFEKPSTRTRVS 61
           HF D+     ++L  II+ A  +K++ +        + +PL  +++A+IFEKPSTRTRVS
Sbjct: 3   HFLDIHLTDPADLREIIDQAAIMKSARKGRPRGAPDDTQPLKDRIVALIFEKPSTRTRVS 62

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG T+ LSG++MQLG  ETI DTA+VLSRYVD I++RT + + L E+ E+AT
Sbjct: 63  FDVGVRQMGGQTMVLSGADMQLGHGETIADTARVLSRYVDLIMIRTFDEAVLTEMAEFAT 122

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD THPCQI+ADI+TFEEHRG + GK   WSGDGNN+  S +  A +F + L 
Sbjct: 123 VPVINGLTDRTHPCQIMADILTFEEHRGPIAGKKVVWSGDGNNVCASFLHAAGQFGFDLT 182

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE--H 239
              P   +P  E++  AR++G +VA+  D  +AV+GA  V TDTW+SM+    ARE   +
Sbjct: 183 FTGPQTLDPDAEFVELARSKGVNVAVERDPAKAVEGADLVVTDTWVSMHDAQSARERRHN 242

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             +P++V+ +LMS A P+ALFMHCLPAHR +E  +EV+DGPQSV+FDEAENRLH QKAI+
Sbjct: 243 QLRPYRVDAALMSRAKPEALFMHCLPAHRDDEATSEVMDGPQSVIFDEAENRLHAQKAIM 302

Query: 300 LWCFGI 305
            WC  +
Sbjct: 303 RWCLAV 308


>gi|319405017|emb|CBI78627.1| Ornithine carbamoyltransferase [Bartonella sp. AR 15-3]
          Length = 300

 Score =  337 bits (863), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 159/299 (53%), Positives = 214/299 (71%), Gaps = 1/299 (0%)

Query: 2   MTYP-KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           MTY  +H  DLS ++      +I+  K +K + +     KP + K LAMIFEKPSTRTRV
Sbjct: 1   MTYTLRHSTDLSILTLQRACALIDYTKILKTAFKAEENLKPFADKTLAMIFEKPSTRTRV 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF++ M  L G+T+ L+ SEM+LG +E I + A+ LSR+++ I++RTT H R+LEL +Y 
Sbjct: 61  SFDLVMHQLSGETMMLTRSEMELGNSEIIANIARALSRFLEIIIIRTTAHHRILELVQYV 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
            +PVINALTD+THPCQI+ DI+T+EEHRG + GK F+W  D NN+LHSLIE    FN+ L
Sbjct: 121 QIPVINALTDDTHPCQILTDILTYEEHRGIIAGKTFAWMRDDNNVLHSLIEATTLFNFYL 180

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
           +IATP GS+ + +Y+NWA  QG    L  +  +  +   C+  DTW+S+ QEF+AR   +
Sbjct: 181 HIATPQGSKIQEKYVNWACEQGPHSMLTQNPQKTAENTDCIINDTWVSVGQEFRARSYPI 240

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           FQP QVN +LM+ A PD+LFMH LPAHRGEEV++ V++G  SVVFDEAENRL+TQKAIL
Sbjct: 241 FQPDQVNEALMARAKPDSLFMHYLPAHRGEEVLDNVINGLYSVVFDEAENRLYTQKAIL 299


>gi|254510326|ref|ZP_05122393.1| ornithine carbamoyltransferase [Rhodobacteraceae bacterium KLH11]
 gi|221534037|gb|EEE37025.1| ornithine carbamoyltransferase [Rhodobacteraceae bacterium KLH11]
          Length = 308

 Score =  337 bits (863), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 154/306 (50%), Positives = 211/306 (68%), Gaps = 7/306 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNS-----SENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           HF D+    ++ L  +I+ A  +K +          +++PL   ++A+IFEKPSTRTRVS
Sbjct: 3   HFLDIHKTDAAALRGMIDQAGAMKQARLGRPKAAPDDDQPLKDHMVALIFEKPSTRTRVS 62

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG T+ LSG +MQLG  ETI DTA+VLSRYVD I++RT + + L E+ EY+ 
Sbjct: 63  FDVGVRQMGGQTMVLSGKDMQLGHGETIADTARVLSRYVDMIMIRTFDETILTEMAEYSD 122

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD THPCQI+AD++T+EEHRG +KGK   W+GDGNN+  S +  A +F + L 
Sbjct: 123 VPVINGLTDRTHPCQIMADVLTYEEHRGPIKGKKVVWTGDGNNVCASFLHAAGQFGFDLT 182

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM--NQEFKAREEH 239
              P   +P  E++  AR +G+ + +  D  +AV+GA  V  DTW+SM  +Q  K R  +
Sbjct: 183 FTGPAQLDPEEEFMGLARQKGSKITIERDPFKAVEGADLVVADTWVSMHDSQSAKERRHN 242

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + +P+QVN  LMS A PDALFMHCLPAHR EE  +EV+DGP SV+FDEAENRLH QKA++
Sbjct: 243 MLRPYQVNADLMSHAKPDALFMHCLPAHREEEATSEVMDGPNSVIFDEAENRLHAQKAVM 302

Query: 300 LWCFGI 305
            WC G+
Sbjct: 303 RWCLGV 308


>gi|149913426|ref|ZP_01901959.1| ornithine carbamoyltransferase [Roseobacter sp. AzwK-3b]
 gi|149812546|gb|EDM72375.1| ornithine carbamoyltransferase [Roseobacter sp. AzwK-3b]
          Length = 308

 Score =  336 bits (862), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 156/305 (51%), Positives = 217/305 (71%), Gaps = 7/305 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSEN-----IFENKPLSGKVLAMIFEKPSTRTRV 60
           ++F D+       L  II+ AK +K++ ++       +  PL+G ++A+IFEKPSTRTR 
Sbjct: 2   ENFLDIHKTDPEALRHIIDSAKAMKDARKDRPRGATDDELPLAGHMVALIFEKPSTRTRT 61

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF+V ++ +GG T+ LSG++MQLG  ETI DTA+VLSRYVD I++RT + S LLE+ +YA
Sbjct: 62  SFDVGVRQMGGQTMVLSGTDMQLGHGETIADTARVLSRYVDLIMIRTFDESVLLEMADYA 121

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
            VPVIN LT+ THPCQI+ADIMT+EEHRG + G+   WSGDGNN+  SL+  A +F + +
Sbjct: 122 DVPVINGLTNRTHPCQIMADIMTYEEHRGPIAGRKVVWSGDGNNVCASLLHAAGQFGFDV 181

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM--NQEFKAREE 238
               P   +P + ++ +AR +G+++ +  D V+AV GA  V TDTW+SM  +Q  K R  
Sbjct: 182 TFTGPAQLDPEDAFVGFARQKGSTIQIERDPVKAVSGADLVVTDTWVSMHDSQSTKERRH 241

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
           ++ +P+QVN  LM+ A PDALFMHCLPAHR EEV ++V+DGP SV++DEAENRLH QKAI
Sbjct: 242 NMLRPYQVNEELMAHAKPDALFMHCLPAHREEEVTSQVMDGPHSVIWDEAENRLHAQKAI 301

Query: 299 LLWCF 303
           + WC 
Sbjct: 302 MRWCL 306


>gi|260575313|ref|ZP_05843313.1| ornithine carbamoyltransferase [Rhodobacter sp. SW2]
 gi|259022573|gb|EEW25869.1| ornithine carbamoyltransferase [Rhodobacter sp. SW2]
          Length = 308

 Score =  336 bits (861), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 157/307 (51%), Positives = 214/307 (69%), Gaps = 7/307 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSEN-----IFENKPLSGKVLAMIFEKPSTRTRV 60
           KHF D+   ++++L  +I  A+ +K +          +++PL+G+++A+IFEKPSTRTRV
Sbjct: 2   KHFLDIHTTAAADLRLMINSAQAMKTARNGRPKGTPDDDQPLAGRMVALIFEKPSTRTRV 61

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF+V ++ +GG T+ LSG EMQLG  ETI DTA+VLSRYVD I++RT   + LLE+ E+A
Sbjct: 62  SFDVGVRQMGGQTMVLSGKEMQLGHGETIADTARVLSRYVDLIMIRTFEEATLLEMAEHA 121

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVIN LT+ THPCQI+AD+MT+EEHRG + GK   W+GDGNN+  S +  A +F +  
Sbjct: 122 TVPVINGLTNRTHPCQIMADVMTYEEHRGPIAGKKVVWAGDGNNVCASFLHAAGQFGFDF 181

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKAREE 238
               P   +P    L +AR  G+ VA+  D   AV+GA  V TDTW+SM+  +  K R  
Sbjct: 182 TFTGPEPLDPEAPALGFARQMGSRVAIERDPALAVQGADLVVTDTWVSMHDPESAKERRH 241

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
           +  + +QVN +LM+ A PDALFMHCLPAHR +EV + V+DGP SVVFDEAENRLH QKA+
Sbjct: 242 NQLRGYQVNDALMAKAKPDALFMHCLPAHRNDEVTSAVMDGPHSVVFDEAENRLHAQKAV 301

Query: 299 LLWCFGI 305
           + WC G+
Sbjct: 302 MRWCLGV 308


>gi|294085450|ref|YP_003552210.1| ornithine carbamoyltransferase [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292665025|gb|ADE40126.1| ornithine carbamoyltransferase [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 302

 Score =  336 bits (861), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 163/300 (54%), Positives = 207/300 (69%), Gaps = 2/300 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIK-NSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           +HF D+ + ++  LS I+E A  +K +        KPL+GK +AMIFEKPSTRTRVSFEV
Sbjct: 2   RHFLDIRDFNADTLSAILEQAASLKADRKAGSASAKPLAGKSVAMIFEKPSTRTRVSFEV 61

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG  + LS S++Q+GR E++ DTAKVLSRYVDAI++R   H  L+ L E+ATVPV
Sbjct: 62  GITELGGTPLILSASDLQVGRGESVADTAKVLSRYVDAIMIRCFKHDMLMTLAEHATVPV 121

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALT+ +HPCQI+AD+ T  E  G + G+  +W GDGNN+  S IE AA F + LNIA 
Sbjct: 122 INALTEWSHPCQIMADLQTMIERHGPLAGQSVAWLGDGNNVATSWIEAAAVFGFKLNIAC 181

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P G  P ++ L WAR QGA + L  DA++A K    + TD WISM  +   R E  F P+
Sbjct: 182 PDGYAPSSKLLAWARAQGADITLTDDAMEAAKDVQTIVTDVWISMGDDEGTRAED-FAPY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QVN ++M+ A  DA+FMHCLPA RG EV  +V+DG QSVVFDEAENRLH QKAIL WC G
Sbjct: 241 QVNATIMAAAAGDAIFMHCLPAIRGMEVTADVIDGHQSVVFDEAENRLHAQKAILAWCVG 300


>gi|159043348|ref|YP_001532142.1| ornithine carbamoyltransferase [Dinoroseobacter shibae DFL 12]
 gi|157911108|gb|ABV92541.1| ornithine carbamoyltransferase [Dinoroseobacter shibae DFL 12]
          Length = 308

 Score =  335 bits (859), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 152/306 (49%), Positives = 213/306 (69%), Gaps = 7/306 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSEN-----IFENKPLSGKVLAMIFEKPSTRTRVS 61
           HF D+     ++L  +++  + +K +          +++PL+G ++A+IFEKPSTRTRVS
Sbjct: 3   HFLDIHTTDPADLRAMLDRGRAMKTARAGRPKGASDDDQPLAGHMVALIFEKPSTRTRVS 62

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F++ ++ +GG T+ LSG++MQLG  ETI DTA+VLSRYVD I++RT   + LLE+ E+A+
Sbjct: 63  FDLGVRQMGGQTMVLSGADMQLGHGETIADTARVLSRYVDLIMIRTFEETTLLEMAEHAS 122

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LT+ THPCQI+AD+MT+EEHRG + GK   W GDGNN+  S +  A +F + + 
Sbjct: 123 VPVINGLTNRTHPCQIMADVMTYEEHRGPIAGKKVVWCGDGNNVCASFLHAAGQFGFDMT 182

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM--NQEFKAREEH 239
              P   +P  E++  AR +G +V +  D   AV+GA  V  DTW+SM  +Q  K R  +
Sbjct: 183 FTGPPTLDPEAEFVAGARAKGVTVEIERDPAVAVQGADLVVADTWVSMHDSQTTKERRHN 242

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             +P+QV+ +LM  A PDALFMHCLPAHRGEEV +EV+DGP SV+FDEAENRLH QKA++
Sbjct: 243 QLRPYQVDRALMEKAKPDALFMHCLPAHRGEEVTSEVMDGPHSVIFDEAENRLHAQKAVM 302

Query: 300 LWCFGI 305
            WC G+
Sbjct: 303 RWCLGV 308


>gi|84685278|ref|ZP_01013176.1| ornithine carbamoyltransferase [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84666435|gb|EAQ12907.1| ornithine carbamoyltransferase [Rhodobacterales bacterium HTCC2654]
          Length = 308

 Score =  335 bits (858), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 161/307 (52%), Positives = 213/307 (69%), Gaps = 7/307 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKP-----LSGKVLAMIFEKPSTRTRV 60
           +HF D++    ++L  +++ A +IK    +  +  P     L+GKV+A+IFEKPSTRTRV
Sbjct: 2   RHFLDINATDPADLRTMLDEAHRIKAGRGDAAKGVPDDEQALAGKVVALIFEKPSTRTRV 61

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF+V ++ +GG+T+ LSGSEMQLG  E+I DTA+VLSRYVD I++RT   S L EL E+A
Sbjct: 62  SFDVGVRQMGGETLVLSGSEMQLGHGESIPDTARVLSRYVDLIMIRTFEESALQELAEFA 121

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVIN LT+ THPCQI+ADI+T+EEHRG + GK   W+GDGNN+  S I  A +  + L
Sbjct: 122 TVPVINGLTNRTHPCQIMADILTYEEHRGPIAGKKVVWTGDGNNVCASFIHAAGQLGFDL 181

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-- 238
               P    P  E++  AR +G  + +  D   AVKGA  V TDTW+SM+     RE   
Sbjct: 182 TYTGPERLGPDREFVEEARAKGVKIEIERDPHAAVKGADLVVTDTWVSMHDAPSTRERRH 241

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
           ++ + +QV+  LM+ A+PDALFMHCLPAHR EEV + V+DGPQSVVFDEAENRLH QKAI
Sbjct: 242 NLLRAYQVDDRLMAGANPDALFMHCLPAHRNEEVTDAVMDGPQSVVFDEAENRLHAQKAI 301

Query: 299 LLWCFGI 305
           + WC G+
Sbjct: 302 MRWCLGV 308


>gi|126739950|ref|ZP_01755640.1| ornithine carbamoyltransferase [Roseobacter sp. SK209-2-6]
 gi|126718769|gb|EBA15481.1| ornithine carbamoyltransferase [Roseobacter sp. SK209-2-6]
          Length = 308

 Score =  335 bits (858), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 155/305 (50%), Positives = 209/305 (68%), Gaps = 7/305 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNS-----SENIFENKPLSGKVLAMIFEKPSTRTRV 60
           KHF D+     ++L  II+ A   K +        + +  PL  +++A+IFEKPSTRTRV
Sbjct: 2   KHFLDIHKTDPADLRAIIDQASATKQARLGRPKAALDDELPLKDRMVALIFEKPSTRTRV 61

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF+V ++ +GG T+ LSG +MQLG  ETI DTA+VLSRYVD I++RT + + L E+ EYA
Sbjct: 62  SFDVGVRQMGGQTMVLSGKDMQLGHGETIADTARVLSRYVDMIMIRTFDETVLTEMAEYA 121

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
            VPVIN LTD THPCQI+AD++T+EEHRG +KGK   W+GDGNN+  S +  A +F + L
Sbjct: 122 DVPVINGLTDRTHPCQIMADVLTYEEHRGPIKGKKVVWAGDGNNVCASFLHAAGQFGFDL 181

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM--NQEFKAREE 238
               P   +P  E++  AR  G+ +++  DA +AV+GA  +  DTW+SM  +Q  K R  
Sbjct: 182 TFTGPAQLDPEEEFIGLARKAGSKISIERDAFKAVEGADLIVADTWVSMHDSQSSKERRH 241

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
           ++ +P+QVN  LMS A  DALFMHCLPAHR EEV + V+DG QSV+FDEAENRLH QKA+
Sbjct: 242 NMLRPYQVNDELMSHAKSDALFMHCLPAHREEEVTSSVMDGAQSVIFDEAENRLHAQKAV 301

Query: 299 LLWCF 303
           + WC 
Sbjct: 302 MRWCL 306


>gi|83952797|ref|ZP_00961527.1| ornithine carbamoyltransferase [Roseovarius nubinhibens ISM]
 gi|83835932|gb|EAP75231.1| ornithine carbamoyltransferase [Roseovarius nubinhibens ISM]
          Length = 308

 Score =  335 bits (858), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 157/305 (51%), Positives = 213/305 (69%), Gaps = 7/305 (2%)

Query: 8   FADLSNISSSNLSCIIEVAKKIKNSSENIF-----ENKPLSGKVLAMIFEKPSTRTRVSF 62
           F D+    +  L  I++ A ++K +          +++PL+  ++A+IFEKPSTRTRVSF
Sbjct: 4   FLDIHKTDAGALRDILDQASQMKQARLGRKRGAPDDDQPLANHMVALIFEKPSTRTRVSF 63

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           +  ++ +GG T+ LSG+E+QLG  ETI DTA+VLSRYVD I++RT + S LLEL E++ V
Sbjct: 64  DAGVRQMGGQTMLLSGAELQLGHGETIADTARVLSRYVDLIMIRTFDESVLLELAEHSQV 123

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVIN LTD THPCQI+ADI+T+EEHRG +KGK   WSGDGNN+  S +  A +F +    
Sbjct: 124 PVINGLTDRTHPCQIMADILTYEEHRGPIKGKKVVWSGDGNNVCASFLHAAGKFGFDFTY 183

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM--NQEFKAREEHV 240
             P   +P  E++  AR  G  V +  DA +AV+GA  V TDTW+SM  +Q  K R  ++
Sbjct: 184 TGPQQLDPEEEFIGEARRAGVQVTIERDAAKAVEGADLVVTDTWVSMHDSQSTKERRHNL 243

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
            + +QVN +LMS A PDALFMHCLPAHR EEV ++V+DGPQSV++DEAENRLH QKA++ 
Sbjct: 244 LRSYQVNDALMSHAKPDALFMHCLPAHREEEVTSKVMDGPQSVIWDEAENRLHAQKAVMR 303

Query: 301 WCFGI 305
           WC G+
Sbjct: 304 WCLGV 308


>gi|310816622|ref|YP_003964586.1| ornithine carbamoyltransferase [Ketogulonicigenium vulgare Y25]
 gi|308755357|gb|ADO43286.1| ornithine carbamoyltransferase [Ketogulonicigenium vulgare Y25]
          Length = 308

 Score =  333 bits (855), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 155/307 (50%), Positives = 216/307 (70%), Gaps = 7/307 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFE-----NKPLSGKVLAMIFEKPSTRTRV 60
           +HF D++   +  L  +I+ A  +K +   + +     ++PL+ +++A+IFEKPSTRTRV
Sbjct: 2   QHFLDINTTPADQLRGMIDKALAMKQARAGLPKGAGDADQPLADRMVALIFEKPSTRTRV 61

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF+V ++ +GG T+ LSG++MQLG  ETI DTA+VLSRYVD I++RT   + LLE+ EYA
Sbjct: 62  SFDVGVRQMGGQTMVLSGADMQLGHGETIADTARVLSRYVDMIMIRTFEEATLLEMAEYA 121

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVIN LT+ THPCQI+ADI+T+EEHRG + GK   WSGDGNN+ HS +  A +FN+ L
Sbjct: 122 TVPVINGLTNRTHPCQIMADILTYEEHRGPITGKKVVWSGDGNNVFHSFVHAAQKFNFDL 181

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-- 238
               P   +P    +  AR  GA++ +  D ++AV+GA  V TDTW+SM+    A+E   
Sbjct: 182 TFTGPQPLDPEAGIVAEARAAGANIVIERDPMKAVEGADLVVTDTWVSMHDPASAKERRH 241

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
           +  + +QVN +LM+ A  DALFMHCLPAHR +EV + V+DGP SV+FDEAENRLH QKA+
Sbjct: 242 NQLRGYQVNDTLMARAKSDALFMHCLPAHREDEVTSSVMDGPHSVIFDEAENRLHAQKAV 301

Query: 299 LLWCFGI 305
           + WC G+
Sbjct: 302 MRWCLGV 308


>gi|84499549|ref|ZP_00997837.1| ornithine carbamoyltransferase [Oceanicola batsensis HTCC2597]
 gi|84392693|gb|EAQ04904.1| ornithine carbamoyltransferase [Oceanicola batsensis HTCC2597]
          Length = 308

 Score =  332 bits (852), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 154/306 (50%), Positives = 212/306 (69%), Gaps = 7/306 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIF-----ENKPLSGKVLAMIFEKPSTRTRVS 61
           HF D+     + L  +I+ A+ +K +          + +PL+G+++A+IFEKPSTRTRVS
Sbjct: 3   HFLDIHTTERAALRQMIDQARSMKEARAGRSRGAPDDEQPLAGRMVALIFEKPSTRTRVS 62

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG T+ LSG +MQLG  ETI DTA+VLSRYVD I++RT + + L E+ +YA+
Sbjct: 63  FDVGVRQMGGQTMVLSGQDMQLGHGETIADTARVLSRYVDLIMLRTFDEAVLQEMADYAS 122

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD THPCQI+AD+MT+EEHRGS+ GK  +W GDGNN+  S +  A +F + L 
Sbjct: 123 VPVINGLTDRTHPCQIMADVMTYEEHRGSIAGKNVTWLGDGNNVFASFLHAATQFGFNLT 182

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKAREEH 239
              P   +P  E+L+ AR  G +V +  D  + V GA  V  DTW+SM+  Q  + R  +
Sbjct: 183 FCGPQQLDPDREFLDQARAAGTNVRIERDPWKGVDGADLVVADTWVSMHDAQSSRERRHN 242

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + + +QVN  LM+ A P+ALFMHCLPAHR EEV + V+DGPQSV+FDEAENRLH QKA++
Sbjct: 243 LLRAYQVNDRLMAAASPEALFMHCLPAHREEEVTSSVMDGPQSVIFDEAENRLHAQKAVM 302

Query: 300 LWCFGI 305
            WC G+
Sbjct: 303 RWCLGV 308


>gi|148554328|ref|YP_001261910.1| ornithine carbamoyltransferase [Sphingomonas wittichii RW1]
 gi|189036341|sp|A5V656|OTC_SPHWW RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|148499518|gb|ABQ67772.1| ornithine carbamoyltransferase [Sphingomonas wittichii RW1]
          Length = 309

 Score =  331 bits (848), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 152/304 (50%), Positives = 207/304 (68%), Gaps = 5/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFE-----NKPLSGKVLAMIFEKPSTRTRV 60
           + F DL++  ++ +  +++ A   K +   + +     + PL+G  LAMIFEK STRTRV
Sbjct: 3   RSFLDLADAGAAGVRLMLDEAVSRKKARAGLPKGAPDRDAPLAGHTLAMIFEKNSTRTRV 62

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF++AM+ LGG TI +    MQLGR ETI DTA+VLSRYVDAI++RT +H + ++L  YA
Sbjct: 63  SFDMAMRQLGGTTIVMDAGSMQLGRGETIADTARVLSRYVDAIMIRTDDHRKAVDLARYA 122

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
            VPVIN LTD +HPCQI+AD+ T  EH+G V+G  ++W GDGNN+LHS++E  +   + +
Sbjct: 123 DVPVINGLTDRSHPCQIMADLQTILEHKGRVEGLGWAWLGDGNNVLHSIVEAGSLLGFPV 182

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            I  P G +P  E L  AR +G  + L  D  + V+GA  V TDTWISM Q     +   
Sbjct: 183 RIGCPEGYDPDAEVLAEARARGGDILLSRDPAEVVRGADVVVTDTWISMGQAHAEEKLAA 242

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
             PFQV+ + M+ A PDA F+HCLPAHRGEEV++ V+DGP S+++DEAENRLH QKA+LL
Sbjct: 243 MMPFQVDEARMAQAAPDAAFLHCLPAHRGEEVVDAVIDGPHSLIWDEAENRLHAQKAVLL 302

Query: 301 WCFG 304
           WC G
Sbjct: 303 WCLG 306


>gi|315497562|ref|YP_004086366.1| ornithine carbamoyltransferase [Asticcacaulis excentricus CB 48]
 gi|315415574|gb|ADU12215.1| ornithine carbamoyltransferase [Asticcacaulis excentricus CB 48]
          Length = 307

 Score =  328 bits (841), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 156/303 (51%), Positives = 203/303 (66%), Gaps = 5/303 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNS-----SENIFENKPLSGKVLAMIFEKPSTRTRV 60
           KHF D+S++S+++L  I++ A   K +        +  + P   +VLAMIFEK STRTR 
Sbjct: 3   KHFLDISDLSATDLRAILDDAHARKKARLGWPKGRVDADAPAQDRVLAMIFEKNSTRTRF 62

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF+ A++ LGGD I  + ++MQLGR ETI DTAKVLSR VDAI++R   H  +  L   A
Sbjct: 63  SFDAAIRQLGGDAIISTATDMQLGRGETIEDTAKVLSRMVDAIMIRANRHEDVERLARAA 122

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +VPVIN LT+ +HPCQI+AD+ T EEHRG +KGK  +W GDGNN+  S I  AARF++ L
Sbjct: 123 SVPVINGLTNKSHPCQILADLQTIEEHRGDIKGKTLAWVGDGNNVCASFIHAAARFDFTL 182

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
           NIA P   +P N  + +A    A V +  D   AV+GA  V  DTW+SM           
Sbjct: 183 NIACPAKYKPSNADMVFAAESRARVTVTQDPEAAVRGADVVMADTWVSMGDLDHEERLEA 242

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+P+QVN +LM +A PDALF+HCLPAHRGEEV + V+DGPQS V+DEAENR+H QKA+L 
Sbjct: 243 FEPYQVNEALMKLAGPDALFLHCLPAHRGEEVTDGVIDGPQSQVWDEAENRIHAQKAVLA 302

Query: 301 WCF 303
           WC 
Sbjct: 303 WCL 305


>gi|126725181|ref|ZP_01741024.1| ornithine carbamoyltransferase [Rhodobacterales bacterium HTCC2150]
 gi|126706345|gb|EBA05435.1| ornithine carbamoyltransferase [Rhodobacterales bacterium HTCC2150]
          Length = 307

 Score =  326 bits (836), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 154/306 (50%), Positives = 213/306 (69%), Gaps = 8/306 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-----PLSGKVLAMIFEKPSTRTRVS 61
           HF D+     + L  II+ A+ +K++  +  +       PL GK++AMIFEKPSTRTRVS
Sbjct: 3   HFLDIHKTDKAALRGIIDQARGMKDARGDASKGALDAALPLDGKMVAMIFEKPSTRTRVS 62

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG ++ LSG++MQLG  ETI DTAKVLSRYVD I++RT + + LLEL E + 
Sbjct: 63  FDVGVRQMGGQSMILSGADMQLGHGETIADTAKVLSRYVDLIMIRTFDENTLLELAEASD 122

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD THPCQI+AD+MT+EEH+G +KGK   W+GDGNN+  S +  A +F +   
Sbjct: 123 VPVINGLTDRTHPCQIMADVMTYEEHKGPIKGKKVVWTGDGNNVCASFLHAAGQFGFDFT 182

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKAREEH 239
              P   +P  E++  AR QG +V +  +A +AV+GA  +  DTW+SM+  Q  + R  +
Sbjct: 183 YTGPETLDPEAEFIELARKQGVNVTIDRNAQRAVEGADLIVADTWVSMHDPQSKRERRHN 242

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             +P++V+ +LM+ A P+ALFMHCLPAHR EEV + V+DGPQSV+FDEAENRLH QKAI+
Sbjct: 243 QLRPYRVDDALMAQA-PNALFMHCLPAHREEEVTSSVMDGPQSVIFDEAENRLHVQKAIM 301

Query: 300 LWCFGI 305
            W   +
Sbjct: 302 RWALDV 307


>gi|297172479|gb|ADI23451.1| ornithine carbamoyltransferase [uncultured nuHF1 cluster bacterium
           HF0770_35I22]
          Length = 305

 Score =  325 bits (834), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 155/298 (52%), Positives = 202/298 (67%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF DL  ++S+ L  II+ AKKIK+        K LSGK L  IFEKPSTRTRVSF++ 
Sbjct: 7   RHFLDLDLMTSNVLRQIIDDAKKIKSEHFLGRSKKTLSGKNLVCIFEKPSTRTRVSFQIG 66

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG    L      +G+ E+I DTA+VLSRY DAI+ RT +  +L EL +++++PVI
Sbjct: 67  MQQLGGSVTVLDDVNSHMGQGESIADTARVLSRYADAIMFRTDDPKKLQELAQHSSIPVI 126

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD +HPCQI+ADI+TFEEHRGS+ GK  +WSGDGNN+L S +  A  F + + +  P
Sbjct: 127 NGLTDFSHPCQIMADILTFEEHRGSIFGKTIAWSGDGNNVLTSWLHAAVHFGFEVKVGCP 186

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
              +P    + W  + GA + +F  AV AV+ A  V TDTW+SM  E  +        F+
Sbjct: 187 GDCQPDPRVVKWGLDNGAVIKIFDTAVDAVRNADLVITDTWVSMGDEDVSNRRDRLSLFK 246

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           V+  LMS+A  DALFMHCLPAHRGEEV +EV+DGPQSV++DEAENRLH QK+IL WC 
Sbjct: 247 VDSRLMSLAAKDALFMHCLPAHRGEEVTDEVMDGPQSVIWDEAENRLHAQKSILAWCL 304


>gi|89070724|ref|ZP_01157986.1| ornithine carbamoyltransferase [Oceanicola granulosus HTCC2516]
 gi|89043682|gb|EAR49887.1| ornithine carbamoyltransferase [Oceanicola granulosus HTCC2516]
          Length = 308

 Score =  325 bits (833), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 161/305 (52%), Positives = 207/305 (67%), Gaps = 7/305 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSEN-----IFENKPLSGKVLAMIFEKPSTRTRVS 61
           HF D+     + L  II+ A+ +K++          +  PL+G+++A+IFEKPSTRTRVS
Sbjct: 3   HFLDIHCTDPAQLRGIIDAARAMKDARAGRPKGTPDDETPLAGRMVALIFEKPSTRTRVS 62

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG+T+ LSGSEMQLG  ETI DTA+VLSRYVD I++RT     LLE+ EYA 
Sbjct: 63  FDVGVRQMGGETMVLSGSEMQLGHGETIADTARVLSRYVDLIMIRTFEEQTLLEMAEYAD 122

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LT+ +HPCQI+ADIMTFEEHRG ++G+   WSGDGNN+  S    A +F + L 
Sbjct: 123 VPVINGLTNRSHPCQIMADIMTFEEHRGPIRGRKVVWSGDGNNVFTSFAHAAGQFGFDLT 182

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE--H 239
              P   EP  E L   R  G  V +  D  +AV GA  V TDTW+SM+    ARE   +
Sbjct: 183 FTGPPPLEPERELLEEVRAAGGKVEVVRDPAEAVAGADLVVTDTWVSMHDPQSARERRHN 242

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             + +QVN +LM+ A PDALFMHCLPAHR +E  +EV+DGP SV+FDEAENRLH QKAI+
Sbjct: 243 QLRGYQVNAALMARAKPDALFMHCLPAHRDDEATSEVMDGPHSVIFDEAENRLHAQKAIM 302

Query: 300 LWCFG 304
            WC G
Sbjct: 303 RWCLG 307


>gi|89053514|ref|YP_508965.1| ornithine carbamoyltransferase [Jannaschia sp. CCS1]
 gi|88863063|gb|ABD53940.1| ornithine carbamoyltransferase [Jannaschia sp. CCS1]
          Length = 308

 Score =  323 bits (829), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 154/304 (50%), Positives = 204/304 (67%), Gaps = 7/304 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNS-----SENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           +F D+     + L  I+  A  +K +          +++PL+G V+A+IFEKPSTRTRVS
Sbjct: 3   NFLDIHTTDPAALRDILAQAGNMKTARGTRPKGTPDDDQPLAGHVVALIFEKPSTRTRVS 62

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG T+ LSG+EMQLG  ETI DTA+VLSRYVD I++RT     L E+ E+AT
Sbjct: 63  FDVGVRQMGGSTLVLSGAEMQLGHGETIADTARVLSRYVDLIMIRTFGEDILHEMAEHAT 122

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTDN+HPCQI+AD+MTFEEHRG +KGK  +W GDGNN+  S +  AA F +   
Sbjct: 123 VPVINGLTDNSHPCQIMADVMTFEEHRGPIKGKRVAWMGDGNNVAQSFLHAAASFGFDFT 182

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKAREEH 239
            + P   +PR++ +   R  G  V +  D  +AV  A  V TDTW+SM   +  + R  +
Sbjct: 183 FSGPAQLDPRDDLVGAVRKAGQDVRIERDPAKAVADADLVVTDTWVSMGDAESSRQRRHN 242

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + +P+QVN  LM  A   A+ MHCLPAHRGEEV + +LDGP+SVVFDEAENRLH QKAI+
Sbjct: 243 LLRPYQVNERLMDAAPDHAMVMHCLPAHRGEEVTDAILDGPRSVVFDEAENRLHAQKAIM 302

Query: 300 LWCF 303
            WC 
Sbjct: 303 RWCL 306


>gi|85709643|ref|ZP_01040708.1| ornithine carbamoyltransferase [Erythrobacter sp. NAP1]
 gi|85688353|gb|EAQ28357.1| ornithine carbamoyltransferase [Erythrobacter sp. NAP1]
          Length = 313

 Score =  321 bits (823), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 155/310 (50%), Positives = 211/310 (68%), Gaps = 5/310 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-----PLSGKVLAMIFEKPST 56
           MT  +HF DL +  +  ++ +I  A   K +  +  + K     PL G+VLA++FEK ST
Sbjct: 1   MTVARHFLDLGDAGADAIAAMISDALDRKEARRDWPKGKTDADEPLKGRVLALVFEKNST 60

Query: 57  RTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLEL 116
           RTRVSF+VAM+ LGG  + L     QLGR ETI DTA+VLSR VDAI++RT +H+++ E+
Sbjct: 61  RTRVSFDVAMRQLGGTVLILEAGSSQLGRGETIADTARVLSRMVDAIMLRTDDHAKIEEM 120

Query: 117 TEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARF 176
             +A+VPVIN LTD +HPCQI+AD++T  EH+  + G   +W GDGNN+LHS++E A   
Sbjct: 121 ARHASVPVINGLTDRSHPCQIVADLLTIIEHKKPLPGLEVAWFGDGNNVLHSVLEAAGLL 180

Query: 177 NYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR 236
            + + +ATP G EP  E++  AR+ GASV L H+A QA  GA  + TDTWISM Q     
Sbjct: 181 KFNVRVATPEGYEPAAEFVEIARSGGASVTLTHNAQQAADGADVLVTDTWISMGQADADD 240

Query: 237 EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
           +     P+QVN  LM+ A P+A+F+HCLPAH GEEV  +V +  QSVVFDEAENR+H QK
Sbjct: 241 KRKAMAPYQVNGDLMARAKPEAIFLHCLPAHVGEEVSEDVFESSQSVVFDEAENRIHAQK 300

Query: 297 AILLWCFGII 306
           ++LLW FG++
Sbjct: 301 SVLLWSFGLL 310


>gi|296284924|ref|ZP_06862922.1| ornithine carbamoyltransferase [Citromicrobium bathyomarinum JL354]
          Length = 309

 Score =  320 bits (821), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 154/304 (50%), Positives = 211/304 (69%), Gaps = 5/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-----PLSGKVLAMIFEKPSTRTRV 60
           +HF DLS+     L+ ++  A   K + ++  + K     PL+G VLAMIFEK STRTRV
Sbjct: 4   RHFLDLSDAGGDALAAMLSDAIDRKGARKSWPKGKADADAPLAGHVLAMIFEKSSTRTRV 63

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF++AM+ LGG  I +    MQLGR E+I DTA+VLSR VDAI++RT +H+++ E+  +A
Sbjct: 64  SFDIAMRQLGGSAIVMESGSMQLGRGESIADTARVLSRMVDAIMIRTDDHAKVEEMARHA 123

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +VPVIN LTD +HPCQI+AD++T  EH  ++ G   +W GDGNN+LHS++E A  F + +
Sbjct: 124 SVPVINGLTDASHPCQIVADLLTIIEHGKALPGLELAWLGDGNNVLHSILEAAGIFKFNV 183

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            +ATP G EP   ++  AR  GA++ L  DA  A + A  + TDTW+SM QE  A +   
Sbjct: 184 RVATPAGFEPEAAFVEAARAGGATITLTQDAEAAARDADVIVTDTWVSMGQENAASKIAA 243

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
            QPFQVN +LM++A P+A F+HCLPAH G+EV   V++GPQS VFDEAENR+H QK++LL
Sbjct: 244 MQPFQVNDALMALAKPEADFLHCLPAHVGDEVTQSVIEGPQSRVFDEAENRIHAQKSVLL 303

Query: 301 WCFG 304
           W FG
Sbjct: 304 WAFG 307


>gi|295401641|ref|ZP_06811608.1| ornithine carbamoyltransferase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|294976261|gb|EFG51872.1| ornithine carbamoyltransferase [Geobacillus thermoglucosidasius
           C56-YS93]
          Length = 313

 Score =  320 bits (819), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 156/300 (52%), Positives = 210/300 (70%), Gaps = 5/300 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K F  L +IS+ ++  ++ +A+++K        + PL+GK LAMIFEKPSTRTRVSFEV 
Sbjct: 10  KDFLTLIDISTEDIYDLLALAEELKQKQLAGQSHAPLAGKTLAMIFEKPSTRTRVSFEVG 69

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  ++L+ S++QLGR ETI DTA+VLS+YVDAI++RT  HS+L EL  YAT+PVI
Sbjct: 70  MTQLGGSALYLNSSDLQLGRGETIADTARVLSQYVDAIMIRTFAHSKLEELAAYATIPVI 129

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD++T  E + ++KG   ++ GDGNN+ ++L+  AA+      IA P
Sbjct: 130 NGLTDDDHPCQALADLLTIYEVKKTLKGLKLAYVGDGNNVANALMIAAAKVGMDCVIACP 189

Query: 186 IGSEPRNEYLNWA----RNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HV 240
            G EP+ +Y++ A    R  GA+VA+ HD V+AV  A  ++TD W SM QE ++ +   V
Sbjct: 190 AGYEPKEKYIDAAEQIGRQTGAAVAVTHDPVEAVANADVIYTDVWTSMGQEQESEQRLTV 249

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           FQPFQVN  L+  A  D LF+HCLPAHRGEEV  EV+DGP S VF +A NRLH QKA+LL
Sbjct: 250 FQPFQVNGELVKHAKQDYLFLHCLPAHRGEEVTAEVIDGPNSFVFQQAGNRLHAQKAVLL 309


>gi|288957258|ref|YP_003447599.1| ornithine carbamoyltransferase [Azospirillum sp. B510]
 gi|288909566|dbj|BAI71055.1| ornithine carbamoyltransferase [Azospirillum sp. B510]
          Length = 314

 Score =  319 bits (818), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 152/304 (50%), Positives = 203/304 (66%), Gaps = 3/304 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNS--SENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
           +HF D+  +  + L  +++ A +IK     + +  +  L+G+ LA+IFEKPSTRTRVSFE
Sbjct: 10  RHFLDIDRMDGATLRRLLDHAVRIKADLKKDRLAHSTLLAGRSLALIFEKPSTRTRVSFE 69

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M+  GG+ + L   +MQLGR ETIGDTA+VLSR+VDA+++RTT   R+ EL  +A++P
Sbjct: 70  VGMQQFGGNVVVLKPDDMQLGRGETIGDTARVLSRFVDAVMVRTTGEERVHELAAHASIP 129

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           +IN LTD THPCQI+AD+MTFEEHRG + G+  +W GD NN+  S    A RF + + +A
Sbjct: 130 IINGLTDQTHPCQIMADLMTFEEHRGPIGGRTVAWIGDCNNVAVSWAHAAVRFGFEMRLA 189

Query: 184 TPIGSEPRNEYLNWA-RNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQ 242
            P    P  E L WA R  G  + +     +AV+G  CV TD W SM+         +  
Sbjct: 190 CPSVYGPSPELLAWAEREGGGRLVVTESPEEAVRGVDCVITDAWASMHNTDVDERAAILA 249

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           P+QVN +LM+ AH DALFMHCLPAHR EEV + V+DG  SVV+DEAENRLH QKAIL WC
Sbjct: 250 PYQVNEALMAHAHHDALFMHCLPAHRNEEVTDGVIDGRHSVVWDEAENRLHAQKAILGWC 309

Query: 303 FGII 306
            G++
Sbjct: 310 MGVL 313


>gi|209965756|ref|YP_002298671.1| ornithine carbamoyltransferase [Rhodospirillum centenum SW]
 gi|209959222|gb|ACI99858.1| ornithine carbamoyltransferase [Rhodospirillum centenum SW]
          Length = 306

 Score =  319 bits (817), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 157/298 (52%), Positives = 203/298 (68%), Gaps = 3/298 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF D+  + + +L  +++ A  +K + +     KPL G+ LA+IFEKPSTRTRVSFEV 
Sbjct: 10  RHFIDIHLLDAGSLRGMLDYAAALKRAKQ---PEKPLLGRTLALIFEKPSTRTRVSFEVG 66

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+ I L+G E+QLG  ETIGDTA+VLSR+VDAI++RT    +L E+ E A+VPVI
Sbjct: 67  MRQLGGEVITLTGKEIQLGHGETIGDTARVLSRFVDAIMLRTDAEEKLHEMAEAASVPVI 126

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD +HP QI+ADI+TFEE +G + GK+  WSGD NN+  S I  A RF++ L +A P
Sbjct: 127 NGLTDKSHPVQIMADILTFEERKGPITGKVVCWSGDANNVCESWIHAAVRFDFELRVACP 186

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
               P  E L W R     V +  DA  AV GA  V TDTW+SM+ +   R   + +P+Q
Sbjct: 187 AELAPSAETLEWVRRNDGRVIVTRDAEAAVAGADAVVTDTWVSMHHQDAERRHALLKPYQ 246

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN  LM +A  DA+FMHCLPAHR EEV   V+DGPQSVV+DEAENR+H QK IL WC 
Sbjct: 247 VNERLMGLAQKDAIFMHCLPAHRDEEVSTAVIDGPQSVVWDEAENRMHAQKGILAWCL 304


>gi|296131893|ref|YP_003639140.1| ornithine carbamoyltransferase [Thermincola sp. JR]
 gi|296030471|gb|ADG81239.1| ornithine carbamoyltransferase [Thermincola potens JR]
          Length = 313

 Score =  318 bits (816), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 160/304 (52%), Positives = 201/304 (66%), Gaps = 5/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   ++ I++ A ++K   +    +  L+GK LAMIF K STRTRVSFEVA
Sbjct: 10  KDLLALYELTREEITEILKFAAELKQKQKEGIPHPLLAGKTLAMIFTKSSTRTRVSFEVA 69

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FL+G E+QLGR ETI DTA+VLSRYVD I++RT  HS + EL  YA VPVI
Sbjct: 70  MYQLGGYPLFLNGQELQLGRGETIADTARVLSRYVDGIMIRTFAHSDVEELARYADVPVI 129

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQI+AD  T  EH+G ++G   ++ GDGNN+ HSL+ G A+    +++ATP
Sbjct: 130 NGLTDLNHPCQILADFQTIIEHKGRLEGLKLAYVGDGNNVCHSLLNGCAKVGMHISVATP 189

Query: 186 IGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HV 240
            G EP  E +      AR  GA V +  D  QAVK A  ++TD W SM QE +  E   +
Sbjct: 190 KGYEPDAEIVRKAMADARLSGAVVEILEDPCQAVKDADVIYTDVWASMGQEAEHAERLKI 249

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+P+QVN  L+  A PD LFMHCLPAHRGEEV  EV+DGP SVVFDEAENRLH QKA+L 
Sbjct: 250 FRPYQVNSDLVKRARPDYLFMHCLPAHRGEEVAAEVIDGPNSVVFDEAENRLHAQKAVLA 309

Query: 301 WCFG 304
              G
Sbjct: 310 LTMG 313


>gi|312112026|ref|YP_003990342.1| ornithine carbamoyltransferase [Geobacillus sp. Y4.1MC1]
 gi|311217127|gb|ADP75731.1| ornithine carbamoyltransferase [Geobacillus sp. Y4.1MC1]
          Length = 313

 Score =  318 bits (816), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 155/300 (51%), Positives = 210/300 (70%), Gaps = 5/300 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K F  L +IS+ ++  ++ +A+++K        + PL+GK LAMIFEKPSTRTRVSFEV 
Sbjct: 10  KDFLTLIDISTEDIYDLLALAEELKQKQLAGQSHAPLAGKTLAMIFEKPSTRTRVSFEVG 69

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  ++L+ S++QLGR ETI DTA+VLS+YVDAI++RT  HS+L EL  YAT+PVI
Sbjct: 70  MTQLGGSALYLNSSDLQLGRGETIADTARVLSQYVDAIMIRTFAHSKLEELAAYATIPVI 129

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD++T  E + ++KG   ++ GDGNN+ ++L+  AA+      IA P
Sbjct: 130 NGLTDDDHPCQALADLLTIYEVKKTLKGLKLAYVGDGNNVANALMIAAAKVGMDCVIACP 189

Query: 186 IGSEPRNEYLNWA----RNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HV 240
            G EP+ +Y++ A    +  GA+VA+ HD V+AV  A  ++TD W SM QE ++ +   V
Sbjct: 190 AGYEPKEKYIDAAEQIGKQTGAAVAVTHDPVEAVANADVIYTDVWTSMGQEQESEQRLTV 249

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           FQPFQVN  L+  A  D LF+HCLPAHRGEEV  EV+DGP S VF +A NRLH QKA+LL
Sbjct: 250 FQPFQVNGELVKHAKQDYLFLHCLPAHRGEEVTAEVIDGPNSFVFQQAGNRLHAQKAVLL 309


>gi|197106399|ref|YP_002131776.1| ornithine carbamoyltransferase [Phenylobacterium zucineum HLK1]
 gi|196479819|gb|ACG79347.1| ornithine carbamoyltransferase [Phenylobacterium zucineum HLK1]
          Length = 312

 Score =  317 bits (813), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 156/307 (50%), Positives = 203/307 (66%), Gaps = 5/307 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENI-----FENKPLSGKVLAMIFEKPSTRTR 59
           P+HF DL  +  + L  I+E AK  K +          E++P +G+ LAMIFEK STRTR
Sbjct: 6   PRHFIDLWKLDGTELRTILEDAKARKAARAGWPKGRPDEDRPAAGRTLAMIFEKNSTRTR 65

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
            SF+ AM+ LGGD I  +  +MQLGR E I DTA+VLSR VDA+++R+  H  +     +
Sbjct: 66  FSFDAAMRQLGGDVIISNAVDMQLGRGEPIEDTARVLSRMVDAVMIRSNVHEDVERFAHW 125

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ++VPVIN L+D +HPCQI+AD+MTFEEHRGSV G+ F+W GDGNN+  S I  A +  + 
Sbjct: 126 SSVPVINGLSDRSHPCQIMADLMTFEEHRGSVHGRTFAWIGDGNNVCASFIHAAPKLGFK 185

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           LNIATP    P    L  A  Q   V    D  +AV+GAHC+ TDTW+SM          
Sbjct: 186 LNIATPAIYHPDLVDLARAAEQQGHVTTTSDPREAVRGAHCIVTDTWVSMGDTDHDERFE 245

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             +P+QV+ +LM  A  DA+F+HCLPAHRGEEV + V+DGP+S+V+DEAENRLH QK+IL
Sbjct: 246 ALEPYQVDDALMDEAAEDAVFLHCLPAHRGEEVTDSVIDGPRSLVWDEAENRLHAQKSIL 305

Query: 300 LWCFGII 306
            WCFG I
Sbjct: 306 AWCFGAI 312


>gi|239826270|ref|YP_002948894.1| ornithine carbamoyltransferase [Geobacillus sp. WCH70]
 gi|239806563|gb|ACS23628.1| ornithine carbamoyltransferase [Geobacillus sp. WCH70]
          Length = 312

 Score =  317 bits (813), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 155/300 (51%), Positives = 207/300 (69%), Gaps = 5/300 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K F  L +IS+ ++  ++ +AK++K          PL GK LAMIFEKPSTRTRVSFEV 
Sbjct: 10  KDFLTLMDISTEDIHYLLTLAKELKQKQLAGQLYTPLVGKTLAMIFEKPSTRTRVSFEVG 69

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  ++L+ +++QLGR ETI DTA+VLS+YVDAI++RT  H +L EL EYAT+PVI
Sbjct: 70  MTQLGGSALYLNSNDLQLGRGETIADTARVLSQYVDAIMIRTFAHQKLEELAEYATIPVI 129

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD++T  E + ++KG   ++ GDGNN+ H+L+  AA+      IA P
Sbjct: 130 NGLTDDDHPCQALADLLTIYEVKNTLKGLKLAYVGDGNNVAHALMIAAAKVGMDCVIACP 189

Query: 186 IGSEPRNEYLNWA----RNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HV 240
            G EP+ +Y+N A    +  GA+VA+ H+ V+AV  A  ++TD W SM QE ++ +   V
Sbjct: 190 AGYEPKEKYVNAAMQIGKQTGANVAVTHNPVEAVTNADIIYTDVWTSMGQEQESEQRLAV 249

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           FQPFQVN  L   A PD +F+HCLPAHR EEV  +V+DGP S VF +A NRLH QKAILL
Sbjct: 250 FQPFQVNCELAKHAKPDYMFLHCLPAHRDEEVTADVIDGPNSFVFQQAGNRLHVQKAILL 309


>gi|163747267|ref|ZP_02154622.1| ornithine carbamoyltransferase [Oceanibulbus indolifex HEL-45]
 gi|161379542|gb|EDQ03956.1| ornithine carbamoyltransferase [Oceanibulbus indolifex HEL-45]
          Length = 301

 Score =  317 bits (812), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 156/308 (50%), Positives = 207/308 (67%), Gaps = 20/308 (6%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSEN-----IFENKPLSGKVLAMIFEKPSTRTRVS 61
           HF D+     ++L  II+ A  +K + +        +++PL  +++A+IFEKPSTRTRVS
Sbjct: 3   HFLDIHQTDPADLRQIIDNAAAMKAARQGRPRGAADDDQPLKDQMVALIFEKPSTRTRVS 62

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG T+ LSG++MQLG  ETI DTA+VLSRYVD I++RT     LLE+ EYAT
Sbjct: 63  FDVGVRQMGGQTMVLSGADMQLGHGETIADTARVLSRYVDMIMIRTFEEQTLLEMAEYAT 122

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LT+ THPCQI+ADI TFEEHRG +KG+   WSGDGNN+  SL   A +F++ L 
Sbjct: 123 VPVINGLTNRTHPCQIMADIQTFEEHRGPIKGRKVVWSGDGNNVFASLAHAAKQFDFDLV 182

Query: 182 IATPIGSEPRNEYLNWARNQGASVALF---HDAVQAVKGAHCVFTDTWISMNQEFKAREE 238
              P   +P          + A   L+    D  +AV+GA  V TDTW+SM+    ARE 
Sbjct: 183 FTGPQTLDP----------EAALDGLYTIERDPQKAVEGADLVVTDTWVSMHDPQSARER 232

Query: 239 --HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
             +  + +QVN +LMS+A PDALFMHCLPAHR +E  + V+DGP SV+FDEAENRLH QK
Sbjct: 233 RHNQLRGYQVNDALMSLAKPDALFMHCLPAHRDDEATSSVMDGPHSVIFDEAENRLHAQK 292

Query: 297 AILLWCFG 304
           A++ WC G
Sbjct: 293 AVMRWCLG 300


>gi|241760959|ref|ZP_04759048.1| ornithine carbamoyltransferase [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|283856252|ref|YP_162144.2| ornithine carbamoyltransferase [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|241374578|gb|EER64039.1| ornithine carbamoyltransferase [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|283775247|gb|AAV89033.2| ornithine carbamoyltransferase [Zymomonas mobilis subsp. mobilis
           ZM4]
          Length = 313

 Score =  315 bits (807), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 147/306 (48%), Positives = 207/306 (67%), Gaps = 5/306 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSEN-----IFENKPLSGKVLAMIFEKPSTRTRV 60
           +HF + ++  +  +  ++  A   K + +      +  + PL   +L MIFEK STRTRV
Sbjct: 8   RHFLNFADAGADAVKAMLADALARKQARKGWPKGRVDADAPLKDSILGMIFEKNSTRTRV 67

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF+V M+ LGG TI +     Q+GR ETI DTA+VLSR++DAI++RT +H+++ EL  YA
Sbjct: 68  SFDVGMRQLGGSTIVMESGSTQIGRGETIADTARVLSRFIDAIMIRTDDHAKIEELARYA 127

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +VPVIN LTD +HPCQI+AD++T  EH+G V+G  ++W GDGNN+L+S+IE +    + +
Sbjct: 128 SVPVINGLTDLSHPCQIMADMLTVIEHKGKVEGTRWAWLGDGNNVLYSIIEASGLMGFSV 187

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
             A P G EP  +++  AR  G  V +  D  +AVKGA  V TDTWISM Q     +   
Sbjct: 188 IAACPHGYEPDPKFIEAARKAGCDVVITDDPDEAVKGADVVVTDTWISMGQAHAEAKMAA 247

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
            QP+QVN +LM+ A   ALF+HCLPAHRGEEV++ V+DG +SVV+DEAENRLH QK++LL
Sbjct: 248 MQPYQVNEALMAKAGDQALFLHCLPAHRGEEVVDAVIDGSRSVVWDEAENRLHAQKSVLL 307

Query: 301 WCFGII 306
           W  G++
Sbjct: 308 WSLGLL 313


>gi|260753074|ref|YP_003225967.1| ornithine carbamoyltransferase [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|258552437|gb|ACV75383.1| ornithine carbamoyltransferase [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 313

 Score =  315 bits (806), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 146/306 (47%), Positives = 207/306 (67%), Gaps = 5/306 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSEN-----IFENKPLSGKVLAMIFEKPSTRTRV 60
           +HF + ++  +  +  ++  A   K + +      +  + PL   +L MIFEK STRTRV
Sbjct: 8   RHFLNFADAGADAVKAMLADALARKQARKGWPKGRVDADAPLKDSILGMIFEKNSTRTRV 67

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF+V M+ LGG TI +     Q+GR ETI DTA+VLSR++DAI++RT +H+++ EL  YA
Sbjct: 68  SFDVGMRQLGGSTIVMESGSTQIGRGETIADTARVLSRFIDAIMIRTDDHAKIEELARYA 127

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +VP+IN LTD +HPCQI+AD++T  EH+G V+G  ++W GDGNN+L+S+IE +    + +
Sbjct: 128 SVPIINGLTDLSHPCQIMADMLTVIEHKGKVEGTRWAWLGDGNNVLYSIIEASGLMGFSV 187

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
             A P G EP  +++  AR  G  V +  D  +AVKGA  V TDTWISM Q     +   
Sbjct: 188 IAACPHGYEPDPKFIEAARKAGCDVVITDDPDEAVKGADVVVTDTWISMGQAHAEAKMAA 247

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
            QP+QVN +LM+ A   ALF+HCLPAHRGEEV++ V+DG +SVV+DEAENRLH QK++LL
Sbjct: 248 MQPYQVNEALMAKAGDQALFLHCLPAHRGEEVVDAVIDGSRSVVWDEAENRLHAQKSVLL 307

Query: 301 WCFGII 306
           W  G++
Sbjct: 308 WSLGLL 313


>gi|54288320|gb|AAV31608.1| ornithine carbamoyltransferase [uncultured alpha proteobacterium
           EBAC2C11]
          Length = 329

 Score =  313 bits (803), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 157/304 (51%), Positives = 200/304 (65%), Gaps = 4/304 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEV--AKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT  +HF DL + S+  L  I++V  + K+K  S +  E    SGK +AMIFEKPSTRTR
Sbjct: 25  MTPMRHFLDLKDFSTDTLQSILDVGLSMKVKQKSGDSHELS-FSGKTVAMIFEKPSTRTR 83

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSFEV +  LGG  + LS S++Q+GR E+I DTA+VLSRYV+AIV+R   H  LL L ++
Sbjct: 84  VSFEVGITQLGGTPLVLSASDLQIGRGESIEDTARVLSRYVNAIVIRCYKHETLLTLAKH 143

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           A+VPVINALT+ +HPCQ++AD+MT  E+ G + G+  +W GDGNN+  S IE A  F + 
Sbjct: 144 ASVPVINALTNWSHPCQLMADLMTMIEYHGPLAGQTVAWLGDGNNVAVSWIEAAVHFGFH 203

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L IA P    P    L WAR  G  + L  D   A+     V TD W+SM  +  +R + 
Sbjct: 204 LRIAGPQRYAPPAGLLAWARANGGDIMLTDDVSLAIDKVQTVVTDVWVSMGADEGSRRKD 263

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F P+QVN  LM  A  DA+FMHCLPA RG EV  EV+DGPQS VFDEAENRLH QKA++
Sbjct: 264 -FAPYQVNAKLMKSAAGDAIFMHCLPAQRGMEVTAEVIDGPQSAVFDEAENRLHAQKAVM 322

Query: 300 LWCF 303
           LWC 
Sbjct: 323 LWCL 326


>gi|254492475|ref|ZP_05105647.1| ornithine carbamoyltransferase [Methylophaga thiooxidans DMS010]
 gi|224462367|gb|EEF78644.1| ornithine carbamoyltransferase [Methylophaga thiooxydans DMS010]
          Length = 298

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 155/295 (52%), Positives = 207/295 (70%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++SS  L  +I  A ++K    N    +PL  +VLAMIFEK STRTRVSFE A
Sbjct: 2   RHFLTLKDLSSVELKQLINRASELKTMHHNGEIYQPLKNQVLAMIFEKSSTRTRVSFESA 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M   GG +IFLS  + QLGR E + D+A+V+S  VDA+++RT  HS+L    ++++VPVI
Sbjct: 62  MIQFGGGSIFLSPDDTQLGRGEPVEDSARVISSMVDAVMIRTFEHSKLETFAKFSSVPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+ HPCQ++AD+ T++EHRGS+ GK   W GDGNN+ HS I  A +F + L+IATP
Sbjct: 122 NALTDDFHPCQLLADMQTYQEHRGSIDGKKVVWIGDGNNMCHSYINAAQQFGFELHIATP 181

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EHVFQPF 244
            G EP    ++  +   A + LF+D ++A +GA  V TD W SM QE + R+ E  F  F
Sbjct: 182 EGYEPNQSLIDSTQ---AEIQLFNDPIKATEGADLVVTDVWASMGQEEEQRKREAAFASF 238

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QV+ ++M++A  +ALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA+L
Sbjct: 239 QVDQAVMNVAAKNALFMHCLPAHRGEEVTAEVIDGPQSVVWDEAENRLHAQKALL 293


>gi|326389105|ref|ZP_08210686.1| ornithine carbamoyltransferase [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326206411|gb|EGD57247.1| ornithine carbamoyltransferase [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 308

 Score =  313 bits (801), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 151/306 (49%), Positives = 204/306 (66%), Gaps = 5/306 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKP-----LSGKVLAMIFEKPSTRTRV 60
           +HF +LS+  +  L  I+  A   K + + + + +P     L+G VLAM+FEK STRTRV
Sbjct: 3   RHFLNLSDAGADALKAILGDAVARKAARQGLPKGRPDADAPLAGHVLAMVFEKNSTRTRV 62

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF+VAM+ LGG  + L     QLGR ETI DTA+VLSR  DAI++RT +H+++ EL  YA
Sbjct: 63  SFDVAMRQLGGSAVILEAGSTQLGRGETIADTARVLSRMADAIMLRTDDHAKVEELAHYA 122

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVIN LTD +HPCQI+AD+ T  E    + G  ++W GDGNN+L+S++E A    + L
Sbjct: 123 TVPVINGLTDLSHPCQIVADLQTVIERGKPLAGLEWAWLGDGNNVLNSIVEAAGLAGFNL 182

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            I  P G +    ++  A+  G+++ +  DA +AV GA  V TDTW+SM Q     +   
Sbjct: 183 RIGVPEGYDSDPGFIARAQAAGSTIRVTRDAAEAVAGADVVVTDTWVSMGQAHAEEKLAA 242

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
            +PFQVN +LM+ A  DA+F+HCLPAHRGEEV +EV+DG QS V+DEAENR+H QKAIL 
Sbjct: 243 MEPFQVNGALMAKAASDAVFLHCLPAHRGEEVTDEVIDGAQSAVWDEAENRIHAQKAILR 302

Query: 301 WCFGII 306
           W FG I
Sbjct: 303 WAFGQI 308


>gi|157829642|pdb|1A1S|A Chain A, Ornithine Carbamoyltransferase From Pyrococcus Furiosus
          Length = 314

 Score =  312 bits (800), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 153/301 (50%), Positives = 201/301 (66%), Gaps = 5/301 (1%)

Query: 11  LSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLG 70
           L + ++  +  I+E AK  K   +    ++ L GK LAMIF+KPSTRTRVSFEVAM HLG
Sbjct: 12  LQDYTAEEIWTILETAKMFKIWQKIGKPHRLLEGKTLAMIFQKPSTRTRVSFEVAMAHLG 71

Query: 71  GDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTD 130
           G  ++L+  ++QL R ETI DTA+VLSRYVDAI+ R  +H  + +L +YATVPVIN L+D
Sbjct: 72  GHALYLNAQDLQLRRGETIADTARVLSRYVDAIMARVYDHKDVEDLAKYATVPVINGLSD 131

Query: 131 NTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEP 190
            +HPCQ +AD MT  E +G++KG    + GDGNN+ HSL+    +    + +ATP G EP
Sbjct: 132 FSHPCQALADYMTIWEKKGTIKGVKVVYVGDGNNVAHSLMIAGTKLGADVVVATPEGYEP 191

Query: 191 RNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH-VFQPFQ 245
             + + WA       G S  L HD V+AVK A  ++TD W SM QE +A E   +F+PFQ
Sbjct: 192 DEKVIKWAEQNAAESGGSFELLHDPVKAVKDADVIYTDVWASMGQEAEAEERRKIFRPFQ 251

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGI 305
           VN  L+  A PD +FMHCLPAHRGEEV ++V+D P SVV+D+AENRLH QKA+L    G 
Sbjct: 252 VNKDLVKHAKPDYMFMHCLPAHRGEEVTDDVIDSPNSVVWDQAENRLHAQKAVLALVMGG 311

Query: 306 I 306
           I
Sbjct: 312 I 312


>gi|18976966|ref|NP_578323.1| ornithine carbamoyltransferase [Pyrococcus furiosus DSM 3638]
 gi|20141649|sp|Q51742|OTC_PYRFU RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|40889330|pdb|1PVV|A Chain A, Refined Structure Of Pyrococcus Furiosus Ornithine
           Carbamoyltransferase At 1.87 A
 gi|18892590|gb|AAL80718.1| ornithine carbamoyltransferase [Pyrococcus furiosus DSM 3638]
          Length = 315

 Score =  312 bits (800), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 153/301 (50%), Positives = 201/301 (66%), Gaps = 5/301 (1%)

Query: 11  LSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLG 70
           L + ++  +  I+E AK  K   +    ++ L GK LAMIF+KPSTRTRVSFEVAM HLG
Sbjct: 13  LQDYTAEEIWTILETAKMFKIWQKIGKPHRLLEGKTLAMIFQKPSTRTRVSFEVAMAHLG 72

Query: 71  GDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTD 130
           G  ++L+  ++QL R ETI DTA+VLSRYVDAI+ R  +H  + +L +YATVPVIN L+D
Sbjct: 73  GHALYLNAQDLQLRRGETIADTARVLSRYVDAIMARVYDHKDVEDLAKYATVPVINGLSD 132

Query: 131 NTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEP 190
            +HPCQ +AD MT  E +G++KG    + GDGNN+ HSL+    +    + +ATP G EP
Sbjct: 133 FSHPCQALADYMTIWEKKGTIKGVKVVYVGDGNNVAHSLMIAGTKLGADVVVATPEGYEP 192

Query: 191 RNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH-VFQPFQ 245
             + + WA       G S  L HD V+AVK A  ++TD W SM QE +A E   +F+PFQ
Sbjct: 193 DEKVIKWAEQNAAESGGSFELLHDPVKAVKDADVIYTDVWASMGQEAEAEERRKIFRPFQ 252

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGI 305
           VN  L+  A PD +FMHCLPAHRGEEV ++V+D P SVV+D+AENRLH QKA+L    G 
Sbjct: 253 VNKDLVKHAKPDYMFMHCLPAHRGEEVTDDVIDSPNSVVWDQAENRLHAQKAVLALVMGG 312

Query: 306 I 306
           I
Sbjct: 313 I 313


>gi|149185384|ref|ZP_01863700.1| ornithine carbamoyltransferase [Erythrobacter sp. SD-21]
 gi|148830604|gb|EDL49039.1| ornithine carbamoyltransferase [Erythrobacter sp. SD-21]
          Length = 321

 Score =  312 bits (800), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 147/306 (48%), Positives = 203/306 (66%), Gaps = 5/306 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKP-----LSGKVLAMIFEKPSTRTRV 60
           ++  DLS+     ++ ++  A+  K +     + +P     L+G VL MIFEK STRTRV
Sbjct: 14  RNLLDLSDAGGDAIAAMLADAQDRKAARRGWPKGQPDSDAPLAGHVLGMIFEKNSTRTRV 73

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF++ M+ LGG  + L     QLGR E+I DTA+VLSR VDAI++RT +H++  EL  +A
Sbjct: 74  SFDMGMRQLGGSALILDSGTSQLGRGESIADTARVLSRMVDAIMIRTDDHAKAEELAHHA 133

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
            VPVIN LTD +HPCQI AD++T  EH  ++ G   +W GDGNN+LHS++E A  F + +
Sbjct: 134 HVPVINGLTDRSHPCQIAADLLTIVEHGKALPGLEVAWLGDGNNVLHSILEAAGIFKFNV 193

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            +  P G EP +E+++ AR  GA++ L  DA +A +GA  + TDTWISM Q+    +   
Sbjct: 194 RVGVPHGYEPESEFVDMARKGGATITLTRDAAEAARGADIIVTDTWISMGQDHAEAKLAA 253

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
            QPF+V+ +LM+ A PDA F+HCLPAH G+EV   V +  QS VFDEAENR+H QK+ILL
Sbjct: 254 MQPFRVDSALMAFAKPDAKFLHCLPAHVGDEVTGGVFESAQSAVFDEAENRIHAQKSILL 313

Query: 301 WCFGII 306
           WCFG I
Sbjct: 314 WCFGKI 319


>gi|167645197|ref|YP_001682860.1| ornithine carbamoyltransferase [Caulobacter sp. K31]
 gi|167347627|gb|ABZ70362.1| ornithine carbamoyltransferase [Caulobacter sp. K31]
          Length = 311

 Score =  312 bits (799), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 148/310 (47%), Positives = 201/310 (64%), Gaps = 5/310 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-----PLSGKVLAMIFEKPST 56
           MT P+HF DL  +  + L  I+E AK  K++ +   + K     P  G+VLAMIF+K ST
Sbjct: 1   MTTPRHFIDLWKLDGAALRVILEDAKARKSARKGWGQGKVDADAPAEGRVLAMIFQKNST 60

Query: 57  RTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLEL 116
           RTR SF+ A++ LGG  I  + ++MQLGR ETI DTAKVLSR VDA+++R  +H+ +   
Sbjct: 61  RTRFSFDAAIRQLGGAGIISTSNDMQLGRGETIEDTAKVLSRMVDAVMIRANSHADVERF 120

Query: 117 TEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARF 176
            + +TVPVIN LTD +HPCQI+AD++T EEHRG + GK  +W GDGNN+  S I  A   
Sbjct: 121 AQVSTVPVINGLTDKSHPCQIMADLLTIEEHRGDIGGKTIAWVGDGNNVCSSFIHAAPLL 180

Query: 177 NYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR 236
            + L IA P    P    L  A++    + L  D  +AV+GA  V  DTW+SM       
Sbjct: 181 GFTLKIACPAIYHPDLVDLARAQDLQGQITLTDDPREAVRGADVVVADTWVSMGDTDHDE 240

Query: 237 EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
                +P+QV+ +LM ++ PD +F+HCLPAHRGEEV + VLDGP+S+ +DEAENR+H QK
Sbjct: 241 RLAALEPYQVDDALMDLSKPDGVFLHCLPAHRGEEVTDSVLDGPRSLAWDEAENRIHAQK 300

Query: 297 AILLWCFGII 306
           ++L WCFG I
Sbjct: 301 SVLAWCFGAI 310


>gi|14521522|ref|NP_126998.1| ornithine carbamoyltransferase [Pyrococcus abyssi GE5]
 gi|6685709|sp|O93656|OTC_PYRAB RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|5458741|emb|CAB50228.1| argF ornithine carbamoyltransferase [Pyrococcus abyssi GE5]
          Length = 317

 Score =  312 bits (799), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 152/299 (50%), Positives = 200/299 (66%), Gaps = 5/299 (1%)

Query: 11  LSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLG 70
           L + +   +  I+E AK +K   +    ++ L GK LAMIF+KPSTRTRVSFEVAM HLG
Sbjct: 13  LQDYTPEEIWTILETAKMLKIWQKIGKPHRLLEGKTLAMIFQKPSTRTRVSFEVAMAHLG 72

Query: 71  GDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTD 130
           G  ++L+  ++QL R ETI DTA+VLSRYVDAI+ R  +H  + +L +YA+VPVIN L+D
Sbjct: 73  GHALYLNAQDLQLRRGETIADTARVLSRYVDAIMARVYDHKDVEDLAKYASVPVINGLSD 132

Query: 131 NTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEP 190
            +HPCQ +AD MT  E +G++KG    + GDGNN+ HSL+    +    + +ATP G EP
Sbjct: 133 FSHPCQALADYMTIWEKKGTIKGVKVVYVGDGNNVAHSLMIAGTKLGADVVVATPEGYEP 192

Query: 191 RNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH-VFQPFQ 245
             + + WA       G S  L HD V+AVK A  ++TD W SM QE +A E   +F+PFQ
Sbjct: 193 DEKVIKWAEQNAAESGGSFELLHDPVKAVKDADVIYTDVWASMGQEAEAEERRKIFRPFQ 252

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           VN  L+  A PD +FMHCLPAHRGEEV ++V+D P SVV+DEAENRLH QKA+L    G
Sbjct: 253 VNKDLVKHAKPDYMFMHCLPAHRGEEVTDDVIDSPNSVVWDEAENRLHAQKAVLALLLG 311


>gi|3341473|emb|CAA73260.1| ornithine carbamoyltransferase [Pyrococcus furiosus DSM 3638]
          Length = 315

 Score =  312 bits (799), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 153/301 (50%), Positives = 201/301 (66%), Gaps = 5/301 (1%)

Query: 11  LSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLG 70
           L + ++  +  I+E AK  K   +    ++ L GK LAMIF+KPSTRTRVSFEVAM HLG
Sbjct: 13  LQDYTAEEIWTILETAKMFKIWQKIGKPHRLLEGKTLAMIFQKPSTRTRVSFEVAMAHLG 72

Query: 71  GDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTD 130
           G  ++L+  ++QL R ETI DTA+VLSRYVDAI+ R  +H  + +L +YATVPVIN L+D
Sbjct: 73  GHALYLNAQDLQLRRGETIADTARVLSRYVDAIMARVYDHKDVEDLAKYATVPVINGLSD 132

Query: 131 NTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEP 190
            +HPCQ +AD MT  E +G++KG    + GDGNN+ HSL+    +    + +ATP G EP
Sbjct: 133 FSHPCQALADYMTIWEKKGTIKGVKVVYVGDGNNVAHSLMIAGTKLGADVVVATPEGYEP 192

Query: 191 RNEYLNWARNQGA----SVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH-VFQPFQ 245
             + + WA    A    S  L HD V+AVK A  ++TD W SM QE +A E   +F+PFQ
Sbjct: 193 DEKVIKWAEQNAAERSGSFELLHDPVKAVKDADVIYTDVWASMGQEAEAEERRKIFRPFQ 252

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGI 305
           VN  L+  A PD +FMHCLPAHRGEEV ++V+D P SVV+D+AENRLH QKA+L    G 
Sbjct: 253 VNKDLVKHAKPDYMFMHCLPAHRGEEVTDDVIDSPNSVVWDQAENRLHAQKAVLALVMGG 312

Query: 306 I 306
           I
Sbjct: 313 I 313


>gi|1430923|emb|CAA67609.1| ornithine carbamoyltransferase [Pyrococcus furiosus]
          Length = 314

 Score =  312 bits (799), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 153/300 (51%), Positives = 201/300 (67%), Gaps = 4/300 (1%)

Query: 11  LSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLG 70
           L + ++  +  I+E AK  K   +    ++ L GK LAMIF+KPSTRTRVSFEVAM HLG
Sbjct: 13  LQDYTAEEIWTILETAKMFKIWQKIGKPHRLLEGKTLAMIFQKPSTRTRVSFEVAMAHLG 72

Query: 71  GDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTD 130
           G  ++L+  ++QL R ETI DTA+VLSRYVDAI+ R  +H  + +L +YATVPVIN L+D
Sbjct: 73  GHALYLNAQDLQLRRGETIADTARVLSRYVDAIMARVYDHKDVEDLAKYATVPVINGLSD 132

Query: 131 NTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEP 190
            +HPCQ +AD MT  E +G++KG    + GDGNN+ HSL+    +    + +ATP G EP
Sbjct: 133 FSHPCQALADYMTIWEKKGTIKGVKVVYVGDGNNVAHSLMIAGTKLGADVVVATPEGYEP 192

Query: 191 RNEYLNWARNQGA---SVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH-VFQPFQV 246
             + + WA    A   S  L HD V+AVK A  ++TD W SM QE +A E   +F+PFQV
Sbjct: 193 DEKVIKWAEQNAAESGSFELLHDPVKAVKDADVIYTDVWASMGQEAEAEERRKIFRPFQV 252

Query: 247 NLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGII 306
           N  L+  A PD +FMHCLPAHRGEEV ++V+D P SVV+D+AENRLH QKA+L    G I
Sbjct: 253 NKDLVKHAKPDYMFMHCLPAHRGEEVTDDVIDSPNSVVWDQAENRLHAQKAVLALVMGGI 312


>gi|87201152|ref|YP_498409.1| ornithine carbamoyltransferase [Novosphingobium aromaticivorans DSM
           12444]
 gi|123488054|sp|Q2G3J8|OTC_NOVAD RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|87136833|gb|ABD27575.1| ornithine carbamoyltransferase [Novosphingobium aromaticivorans DSM
           12444]
          Length = 311

 Score =  311 bits (798), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 149/306 (48%), Positives = 204/306 (66%), Gaps = 5/306 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-----PLSGKVLAMIFEKPSTRTRV 60
           KHF +L++     ++ ++  A   K++     + K     PL G+VLAM+FEK STRTRV
Sbjct: 6   KHFLNLTDAGGDAIAAMLNDALDRKSARAGQPKGKADADAPLGGRVLAMVFEKNSTRTRV 65

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF++AM+ LGG  + L     QLGR ETI DTA+VLSR  DAI++RT +H+++ EL  +A
Sbjct: 66  SFDIAMRQLGGSALILDAGTTQLGRGETIADTARVLSRMADAIMLRTDDHAKVEELARHA 125

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVIN LTD +HPCQI+AD++T  EH  ++ G   +W GDGNN+L+S++E A    + +
Sbjct: 126 TVPVINGLTDLSHPCQIMADLLTVIEHGKALPGLEVAWLGDGNNVLNSIVEAAGLMKFNV 185

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            I  P G E     +  A   GA + +  D V+AV+GA  V TDTWISM Q     +   
Sbjct: 186 RIGVPEGYESDAGMIEAAVLAGAGIRVIRDPVEAVRGADVVVTDTWISMGQAHAEAKLAA 245

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
             P+QVN +LM+ A PDA+F+HCLPAHRGEEV + V+DGP+SVV+DEAENR+H QK++L 
Sbjct: 246 MAPYQVNDALMAHAKPDAVFLHCLPAHRGEEVTDAVIDGPRSVVWDEAENRIHAQKSVLR 305

Query: 301 WCFGII 306
           W FG I
Sbjct: 306 WVFGQI 311


>gi|329847860|ref|ZP_08262888.1| ornithine carbamoyltransferase [Asticcacaulis biprosthecum C19]
 gi|328842923|gb|EGF92492.1| ornithine carbamoyltransferase [Asticcacaulis biprosthecum C19]
          Length = 312

 Score =  311 bits (798), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 148/304 (48%), Positives = 202/304 (66%), Gaps = 5/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSEN-----IFENKPLSGKVLAMIFEKPSTRTRV 60
           +HF D+ ++ +  L  I++ A + K + +      +  + P   +VLAMIFEK STRTR 
Sbjct: 3   RHFLDICDLDAVTLRAIVDDAHRRKAARKGWTQGRVDADAPAKERVLAMIFEKNSTRTRF 62

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF+ A++ LGG  I  + S+MQLGR E I DT+KVLSR VDAI++R   H  +L L   +
Sbjct: 63  SFDAAIRQLGGSAIISTASDMQLGRGEPIEDTSKVLSRMVDAIMIRANRHEDVLRLAAVS 122

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           T+PV+N LT+ +HPCQI+ADI T EEHRG + GK+ +W  DGNN+ +SLI  AARF++ L
Sbjct: 123 TIPVVNGLTNLSHPCQILADIQTIEEHRGPIAGKVLAWVSDGNNVCNSLIHAAARFDFEL 182

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            IA P   +P  + + +A   GA V +  D   AV+GA  V  DTW+SM           
Sbjct: 183 RIACPDDYKPSMDAMVFAAQHGAKVTVGSDPRAAVEGADVVLADTWVSMGDLDHDERLMA 242

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F  +QV+  LM++A  DA+F+HCLPAHRGEEV +EV+DGPQS+++DEAENR+H QKAIL 
Sbjct: 243 FHEYQVDSKLMALAKKDAVFLHCLPAHRGEEVSDEVIDGPQSLIWDEAENRIHAQKAILA 302

Query: 301 WCFG 304
           WCFG
Sbjct: 303 WCFG 306


>gi|332159010|ref|YP_004424289.1| ornithine carbamoyltransferase [Pyrococcus sp. NA2]
 gi|331034473|gb|AEC52285.1| ornithine carbamoyltransferase [Pyrococcus sp. NA2]
          Length = 317

 Score =  311 bits (797), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 153/301 (50%), Positives = 201/301 (66%), Gaps = 5/301 (1%)

Query: 11  LSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLG 70
           L + +   +  I+E AK +K   +    ++ L GK LAMIF+KPSTRTRVSFEVAM HLG
Sbjct: 13  LQDYTPEEIWTILETAKMLKIWQKIGKPHRLLEGKTLAMIFQKPSTRTRVSFEVAMAHLG 72

Query: 71  GDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTD 130
           G  ++L+  ++QL R ETI DTA+VLSRYVDAI+ R   H  + +L +YA+VPVIN L+D
Sbjct: 73  GHALYLNAQDLQLRRGETIADTARVLSRYVDAIMARVYAHKDVEDLAKYASVPVINGLSD 132

Query: 131 NTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEP 190
            +HPCQ +AD MT  E +G++KG    + GDGNN+ HSL+    +    + +ATP G EP
Sbjct: 133 FSHPCQALADYMTIWEKKGTIKGVKVVYVGDGNNVCHSLMIAGTKLGADVIVATPEGYEP 192

Query: 191 RNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH-VFQPFQ 245
             + + WA       G S  L HD V+AVK A  ++TD W SM QE +A E   VF+PFQ
Sbjct: 193 DEKVIKWAEQNAAESGGSFELLHDPVKAVKDADVIYTDVWASMGQEAEAEERRKVFRPFQ 252

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGI 305
           VN  L+  A PD +FMHCLPAHRGEEV ++V+D P SVV+D+AENRLH QKA+L+   G 
Sbjct: 253 VNKDLVKHAKPDYMFMHCLPAHRGEEVTDDVIDSPNSVVWDQAENRLHAQKAVLVLLLGG 312

Query: 306 I 306
           I
Sbjct: 313 I 313


>gi|83954535|ref|ZP_00963246.1| ornithine carbamoyltransferase [Sulfitobacter sp. NAS-14.1]
 gi|83840819|gb|EAP79990.1| ornithine carbamoyltransferase [Sulfitobacter sp. NAS-14.1]
          Length = 301

 Score =  310 bits (795), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 156/309 (50%), Positives = 205/309 (66%), Gaps = 20/309 (6%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSEN-----IFENKPLSGKVLAMIFEKPSTRTRV 60
           KHF D+     ++L  II+ A  +K+S          + +PL   ++A+IFEKPSTRTRV
Sbjct: 2   KHFLDIHQTDPADLRSIIDNAATMKSSRLGRPRGAPDDEQPLKDHMVALIFEKPSTRTRV 61

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF+V ++ +GG T+ LSG++MQLG  ETI DTA+VLSRYVD I++RT   + LLE+ EYA
Sbjct: 62  SFDVGVRQMGGQTMVLSGADMQLGHGETIADTARVLSRYVDLIMIRTFEEATLLEMAEYA 121

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +VPVIN LT+ THPCQI+ADIMTFEEH G +KGK   WSGDGNN+  S    A  F++ L
Sbjct: 122 SVPVINGLTNRTHPCQIMADIMTFEEHSGPIKGKKVVWSGDGNNVFASFAHAAKAFDFEL 181

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALF---HDAVQAVKGAHCVFTDTWISMNQEFKARE 237
               P   +P          + A   L+    D  +AV+GA  V TDTW+SM+    ARE
Sbjct: 182 VFTGPQTLDP----------EAALNGLYTTERDPNKAVEGADLVVTDTWVSMHDPQSARE 231

Query: 238 E--HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
              +  + +QVN +LM+ A PDALFMHCLPAHR +EV + V+DGP SV+FDEAENRLH Q
Sbjct: 232 RRHNQLRGYQVNDALMAKAKPDALFMHCLPAHRDDEVTSSVMDGPSSVIFDEAENRLHAQ 291

Query: 296 KAILLWCFG 304
           K+++ WC G
Sbjct: 292 KSVMRWCLG 300


>gi|83943962|ref|ZP_00956419.1| ornithine carbamoyltransferase [Sulfitobacter sp. EE-36]
 gi|83845209|gb|EAP83089.1| ornithine carbamoyltransferase [Sulfitobacter sp. EE-36]
          Length = 301

 Score =  310 bits (795), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 156/309 (50%), Positives = 205/309 (66%), Gaps = 20/309 (6%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSEN-----IFENKPLSGKVLAMIFEKPSTRTRV 60
           KHF D+     ++L  II+ A  +K+S          + +PL   ++A+IFEKPSTRTRV
Sbjct: 2   KHFLDIHQTDPADLRSIIDNAATMKSSRLGRPRGAPDDEQPLKDHMVALIFEKPSTRTRV 61

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF+V ++ +GG T+ LSG++MQLG  ETI DTA+VLSRYVD I++RT   + LLE+ EYA
Sbjct: 62  SFDVGVRQMGGQTMVLSGADMQLGHGETIADTARVLSRYVDLIMIRTFEEATLLEMAEYA 121

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +VPVIN LT+ THPCQI+ADIMTFEEH G +KGK   WSGDGNN+  S    A  F++ L
Sbjct: 122 SVPVINGLTNRTHPCQIMADIMTFEEHSGPIKGKKVVWSGDGNNVFASFAHAAKAFDFEL 181

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALF---HDAVQAVKGAHCVFTDTWISMNQEFKARE 237
               P   +P          + A   L+    D  +AV+GA  V TDTW+SM+    ARE
Sbjct: 182 VFTGPQTLDP----------EAALNGLYTTVRDPNKAVEGADLVVTDTWVSMHDPQSARE 231

Query: 238 E--HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
              +  + +QVN +LM+ A PDALFMHCLPAHR +EV + V+DGP SV+FDEAENRLH Q
Sbjct: 232 RRHNQLRGYQVNDALMAKAKPDALFMHCLPAHRDDEVTSSVMDGPSSVIFDEAENRLHAQ 291

Query: 296 KAILLWCFG 304
           K+++ WC G
Sbjct: 292 KSVMRWCLG 300


>gi|307293822|ref|ZP_07573666.1| ornithine carbamoyltransferase [Sphingobium chlorophenolicum L-1]
 gi|306879973|gb|EFN11190.1| ornithine carbamoyltransferase [Sphingobium chlorophenolicum L-1]
          Length = 309

 Score =  310 bits (795), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 145/303 (47%), Positives = 202/303 (66%), Gaps = 5/303 (1%)

Query: 7   HFADLSNISSSNLSCII-----EVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           HF +LS+     ++ +I       A ++         + PL+G  LAMIFEK STRTRVS
Sbjct: 4   HFLNLSDAGGDAIAAMISDAIDRKAARLGQPKGRADADAPLAGHTLAMIFEKNSTRTRVS 63

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F++A++ LGG ++ L G+  QLGR ETI DTA+VLSR  DAI++RT +H+++ E+  +AT
Sbjct: 64  FDMAIRQLGGTSLILDGATSQLGRGETIADTARVLSRMADAIMIRTDDHAKIEEMAHHAT 123

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD +HPCQI+AD++T  EH  ++ G  ++W GDGNN+LHS++E A    + + 
Sbjct: 124 VPVINGLTDLSHPCQIVADLLTVVEHGVALPGSQWAWLGDGNNVLHSIVEAAGLMKFGVR 183

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           IA P G +P   +   A+ +GA++    D + AV GA  V TDTWISM Q     +    
Sbjct: 184 IAVPEGYDPDPSFEAEAQARGATITRTRDPLAAVTGADIVVTDTWISMGQAHAEEKLAAM 243

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
            P+QV   LM++A P A F+HCLPAHRGEEV+  V+DGPQSV++DEAENR+H QK++LLW
Sbjct: 244 MPYQVTPELMALAKPTAKFLHCLPAHRGEEVVEAVIDGPQSVIWDEAENRIHAQKSVLLW 303

Query: 302 CFG 304
             G
Sbjct: 304 ALG 306


>gi|329890975|ref|ZP_08269318.1| ornithine carbamoyltransferase [Brevundimonas diminuta ATCC 11568]
 gi|328846276|gb|EGF95840.1| ornithine carbamoyltransferase [Brevundimonas diminuta ATCC 11568]
          Length = 305

 Score =  310 bits (794), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 148/305 (48%), Positives = 208/305 (68%), Gaps = 10/305 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-----PLSGKVLAMIFEKPSTRTRV 60
           +HF D+  + +++L  I++ A   K + +   + +     P   +VLAMIFEK STRTR 
Sbjct: 3   RHFLDIHRLDAADLRAILDDAHARKRARKGWPQGRADADAPGKDRVLAMIFEKNSTRTRF 62

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF+ A++ LGGD+I  + ++MQLGR E + DTA+VLSR VDA+++R  +H  +      +
Sbjct: 63  SFDAAIRQLGGDSIIATAADMQLGRGEPVEDTARVLSRMVDAVMIRANDHEDVERFARVS 122

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPV+N LTD +HPCQI+AD+MT EEHRG ++GK  +W GDGNN+ HS +  A +F + L
Sbjct: 123 TVPVVNGLTDRSHPCQILADLMTIEEHRGPIEGKTIAWIGDGNNVCHSFMHAAPKFGFHL 182

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREEH 239
           ++A P    P    L      GA V L  D  +AVKGA  V TDTW+SM +Q+++AR   
Sbjct: 183 HVACPAEYHPDLRDLE---KGGAHVHLTSDPREAVKGADVVVTDTWVSMGDQDYEARLA- 238

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+P+ V+ +LM+ A  DA+F+HCLPAHRGEEV + V+DGPQS+++DEAENRLH QKA+L
Sbjct: 239 AFEPYGVDEALMAEAADDAVFLHCLPAHRGEEVTDAVIDGPQSLIWDEAENRLHAQKAVL 298

Query: 300 LWCFG 304
            WCFG
Sbjct: 299 AWCFG 303


>gi|294013051|ref|YP_003546511.1| ornithine carbamoyltransferase [Sphingobium japonicum UT26S]
 gi|292676381|dbj|BAI97899.1| ornithine carbamoyltransferase [Sphingobium japonicum UT26S]
          Length = 309

 Score =  310 bits (794), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 146/303 (48%), Positives = 204/303 (67%), Gaps = 5/303 (1%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-----PLSGKVLAMIFEKPSTRTRVS 61
           HF +LS+     ++ +I  A   K + +   + +     PL+G  LAMIFEK STRTRVS
Sbjct: 4   HFLNLSDAGGDAIAAMISDAIDRKAARKGWPKGRADADAPLAGHTLAMIFEKNSTRTRVS 63

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F++A++ LGG ++ L G+  QLGR ETI DTA+VLSR  DAI++RT +H+++ E+  +AT
Sbjct: 64  FDMAIRQLGGTSLILDGATSQLGRGETIADTARVLSRMADAIMIRTDDHAKIEEMAHHAT 123

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD +HPCQI+AD++T  EH  ++ G  ++W GDGNN+LHS++E A    + + 
Sbjct: 124 VPVINGLTDLSHPCQIVADLLTVVEHGVALPGSQWAWLGDGNNVLHSIVEAAGLMKFGVR 183

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           IA P G +P   +   A+ +GA++    D + AV GA  V TDTWISM Q     +    
Sbjct: 184 IAVPEGYDPDPSFEAEAQARGATITRTRDPLAAVAGADIVVTDTWISMGQAHAEEKLAAM 243

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
            P+QV   LM++A P A F+HCLPAHRGEEV+  V+DGPQSV++DEAENR+H QK++LLW
Sbjct: 244 MPYQVTPELMALAKPTAKFLHCLPAHRGEEVVEAVIDGPQSVIWDEAENRIHAQKSVLLW 303

Query: 302 CFG 304
             G
Sbjct: 304 ALG 306


>gi|254485891|ref|ZP_05099096.1| ornithine carbamoyltransferase [Roseobacter sp. GAI101]
 gi|214042760|gb|EEB83398.1| ornithine carbamoyltransferase [Roseobacter sp. GAI101]
          Length = 301

 Score =  310 bits (794), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 155/305 (50%), Positives = 204/305 (66%), Gaps = 14/305 (4%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSEN-----IFENKPLSGKVLAMIFEKPSTRTRVS 61
           HF D+     ++L  II+ A  +K+S +        + +PL   ++A+IFEKPSTRTRVS
Sbjct: 3   HFLDIHQTDPADLRHIIDRAAAMKSSRQGRPRGAPDDEQPLKDHMVALIFEKPSTRTRVS 62

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG T+ LSG++MQLG  ETI DTA+VLSRYVD I++RT   + LLE+ EYA+
Sbjct: 63  FDVGVRQMGGQTMVLSGADMQLGHGETIADTARVLSRYVDLIMIRTFEEATLLEMAEYAS 122

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LT+ THPCQI+ADIMTFEEH G +KGK   WSGDGNN+  S    A  F++ L 
Sbjct: 123 VPVINGLTNRTHPCQIMADIMTFEEHSGPIKGKKVVWSGDGNNVFASFAHAAKSFDFELV 182

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE--H 239
              P   +P    LN          +  D  +AV+GA  V TDTW+SM+    ARE   +
Sbjct: 183 FTGPPTLDP-EPALN------GLYTVERDPNKAVEGADLVVTDTWVSMHDPQSARERRHN 235

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             + +QVN +LM+ A PDALFMHCLPAHR +EV + V+DGP SV+FDEAENRLH QK+++
Sbjct: 236 QLRGYQVNDALMAKAKPDALFMHCLPAHRDDEVTSSVMDGPHSVIFDEAENRLHAQKSVM 295

Query: 300 LWCFG 304
            WC G
Sbjct: 296 RWCLG 300


>gi|330994135|ref|ZP_08318063.1| Ornithine carbamoyltransferase [Gluconacetobacter sp. SXCC-1]
 gi|329758602|gb|EGG75118.1| Ornithine carbamoyltransferase [Gluconacetobacter sp. SXCC-1]
          Length = 328

 Score =  310 bits (793), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 161/303 (53%), Positives = 207/303 (68%), Gaps = 4/303 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIK----NSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           P+HF DL  +  + L  I++VA  IK      +  +    PL G+ L ++  KPSTRTRV
Sbjct: 12  PRHFLDLKELDRATLRAILDVAAGIKRMQHGRTRPLHPALPLRGRALGLMLSKPSTRTRV 71

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFEV M+ LGG+ I L+ S+MQLGR E+I DTA+VLSR+VDAIV+RT     L +L  ++
Sbjct: 72  SFEVGMQQLGGNVILLAPSDMQLGRGESIADTARVLSRFVDAIVLRTGKTENLRQLARWS 131

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +VPVIN LT ++HP QI+ADIMTFEEHRG + G+  +W GDGNN+  S IE AA F + L
Sbjct: 132 SVPVINGLTPDSHPVQILADIMTFEEHRGPIAGRTLAWVGDGNNVATSFIEAAALFGFHL 191

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            +ATP    P    + WAR QGA + +  D V AVKGAH V TDTW+SM+    A+    
Sbjct: 192 RLATPAAHAPSAAAVAWARAQGADITVTTDPVAAVKGAHAVITDTWVSMSDTESAQRVSA 251

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+P++VN +LM+ A  DALF+HCLPAH GEEV  +V +GPQSVVFDEAENRLH QK IL+
Sbjct: 252 FEPYRVNAALMAHAAADALFLHCLPAHIGEEVTEDVFEGPQSVVFDEAENRLHAQKGILV 311

Query: 301 WCF 303
           W  
Sbjct: 312 WAL 314


>gi|85375611|ref|YP_459673.1| ornithine carbamoyltransferase [Erythrobacter litoralis HTCC2594]
 gi|84788694|gb|ABC64876.1| ornithine carbamoyltransferase [Erythrobacter litoralis HTCC2594]
          Length = 314

 Score =  309 bits (791), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 153/304 (50%), Positives = 204/304 (67%), Gaps = 5/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKP-----LSGKVLAMIFEKPSTRTRV 60
           +HF DLS+     ++ +I  A+  K +     + +P     L   VLAMIFEK STRTRV
Sbjct: 8   RHFLDLSDAGGDAIAAMINDAQDRKAARTAWPKGRPDPDAPLKDHVLAMIFEKSSTRTRV 67

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF++AM+ LGG  + +    MQLGR E+I DTA+VLSR VDAI++RT +H ++ EL  +A
Sbjct: 68  SFDMAMRQLGGSAMVMESGSMQLGRGESIADTARVLSRMVDAIMIRTDDHGKIEELAHHA 127

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVIN LTD +HPCQI+AD++T  E+  ++ G   +W GDGNN+LHS++E A    + +
Sbjct: 128 TVPVINGLTDRSHPCQIVADLLTVIENGKALPGLEIAWLGDGNNVLHSILEAAGLMKFNV 187

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            + TP G EP  E++  AR  GA V+L  DA +A +GA  V TDTW+SM QE  A +   
Sbjct: 188 RVGTPKGYEPDGEFVELARAGGAQVSLAADAAEAARGADVVITDTWVSMGQEHAATKLEA 247

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
             PFQV+  LM  A PDA+F+HCLPAH GEEV   V++GPQS VFDEAENR+H QK++LL
Sbjct: 248 MAPFQVDDRLMDQAKPDAIFLHCLPAHVGEEVAESVIEGPQSRVFDEAENRIHAQKSVLL 307

Query: 301 WCFG 304
           W  G
Sbjct: 308 WALG 311


>gi|254451074|ref|ZP_05064511.1| ornithine carbamoyltransferase [Octadecabacter antarcticus 238]
 gi|198265480|gb|EDY89750.1| ornithine carbamoyltransferase [Octadecabacter antarcticus 238]
          Length = 301

 Score =  308 bits (789), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 152/308 (49%), Positives = 205/308 (66%), Gaps = 20/308 (6%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFE-----NKPLSGKVLAMIFEKPSTRTRVS 61
           HF D+   S ++L  II++A  +K +   + +     ++PL+  ++A+IFEKPSTRTR+S
Sbjct: 3   HFLDIHTTSPADLRGIIDMAASMKTARAGLPKGTPDADQPLANHMVALIFEKPSTRTRIS 62

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG+T+ LSG +MQLG  ETI DTA+VLSRYVD I++RT     LLE+ EYA+
Sbjct: 63  FDVGVRQMGGETMVLSGKDMQLGHGETIADTARVLSRYVDLIMIRTFEEQTLLEMAEYAS 122

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD THPCQI+ADI+TFEEH G +KGK   WSGDGNN+  S    A +F++ L 
Sbjct: 123 VPVINGLTDRTHPCQIMADILTFEEHSGPIKGKKVVWSGDGNNVFASFAHAAKQFDFDLV 182

Query: 182 IATPIGSEPR---NEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE 238
              P   +P    +      RN             AV+GA  V TDTW+SM+    ARE 
Sbjct: 183 FTGPETLQPEAALDGLYTTERNPDI----------AVQGADLVVTDTWVSMHDPQSARER 232

Query: 239 --HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
             +  + +QVN  LM+ A PDALFMHCLPAHR +E  +EV+DGP+SV++DEAENR+H QK
Sbjct: 233 RHNQLRGYQVNAGLMAKAKPDALFMHCLPAHRDDEATSEVMDGPRSVIWDEAENRMHAQK 292

Query: 297 AILLWCFG 304
           A+L +C G
Sbjct: 293 AVLRYCLG 300


>gi|198282709|ref|YP_002219030.1| ornithine carbamoyltransferase [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218667835|ref|YP_002424901.1| ornithine carbamoyltransferase [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|198247230|gb|ACH82823.1| ornithine carbamoyltransferase [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218520048|gb|ACK80634.1| ornithine carbamoyltransferase [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 311

 Score =  307 bits (787), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 152/302 (50%), Positives = 204/302 (67%), Gaps = 5/302 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  LS++S S L  +++ A  +K    +     P +G+ LAMIFEK STRTRVSFE  
Sbjct: 4   RHFLRLSDLSPSELRALLQRAIALKKIQRDGERYAPCAGRTLAMIFEKSSTRTRVSFETG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLS  + QLGR E++ DTAKV+SR VD +++RT  H  LL     + VPVI
Sbjct: 64  MAQLGGHALFLSPRDTQLGRGESVEDTAKVISRMVDMVMIRTFGHDNLLRFAAASRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLNIAT 184
           N L+D+ HPCQ++AD+MT  EH G ++G+  ++ GDG NN+ HS +E A  F++ L I +
Sbjct: 124 NGLSDDHHPCQLLADLMTATEHWGDLRGRTVAYIGDGSNNMAHSWMEAAQVFDFRLRIGS 183

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQP 243
           P G  P    L   ++ G  V + HDAV AV+GA+ + TD W SM QE + A  + +  P
Sbjct: 184 PAGYVPSAGML---QSGGDQVTVLHDAVAAVRGANLIVTDVWTSMGQEEEAAARKAILAP 240

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           FQVN +LM+ A PDALFMHCLPAHRGEEV  EV+DGP+SVV++EAENRLH QKA++ + F
Sbjct: 241 FQVNATLMAAAAPDALFMHCLPAHRGEEVSAEVIDGPRSVVWEEAENRLHAQKALMEFLF 300

Query: 304 GI 305
           GI
Sbjct: 301 GI 302


>gi|226227907|ref|YP_002762013.1| ornithine carbamoyltransferase [Gemmatimonas aurantiaca T-27]
 gi|226091098|dbj|BAH39543.1| ornithine carbamoyltransferase [Gemmatimonas aurantiaca T-27]
          Length = 303

 Score =  307 bits (786), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 148/300 (49%), Positives = 205/300 (68%), Gaps = 4/300 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F ++++ SS     ++++A++++  +   ++ KPL+GK LAMIF K STRTR+SFEV 
Sbjct: 3   RDFLNIADFSSDETFALLDLAERMRTGA---YQAKPLTGKALAMIFMKSSTRTRMSFEVG 59

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
              LGG   FLS  ++Q+GR E I DTA+VLSRYV  I++RT  H  ++EL EYA+VP+I
Sbjct: 60  ANQLGGTAHFLSPRDVQIGRGEPIADTARVLSRYVQGIMIRTFAHQDVVELAEYASVPII 119

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD +HPCQI+AD++T ++H G V+GK  +W GDGNN+ +S +E AA   + L +A P
Sbjct: 120 NGLTDLSHPCQILADVLTMQQHLGGVRGKTVAWIGDGNNMANSWMEAAAHLGFTLRLACP 179

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV-FQPF 244
            G +P  ++L  A+ +G  V L  D  +AV GA  V TD W SM QE +  +  V F  +
Sbjct: 180 EGYDPDAQFLADAKARGGDVQLLRDPREAVAGADVVTTDVWASMGQEEEQSKRAVAFALY 239

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QV+  LM+ A   A+F+HCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKAI+    G
Sbjct: 240 QVDAELMARAAAHAVFLHCLPAHRGEEVTAEVIDGPQSVVWDEAENRLHVQKAIMAVLMG 299


>gi|254421074|ref|ZP_05034798.1| ornithine carbamoyltransferase [Brevundimonas sp. BAL3]
 gi|196187251|gb|EDX82227.1| ornithine carbamoyltransferase [Brevundimonas sp. BAL3]
          Length = 304

 Score =  307 bits (786), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 148/304 (48%), Positives = 205/304 (67%), Gaps = 10/304 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-----KVLAMIFEKPSTRTRV 60
           +HF D+  + +++L  I++ A   K + +   + +P +      +VLAMIFEK STRTR 
Sbjct: 3   RHFLDIHQLDAADLRSILDDAHARKAARKGWPQGRPDADAPGKDRVLAMIFEKNSTRTRF 62

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF+ A++ LGG  I  + S+MQLGR E + DTA+VLSR VDA+++R  +H  +      +
Sbjct: 63  SFDAAIRQLGGAAIIATASDMQLGRGEPVEDTARVLSRMVDAVMIRANSHEDVERFARVS 122

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVIN LTD +HPCQI+AD+ T EEH G V GK  +W GDGNN+ HS +  A RF + L
Sbjct: 123 TVPVINGLTDRSHPCQILADLQTIEEHSGPVSGKTIAWIGDGNNVCHSFMHAAPRFGFHL 182

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREEH 239
           N+A P    P    L    N G +V L  D  +AVKGA  V TDTW+SM +Q+++AR   
Sbjct: 183 NVACPAAYHPDLRDLA---NGGGAVTLTSDPREAVKGADVVVTDTWVSMGDQDYEARLA- 238

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ + V+ +LM++A PDA+F+HCLPAHRGEEV + V+DGP+S+V+DEAENR+H QKA+L
Sbjct: 239 AFEDYTVDEALMALADPDAVFLHCLPAHRGEEVTDAVIDGPRSLVWDEAENRIHAQKAVL 298

Query: 300 LWCF 303
            WCF
Sbjct: 299 AWCF 302


>gi|84514441|ref|ZP_01001805.1| ornithine carbamoyltransferase [Loktanella vestfoldensis SKA53]
 gi|84511492|gb|EAQ07945.1| ornithine carbamoyltransferase [Loktanella vestfoldensis SKA53]
          Length = 301

 Score =  306 bits (785), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 151/305 (49%), Positives = 206/305 (67%), Gaps = 14/305 (4%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFEN-----KPLSGKVLAMIFEKPSTRTRVS 61
           HF D+    + +LS II  A+++K++ + + +      +PL+G+++A+IFEKPSTRTRVS
Sbjct: 3   HFLDIHVTPADDLSAIIANARRMKDARDGLPKGTPDAEQPLAGQMVALIFEKPSTRTRVS 62

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG T+ LSG++MQLG  ETI DTA+VLSRYVD I++RT     LL++ EYA+
Sbjct: 63  FDVGVRQMGGQTMVLSGTDMQLGHGETIADTARVLSRYVDLIMIRTFEEQTLLDMAEYAS 122

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LT+ THPCQI+ADIMTFEEH G +KGK   WSGDGNN+  S    A +F++ L 
Sbjct: 123 VPVINGLTNRTHPCQIMADIMTFEEHNGPIKGKKVVWSGDGNNVFASFAHAAKQFDFDLV 182

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE--H 239
                        L+          +  +  +AV+GA  V TDTW+SM+    ARE   +
Sbjct: 183 FTG-------PPPLDPDPALDGLYTIMRNPNEAVQGADLVVTDTWVSMHDPQSARERRHN 235

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             + +QVN +LM+ A PDALFMHCLPAHR +E  + V+DGP SV+FDEAENRLH QKAI+
Sbjct: 236 QLRGYQVNDALMAKAKPDALFMHCLPAHREDEATSSVMDGPHSVIFDEAENRLHAQKAIM 295

Query: 300 LWCFG 304
            +C G
Sbjct: 296 RYCLG 300


>gi|153876535|ref|ZP_02003805.1| ornithine carbamoyltransferase [Beggiatoa sp. PS]
 gi|152067001|gb|EDN66195.1| ornithine carbamoyltransferase [Beggiatoa sp. PS]
          Length = 303

 Score =  306 bits (785), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 155/302 (51%), Positives = 199/302 (65%), Gaps = 4/302 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           P+HF  L ++S   L  +I  A ++K         +P   KVLAMIFEK STRTRVSFE 
Sbjct: 3   PRHFLTLLDLSQDELQALIARAIELKAMQYANICYEPFKKKVLAMIFEKSSTRTRVSFET 62

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           AM   GG  IFLS  + QLGR E I DTA+VLS  V++I++RT  H ++    +Y+ VPV
Sbjct: 63  AMVQCGGSAIFLSPRDTQLGRGEPIEDTARVLSSMVNSIMVRTYEHKKIELFAKYSKVPV 122

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALTD  HPCQ++ADI T+ EHRGS++GK  +W GDGNN+ HS ++ A +F++ L +A 
Sbjct: 123 INALTDRHHPCQLLADIQTYVEHRGSIQGKKVAWIGDGNNMCHSYMQAAHQFDFELAVAC 182

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQP 243
           P   +P  E +         V L  D  QAV GA  V TD W SM QE +  +   VF+P
Sbjct: 183 PPNYQPDAELVAQFDKH---VNLITDPRQAVAGADLVSTDVWASMGQEEEQNQRLQVFEP 239

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +QVN  LMS+  PDALFMHCLPAHRGEEV  EV+DGPQSVV+D+AENRLH+QKA+L +  
Sbjct: 240 YQVNTQLMSLTKPDALFMHCLPAHRGEEVSAEVIDGPQSVVWDQAENRLHSQKALLEFLL 299

Query: 304 GI 305
            +
Sbjct: 300 SV 301


>gi|292492306|ref|YP_003527745.1| ornithine carbamoyltransferase [Nitrosococcus halophilus Nc4]
 gi|291580901|gb|ADE15358.1| ornithine carbamoyltransferase [Nitrosococcus halophilus Nc4]
          Length = 304

 Score =  306 bits (784), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 154/295 (52%), Positives = 191/295 (64%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++ +  L  ++  A  +K         +PL  KVL M+FEK STRTRVSFE  
Sbjct: 4   QHFLTLLDLPADELRQLVLRAMDLKTLQRQGKIYEPLKNKVLGMLFEKSSTRTRVSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I DTA+VLSR VD +++RT +HS L     Y+ VPVI
Sbjct: 64  MAQLGGSAIFLSPQDTQLGRGEPIEDTARVLSRMVDCLMVRTFSHSMLERFAAYSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD  HPCQ++ADI T+ EHRG ++G+  +W GDGNN+  S I  A +F++ L IATP
Sbjct: 124 NALTDGYHPCQLLADIQTYLEHRGGIQGRTIAWIGDGNNMCQSYINAACQFDFQLRIATP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREEHVFQPF 244
           +G EP    L  A   G    +  D  +A KGA  V TD W SM QE  K R    F  +
Sbjct: 184 VGYEPDPTILQTA---GERAQIMIDPREAAKGADLVVTDVWTSMGQEKEKLRRLQDFADY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           Q+N  LM++A  DALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA+L
Sbjct: 241 QINSKLMALAQEDALFMHCLPAHRGEEVTAEVIDGPQSVVWDEAENRLHAQKALL 295


>gi|262277634|ref|ZP_06055427.1| ornithine carbamoyltransferase [alpha proteobacterium HIMB114]
 gi|262224737|gb|EEY75196.1| ornithine carbamoyltransferase [alpha proteobacterium HIMB114]
          Length = 308

 Score =  306 bits (783), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 147/305 (48%), Positives = 214/305 (70%), Gaps = 7/305 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKK--IKNSSE-NIFENKPLSGK--VLAMIFEKPSTRTRV 60
           KHF DLS I  S+L  I+  AKK   K S E  +  ++P +GK  +L M+FEKPSTRTR+
Sbjct: 2   KHFLDLSLIPKSDLHHILSEAKKRKAKQSKEGKVVVSEPSNGKDKLLLMVFEKPSTRTRL 61

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAE-TIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           SF++AM+ LGG+TI ++ ++M LG+ E ++ DTAKV+S + D ++ RT  H  L++L++ 
Sbjct: 62  SFDLAMRQLGGETIVMNANDMHLGKGEESVQDTAKVISGFSDIVMFRTFEHQTLIDLSKL 121

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
            TVP+IN LT+++HPCQ+++D+MTFEE +GS+KG   +W GDGNN+ +S IE A +F++ 
Sbjct: 122 LTVPLINGLTNSSHPCQLLSDVMTFEEQKGSIKGAKVAWVGDGNNVTNSAIEAAVQFDFE 181

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREE 238
           LNI       P  + L+WA NQG  + LFHDA + V GA C+ +D W+SM +Q    +++
Sbjct: 182 LNICVSKNYLPSKKVLDWAENQGGKINLFHDAKKGVAGADCIMSDKWVSMGDQGDTKKKK 241

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
              + FQVN  LMS+A PD++++H LPA R EEV + V+DG QS+V+ +AENRLH QKAI
Sbjct: 242 SDLKQFQVNDELMSLAKPDSIYLHVLPAAREEEVTSSVIDGKQSLVWQQAENRLHGQKAI 301

Query: 299 LLWCF 303
           + WC 
Sbjct: 302 IDWCL 306


>gi|14590603|ref|NP_142671.1| ornithine carbamoyltransferase [Pyrococcus horikoshii OT3]
 gi|6647686|sp|O58457|OTC_PYRHO RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|3257134|dbj|BAA29817.1| 317aa long hypothetical ornithine carbamoyltransferase [Pyrococcus
           horikoshii OT3]
          Length = 317

 Score =  306 bits (783), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 151/299 (50%), Positives = 197/299 (65%), Gaps = 5/299 (1%)

Query: 11  LSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLG 70
           L + +   +  I+E AK  K   +    ++ L GK LAMIF+KPSTRTRVSFEVAM HLG
Sbjct: 13  LQDYTPEEIWTILETAKMFKIWQKIGKPHRLLEGKTLAMIFQKPSTRTRVSFEVAMAHLG 72

Query: 71  GDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTD 130
           G  ++L+  ++QL R ETI DTA+VLSRYVDAI+ R   H  + +L +YA+VPVIN L+D
Sbjct: 73  GHALYLNAQDLQLRRGETIADTARVLSRYVDAIMARVYAHKDVEDLAKYASVPVINGLSD 132

Query: 131 NTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEP 190
            +HPCQ +AD MT  E +G++KG    + GDGNN+ HSL+    +    + +ATP G EP
Sbjct: 133 FSHPCQALADYMTIWEKKGTIKGVKVVYVGDGNNVCHSLMIAGTKLGADVVVATPEGYEP 192

Query: 191 RNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH-VFQPFQ 245
             + + WA       G S  L HD V+AVK A  ++TD W SM QE +A E   +F+PFQ
Sbjct: 193 DKKVIKWAEQNAAESGGSFELLHDPVKAVKDADVIYTDVWASMGQEAEAEERRKIFRPFQ 252

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           VN  L+  A  D +FMHCLPAHRGEEV ++V+D P SVV+DEAENRLH QKA+L    G
Sbjct: 253 VNKDLVKHAKSDYMFMHCLPAHRGEEVTDDVIDSPNSVVWDEAENRLHAQKAVLALLLG 311


>gi|53803891|ref|YP_114510.1| ornithine carbamoyltransferase [Methylococcus capsulatus str. Bath]
 gi|81681594|sp|Q606D8|OTC_METCA RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|53757652|gb|AAU91943.1| ornithine carbamoyltransferase [Methylococcus capsulatus str. Bath]
          Length = 298

 Score =  306 bits (783), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 155/296 (52%), Positives = 193/296 (65%), Gaps = 7/296 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           P+HF  L ++SS+    +I  A  +K   E     +PL  KVL M+FEK STRTRVSFEV
Sbjct: 3   PRHFVTLRDLSSAEFRALIARAIDLKARKEPY---EPLKNKVLGMVFEKSSTRTRVSFEV 59

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M   GG +IFLS  + QLGR E I D+A+VLSR VD I++RT  H  +    EY+ VPV
Sbjct: 60  GMAQFGGSSIFLSPRDTQLGRGEPIEDSARVLSRMVDCIMLRTHAHRTVEIFAEYSRVPV 119

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD  HPCQ++AD+ T+ EHRG + GK  +W GDGNN+  + +  A   ++ L IA 
Sbjct: 120 INGLTDRFHPCQLLADMQTYFEHRGDIAGKTVAWIGDGNNMCQTYVHAAGLLDFRLRIAC 179

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQP 243
           P G EP  E +  A   G  V + HD   AV GA  V TD W SM QE +  E    F+ 
Sbjct: 180 PPGYEPEAELVEAA---GKCVEVGHDVRTAVNGADLVVTDVWASMGQESEQTERTGAFRD 236

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           +QVN +LM++AH DALFMHCLPAHRGEEV  EVL+GPQSVV+DEAENRLH QKA+L
Sbjct: 237 YQVNAALMALAHADALFMHCLPAHRGEEVSAEVLEGPQSVVWDEAENRLHAQKALL 292


>gi|4185289|gb|AAD09004.1| ornithine carbamoyltransferase [Pyrococcus abyssi GE5]
          Length = 320

 Score =  306 bits (783), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 150/299 (50%), Positives = 198/299 (66%), Gaps = 5/299 (1%)

Query: 11  LSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLG 70
           L + +   +  I+E AK +K   +    ++ L GK LAMIF+KPSTRTRV FEVAM HLG
Sbjct: 13  LQDYTPEEIWTILETAKMLKIWQKIGKPHRLLEGKTLAMIFQKPSTRTRVRFEVAMAHLG 72

Query: 71  GDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTD 130
           G  ++L+  ++QL R ETI DTA+VLSRYVDAI+ R  +H  + +L +YA+VPVIN L+D
Sbjct: 73  GHGLYLNAQDLQLRRGETIADTARVLSRYVDAIMARVYDHKDVEDLAKYASVPVINGLSD 132

Query: 131 NTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEP 190
            +HPCQ +AD MT  E +G++KG    + GDGNN+ HSL+    +    + +ATP G EP
Sbjct: 133 FSHPCQALADYMTIWEKKGTIKGVKVIYVGDGNNVAHSLMIAGTKLGADVVVATPEGYEP 192

Query: 191 RNEYLNWAR----NQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH-VFQPFQ 245
             + + WA       G S  L HD V+AVK A  ++TD W SM QE +A E   +F+PFQ
Sbjct: 193 DEKVIKWADENAAESGGSFELLHDPVKAVKDADVIYTDVWASMGQEAEAEERRKIFRPFQ 252

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           VN  L+  A P  +FMHCLPAHRGEEV ++V+D P SVV+DEAENRLH QKA+L    G
Sbjct: 253 VNKDLVKHAKPSYMFMHCLPAHRGEEVTDDVIDSPNSVVWDEAENRLHAQKAVLALLLG 311


>gi|110833579|ref|YP_692438.1| ornithine carbamoyltransferase [Alcanivorax borkumensis SK2]
 gi|110646690|emb|CAL16166.1| ornithine carbamoyltransferase [Alcanivorax borkumensis SK2]
          Length = 302

 Score =  305 bits (782), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 153/295 (51%), Positives = 203/295 (68%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L++++   L  +I+ A ++K    N   ++PL GK L MIFEK STRTRVSFEVA
Sbjct: 3   RHFLTLTDLTPDELGYLIQRAIELKTMLRNGQNHEPLKGKTLGMIFEKSSTRTRVSFEVA 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M H GG +IFLS  + QLGR E I D+A+VLSR VDA+++RT +H+ L    +++ VPVI
Sbjct: 63  MTHFGGSSIFLSPRDTQLGRGEPIEDSARVLSRMVDAVMIRTFDHATLQTFADHSAVPVI 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+ HPCQ++AD+ TF EHRGS++GK   W GDGNN+  S I  A +F++ L I+ P
Sbjct: 123 NALTDDFHPCQLLADMQTFVEHRGSIQGKKVVWVGDGNNMCASYINAANQFDFELVISCP 182

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQPF 244
            G  P N+ L     +   V+L  D   AV+GAH V TD W SM QE + +   + F+ +
Sbjct: 183 DGFTPDNDLLGRYPER---VSLEADVATAVQGAHLVVTDVWASMGQEDEQQTRLNAFEGY 239

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QV   LM  A PDALFMHCLPAHRGEEV +E++D P++VV+DEAENRLH QKA+L
Sbjct: 240 QVTPELMDKADPDALFMHCLPAHRGEEVSHEMMDDPRAVVWDEAENRLHAQKALL 294


>gi|328954146|ref|YP_004371480.1| Ornithine carbamoyltransferase [Desulfobacca acetoxidans DSM 11109]
 gi|328454470|gb|AEB10299.1| Ornithine carbamoyltransferase [Desulfobacca acetoxidans DSM 11109]
          Length = 322

 Score =  305 bits (781), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 144/293 (49%), Positives = 200/293 (68%), Gaps = 1/293 (0%)

Query: 13  NISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGD 72
           +++++ +  ++E A  +K   +   + KPL+GK LA+IFEKPSTRTRVSFE  + HLGG 
Sbjct: 26  DLTAAEIYQLLERAAALKVLHQQDHDPKPLAGKTLALIFEKPSTRTRVSFEAGIAHLGGS 85

Query: 73  TIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNT 132
           TI+L  ++ QL R+E I DTA+VL+RYVD IV+RT  H  + ++  +A +PVIN LTD+ 
Sbjct: 86  TIYLGRNDSQLSRSEPIADTARVLARYVDGIVIRTFGHDIVEDMARWADIPVINGLTDSH 145

Query: 133 HPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRN 192
           HPCQ+++D+ T +E  G V     +W GDGNN+ +S I  A R ++ L++A P G EP  
Sbjct: 146 HPCQVLSDLQTIQERFGRVTDLKVAWIGDGNNMANSWITAALRLDFSLSLACPPGYEPDA 205

Query: 193 EYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQPFQVNLSLM 251
             L  AR +G  + L  D V+AV+ AH + TD W SM QE +A+  + VF P+QVN +L+
Sbjct: 206 GLLQQARQEGRPIYLQDDPVRAVQEAHVINTDVWASMGQEAEAKARKKVFAPYQVNGALL 265

Query: 252 SMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
             A PDA+ +HCLPAHRGEE+  EVLDGPQS  +D+AENRLH QKA+L W  G
Sbjct: 266 QHARPDAIILHCLPAHRGEEITGEVLDGPQSAAWDQAENRLHLQKALLEWLIG 318


>gi|319407972|emb|CBI81626.1| Ornithine carbamoyltransferase (fragment) [Bartonella
           schoenbuchensis R1]
          Length = 237

 Score =  305 bits (781), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 173/228 (75%)

Query: 76  LSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPC 135
           L+GS+MQL  ++ I DTA++LSR+VD I +RTT H R+L+L +   +PVIN LTD+THPC
Sbjct: 2   LTGSQMQLSHSKIIADTARILSRFVDIITLRTTIHHRMLKLAQRVQIPVINVLTDDTHPC 61

Query: 136 QIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYL 195
           QI+ DI+T+EEHRG +  K+F+W G  NN+LHSLIE  A FN+ L I  P  S+P+ +++
Sbjct: 62  QILVDILTYEEHRGPIFSKIFAWMGKSNNVLHSLIEATALFNFHLRIVIPKSSKPQTKHV 121

Query: 196 NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVNLSLMSMAH 255
            W+R +GA + L +D  +A + A C+ TDTW+SM QEF+ R   +FQP+QVN +LM +A 
Sbjct: 122 EWSRKRGAHITLTNDPQKAAENADCIITDTWVSMGQEFRVRNHSIFQPYQVNEALMKLAK 181

Query: 256 PDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           P+ALFMHCLPAHRGEEV++ V+DGP SVVFDEAENR HTQKAI  WC 
Sbjct: 182 PNALFMHCLPAHRGEEVVDTVIDGPHSVVFDEAENRFHTQKAIFAWCL 229


>gi|218885154|ref|YP_002434475.1| ornithine carbamoyltransferase [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218756108|gb|ACL07007.1| ornithine carbamoyltransferase [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 300

 Score =  305 bits (780), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 145/300 (48%), Positives = 204/300 (68%), Gaps = 4/300 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           P+HF  + ++       +++ AK++K+++      K + GK   +IFEK STRTRVSFE+
Sbjct: 2   PRHFTRIRDLGYEGAWKLLQRAKEMKDTAHR---GKIMEGKTAILIFEKASTRTRVSFEM 58

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           A++HLGG TIF++ +E QLGR+E + DTA+VLSRY D +V+RT   S++ EL EY ++PV
Sbjct: 59  AVRHLGGSTIFMTPAESQLGRSEPLRDTARVLSRYADCMVVRTFGQSKITELAEYGSIPV 118

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALTD  HPCQ++ D++T  E    +     +W GDGNN+ +S IE A  F + L +A 
Sbjct: 119 INALTDEGHPCQVMGDVLTMYERTPDLSTVRVAWVGDGNNMANSWIEAAVYFPFELFMAF 178

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EHVFQP 243
           P G EP  + L +A N GA + L HD   AV+GAH V TD W SM QE + ++ E  F+ 
Sbjct: 179 PEGYEPDRDLLGYALNAGAKIFLTHDPRMAVEGAHYVNTDVWASMGQEEEQKKREAAFKG 238

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           + ++  +M++A PDA FMHCLPAHRGEEV +EV++ P S++FD+AENRLH QKAIL W F
Sbjct: 239 YCIDTEMMALAAPDAKFMHCLPAHRGEEVTDEVMESPASIIFDQAENRLHIQKAILEWAF 298


>gi|254436638|ref|ZP_05050132.1| ornithine carbamoyltransferase [Octadecabacter antarcticus 307]
 gi|198252084|gb|EDY76398.1| ornithine carbamoyltransferase [Octadecabacter antarcticus 307]
          Length = 301

 Score =  304 bits (779), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 152/308 (49%), Positives = 204/308 (66%), Gaps = 20/308 (6%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFE-----NKPLSGKVLAMIFEKPSTRTRVS 61
           HF D+   S ++L  II+ A  +K++   + +     ++PL+  ++A+IFEKPSTRTR+S
Sbjct: 3   HFLDIHTTSPADLRGIIDSAASMKSARAGLPKGTPDADQPLANHMVALIFEKPSTRTRIS 62

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG+T+ LSG +MQLG  ETI DTA+VLSRYVD I++RT     LLE+ EYA+
Sbjct: 63  FDVGVRQMGGETMVLSGKDMQLGHGETIADTARVLSRYVDLIMIRTFEEQTLLEMAEYAS 122

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD THPCQI+ADI+TFEEH G +KGK   WSGDGNN+  S    A +F++ L 
Sbjct: 123 VPVINGLTDRTHPCQIMADILTFEEHSGPIKGKKVVWSGDGNNVFASFAHAAKQFDFDLV 182

Query: 182 IATPIGSEPR---NEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE 238
              P   +P    +      RN             AV+GA  V TDTW+SM+    ARE 
Sbjct: 183 FTGPETLQPEAALDGLYTTERNPNL----------AVQGADLVVTDTWVSMHDPQSARER 232

Query: 239 --HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
             +  + +QVN  LMS A PDALFMHCLPAHR +E  +EV+DG +SV++DEAENR+H QK
Sbjct: 233 RHNQLRGYQVNADLMSKAKPDALFMHCLPAHRDDEATSEVMDGLRSVIWDEAENRMHAQK 292

Query: 297 AILLWCFG 304
           A+L +C G
Sbjct: 293 AVLRYCLG 300


>gi|147676841|ref|YP_001211056.1| ornithine carbamoyltransferase [Pelotomaculum thermopropionicum SI]
 gi|146272938|dbj|BAF58687.1| ornithine carbamoyltransferase [Pelotomaculum thermopropionicum SI]
          Length = 313

 Score =  304 bits (778), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 145/299 (48%), Positives = 204/299 (68%), Gaps = 5/299 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +H   L + S   ++ I+++A ++K+  +    +  L GK+L MIF+K STRTRVSFEVA
Sbjct: 11  RHLLSLHDFSPDEIAYILDLAGELKDRQKKNIPHPYLRGKMLGMIFQKSSTRTRVSFEVA 70

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FL+ +++QLGR ETI DTA+VLSRY+D I++RT +H+ + EL  +ATVPVI
Sbjct: 71  MYQLGGSAMFLNVNDLQLGRGETIADTARVLSRYLDGIMIRTYSHADVEELARHATVPVI 130

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQI+AD++T +E +G + G   ++ GDGNN+ HSL+ G A+    +++A+P
Sbjct: 131 NGLTDLLHPCQILADLLTVKERKGRLAGLKLAYVGDGNNVCHSLLFGCAKTGMHISVASP 190

Query: 186 IGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREEHV 240
            G +P+ E +  A       G+ + +    V+AV GA  V TD W SM QE  ++R   V
Sbjct: 191 EGYKPKEEIVRLAEKDAEQTGSRIEILTSPVEAVSGADVVVTDVWASMGQEVEQSRRVRV 250

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           F P+QVN  L   A PD +F+HCLPAHRGEEV +E++DGP S V+DEAENRLH QKA+L
Sbjct: 251 FAPYQVNRQLTGHARPDYIFLHCLPAHRGEEVTDEIIDGPHSAVWDEAENRLHVQKAVL 309


>gi|326204297|ref|ZP_08194156.1| ornithine carbamoyltransferase [Clostridium papyrosolvens DSM 2782]
 gi|325985572|gb|EGD46409.1| ornithine carbamoyltransferase [Clostridium papyrosolvens DSM 2782]
          Length = 305

 Score =  304 bits (778), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 142/304 (46%), Positives = 208/304 (68%), Gaps = 5/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH   L+++S+  +  ++++++K+K  ++   ++  L GK L MIF K STRTRVSFEV 
Sbjct: 2   KHLLSLNDLSTDEIHDLLKLSEKLKRQTKEGVQHHLLKGKTLGMIFTKSSTRTRVSFEVG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG ++FLS +++QLGR E+I DTA VLSRY+D I++RT   S + +L +Y T+PVI
Sbjct: 62  MYQLGGYSLFLSSNDIQLGRGESIFDTANVLSRYIDGIMIRTFKQSDVEDLAKYGTIPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQI+AD++T  EH+G ++G   ++ GDGNN+ HSL+ G A+    + IA+P
Sbjct: 122 NGLTDEMHPCQILADLLTVYEHKGKLEGLKLAYIGDGNNVAHSLLHGCAKTGMDIAIASP 181

Query: 186 IGSEPRNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HV 240
            G E  + Y++ A+      G+ + L  D V+A+  A  V+ DTWISM QE +  E+ ++
Sbjct: 182 KGYECDSRYVDEAKEAAKASGSKIVLTQDPVEAIANADVVYADTWISMGQEEQKEEKLNI 241

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F P+Q+N  L + A  DA+F+HCLPA+RG EV  +V+DG QSV+FDEAENRLH QKA++ 
Sbjct: 242 FMPYQINSQLFAKAKEDAIFLHCLPAYRGYEVTEDVIDGAQSVIFDEAENRLHAQKAVMA 301

Query: 301 WCFG 304
              G
Sbjct: 302 TLMG 305


>gi|254429913|ref|ZP_05043620.1| ornithine carbamoyltransferase [Alcanivorax sp. DG881]
 gi|196196082|gb|EDX91041.1| ornithine carbamoyltransferase [Alcanivorax sp. DG881]
          Length = 302

 Score =  303 bits (777), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 151/295 (51%), Positives = 204/295 (69%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L++++   L  +I+ A ++K    N   ++PL GK L MIFEK STRTRVSFEVA
Sbjct: 3   RHFLTLTDLTPDELGYLIQRAIELKTMLRNGQHHEPLQGKTLGMIFEKSSTRTRVSFEVA 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M H GG +IFLS  + QLGR E I D+A+VLSR VDA+++RT +H+ L    +++ VPVI
Sbjct: 63  MTHFGGSSIFLSPRDTQLGRGEPIEDSARVLSRMVDAVMIRTFDHATLQTFADHSAVPVI 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+ HPCQ++AD+ T+ EHRGS++GK   W GDGNN+  S I  A +F++ L I++P
Sbjct: 123 NALTDDFHPCQLLADMQTYVEHRGSIQGKKVVWVGDGNNMCASYINAANQFDFELVISSP 182

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQPF 244
            G  P ++ L    ++   V+L  D   AV+GAH V TD W SM QE + +   + F  +
Sbjct: 183 DGFTPDSDLLGRYPDR---VSLEPDVATAVQGAHLVVTDVWASMGQEDEQQTRLNAFDGY 239

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QV   LM  A PDALFMHCLPAHRGEEV +E++D P++VV+DEAENRLH QKA+L
Sbjct: 240 QVTPELMDRADPDALFMHCLPAHRGEEVSHEMMDDPRAVVWDEAENRLHAQKALL 294


>gi|317121383|ref|YP_004101386.1| ornithine carbamoyltransferase [Thermaerobacter marianensis DSM
           12885]
 gi|315591363|gb|ADU50659.1| ornithine carbamoyltransferase [Thermaerobacter marianensis DSM
           12885]
          Length = 332

 Score =  303 bits (777), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 153/304 (50%), Positives = 204/304 (67%), Gaps = 5/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F  LS+ +   L+ ++++A  +K         +PL GK LAMIFEKPSTRTRVSFEV 
Sbjct: 29  RDFLTLSDFTPDELAGLLDLAAALKQEGPVAPGAEPLYGKTLAMIFEKPSTRTRVSFEVG 88

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG  + LS  E+QL R ET+ DTA+VLSRYVDA+++R  +H+ + EL E A++PVI
Sbjct: 89  MQQLGGRVLNLSPRELQLSRGETLADTARVLSRYVDALMVRAYSHATVEELAEAASIPVI 148

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQI+AD++T  E++G ++G   ++ GD NN+ H+ + GAA     L +A P
Sbjct: 149 NGLTDLYHPCQIMADLLTIREYKGRLRGVTVAYVGDSNNVAHTWLLGAALMGLHLRLACP 208

Query: 186 IGSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREEHV 240
            G EPR E L      AR+ GA+V + HD V AV+GA  V+TD W SM  +  +     +
Sbjct: 209 PGYEPRPEVLALAKTLARDTGATVQVLHDPVAAVRGAEVVYTDVWTSMGQEGEEEERRQI 268

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F P+QVN  L++ A PD +FMHC+PAHRGEEV  +VLDGP SVV D+AENRLH QKAILL
Sbjct: 269 FAPYQVNADLVAHAAPDFIFMHCMPAHRGEEVTGDVLDGPHSVVLDQAENRLHVQKAILL 328

Query: 301 WCFG 304
              G
Sbjct: 329 ALLG 332


>gi|126733280|ref|ZP_01749027.1| ornithine carbamoyltransferase [Roseobacter sp. CCS2]
 gi|126716146|gb|EBA13010.1| ornithine carbamoyltransferase [Roseobacter sp. CCS2]
          Length = 301

 Score =  303 bits (776), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 154/308 (50%), Positives = 201/308 (65%), Gaps = 18/308 (5%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFEN-----KPLSGKVLAMIFEKPSTRTRVS 61
           HF D+    +  L  II+ A+ +K +     +      +PL+G ++A+IFEKPSTRTRVS
Sbjct: 3   HFLDIHTTPTDALRDIIDNAQAMKTARAGQPKGTPDAEQPLAGHMVALIFEKPSTRTRVS 62

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG T+ LSG++MQLG  ETI DTA+VLSRYVD I++RT     LL++ EYAT
Sbjct: 63  FDVGVRQMGGQTMVLSGADMQLGHGETIADTARVLSRYVDLIMIRTFEEQTLLDMAEYAT 122

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL- 180
           VPVIN LT+ THPCQI+ADIMTFEEH G +KGK   WSGDGNN+  S    A +F + L 
Sbjct: 123 VPVINGLTNRTHPCQIMADIMTFEEHNGPIKGKKIVWSGDGNNVFASFAHAAKQFEFDLV 182

Query: 181 -NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE- 238
                P+  EP  + L              D  +AV+GA  V TDTW+SM+    ARE  
Sbjct: 183 YTGPPPLDPEPALDGL---------YTTVRDPHEAVQGADLVVTDTWVSMHDPQSARERR 233

Query: 239 -HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
            +  + +QVN +LM+ A  DALFMHCLPAHR +E  + V+DGP SV+FDEAENRLH QKA
Sbjct: 234 HNQLRGYQVNDALMAKAKDDALFMHCLPAHRDDEATSSVMDGPHSVIFDEAENRLHAQKA 293

Query: 298 ILLWCFGI 305
           I+  C G+
Sbjct: 294 IMRHCLGV 301


>gi|330957755|gb|EGH58015.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. maculicola
           str. ES4326]
          Length = 306

 Score =  303 bits (776), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 149/296 (50%), Positives = 196/296 (66%), Gaps = 4/296 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           P+HF  + + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+SFE 
Sbjct: 3   PRHFLSMMDYTPDELLGLIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRLSFEA 62

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M HLGG  IFLS  + QLGR E + D+AKV+SR +DA+++RT  HS L E    + VPV
Sbjct: 63  GMIHLGGQAIFLSHRDTQLGRGEPVADSAKVMSRMLDAVMIRTYAHSNLTEFAANSRVPV 122

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN L+D+ HPCQ++AD+ TF EHRGS+KGK  +W GDGNN+ +S IE A RF++ L +A 
Sbjct: 123 INGLSDDLHPCQLLADMQTFLEHRGSIKGKTVAWIGDGNNMCNSYIEAAIRFDFQLRVAC 182

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQP 243
           P G EP  E++  A   G  V +  D   AV GAH V TD W SM QE + AR + +F P
Sbjct: 183 PAGYEPNPEFMALA---GDRVTVVRDPQAAVSGAHLVSTDVWTSMGQEEETARRKALFAP 239

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           FQV  +L+ +A  D LFMHCLPAHRGEE+  +VLD  +SV +D+AENRLH QKA+L
Sbjct: 240 FQVTRALLDLADKDVLFMHCLPAHRGEEISVDVLDDARSVAWDQAENRLHAQKALL 295


>gi|103486844|ref|YP_616405.1| ornithine carbamoyltransferase [Sphingopyxis alaskensis RB2256]
 gi|98976921|gb|ABF53072.1| ornithine carbamoyltransferase [Sphingopyxis alaskensis RB2256]
          Length = 307

 Score =  303 bits (775), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 146/303 (48%), Positives = 200/303 (66%), Gaps = 5/303 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFE-----NKPLSGKVLAMIFEKPSTRTRV 60
           +HF +L++     ++ +I  A   K +     +     ++PL+  VLAM+FEK STRTR 
Sbjct: 2   RHFLNLADAGGDAVATMIADAIDRKAARAGWPKARPDADEPLADHVLAMVFEKNSTRTRC 61

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF++A++ LGG  + L     QLGR ETI DTA+VLSRY DAI++RT +H++  EL  YA
Sbjct: 62  SFDIAIRQLGGVPMILDAGTTQLGRGETIADTARVLSRYADAIMIRTDDHAKAEELAAYA 121

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +VPVIN LTD +HPCQI+AD++T  E   ++ G   +W GDGNN+L SLIE A  F + +
Sbjct: 122 SVPVINGLTDLSHPCQIVADLLTIVESGKALPGLELAWLGDGNNVLASLIEAAGLFGFNV 181

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            +  P G EP   ++  AR +GA + +  DA +AV GA  V TDTW+SM Q+    +   
Sbjct: 182 RVGVPQGYEPDTGFIEAARARGACIDIVRDAREAVAGADLVVTDTWVSMGQDHAHNKVAA 241

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
             PFQV+  LM+ A  DALF+HCLPAHRGEEV++ V+DG QS V+DEAENR+H QK+ILL
Sbjct: 242 MAPFQVDERLMAAAKSDALFLHCLPAHRGEEVVDAVIDGAQSRVWDEAENRVHAQKSILL 301

Query: 301 WCF 303
           W  
Sbjct: 302 WTL 304


>gi|114778319|ref|ZP_01453178.1| ornithine carbamoyltransferase [Mariprofundus ferrooxydans PV-1]
 gi|114551421|gb|EAU53977.1| ornithine carbamoyltransferase [Mariprofundus ferrooxydans PV-1]
          Length = 301

 Score =  302 bits (774), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 154/295 (52%), Positives = 191/295 (64%), Gaps = 1/295 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF  L +I+      I++ A+K+K         +PL GK LAMIF+K STRTRVSFEV 
Sbjct: 2   KHFLTLLDITPDEARHILKRAEKMKRKLREGKAFRPLEGKTLAMIFDKASTRTRVSFEVG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FL  +  QLGR E + D+A+VLS  VD +++RT  H  +    EY++VPVI
Sbjct: 62  MYQLGGHALFLHSATTQLGRGEPVEDSARVLSGMVDGVMIRTFAHDTIQRFAEYSSVPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD THPCQI+ D+ T+EE RGS++GK  +W GDGNN+ HS I GA  F Y L IA P
Sbjct: 122 NGLTDLTHPCQILTDVFTYEEQRGSIEGKTVAWVGDGNNMAHSWINGAVTFGYQLRIACP 181

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQPF 244
            G  P ++ L+ AR  GA V L  D ++AV  A  V TD W SM QE +  E    F  F
Sbjct: 182 PGYCPDDKTLSAARALGADVTLTDDPLEAVANADLVTTDVWASMGQEDEQAERVKAFAGF 241

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            V+   MS A PDALFMHCLPAHRGEEV  +V+DG QSVV+ EAENRLH QK +L
Sbjct: 242 CVDARTMSYAGPDALFMHCLPAHRGEEVSADVIDGAQSVVWTEAENRLHAQKGLL 296


>gi|302384429|ref|YP_003820252.1| ornithine carbamoyltransferase [Brevundimonas subvibrioides ATCC
           15264]
 gi|302195057|gb|ADL02629.1| ornithine carbamoyltransferase [Brevundimonas subvibrioides ATCC
           15264]
          Length = 305

 Score =  302 bits (774), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 145/304 (47%), Positives = 202/304 (66%), Gaps = 10/304 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSEN-----IFENKPLSGKVLAMIFEKPSTRTRV 60
           +HF D+  + ++ L  I++ A   K + +      +  + P   +VLAMIFEK STRTR 
Sbjct: 3   RHFLDIHRLEAAELRAILDDAHARKAARKGWPRGRVDADAPAKDRVLAMIFEKNSTRTRF 62

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF+ A++ LGGD+I  +  +MQLGR E + DTA+VLSR VDA+++R  +H  +      A
Sbjct: 63  SFDAAIRQLGGDSIIANAGDMQLGRGEPVEDTARVLSRMVDAVMIRANSHEDVERFARVA 122

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPV+N LTD +HPCQI+ADIMT EE RG ++GK  +W GDGNN+ HS +  A +  + L
Sbjct: 123 TVPVVNGLTDRSHPCQILADIMTIEEQRGPIEGKTIAWIGDGNNVCHSFMHAAPKLGFHL 182

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREEH 239
           N+A P    P    L      G +V L  D   AV+GA  V TDTW+SM + +++AR  H
Sbjct: 183 NVACPAEYHPDLHDLA---KGGNAVTLTSDPKDAVRGADVVVTDTWVSMGDGDYEAR-LH 238

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ + V+ +LM +A PDA+F+HCLPAHRGEEV + V+DGP+S+V+DEAENR+H QKA+L
Sbjct: 239 AFENYTVDEALMDLADPDAVFLHCLPAHRGEEVTDAVIDGPRSLVWDEAENRIHAQKAVL 298

Query: 300 LWCF 303
            WCF
Sbjct: 299 AWCF 302


>gi|313902362|ref|ZP_07835766.1| ornithine carbamoyltransferase [Thermaerobacter subterraneus DSM
           13965]
 gi|313467410|gb|EFR62920.1| ornithine carbamoyltransferase [Thermaerobacter subterraneus DSM
           13965]
          Length = 333

 Score =  302 bits (773), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 153/300 (51%), Positives = 202/300 (67%), Gaps = 5/300 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F  L + +   L  ++++A  +K   +     +PL GK LAMIFEKPSTRTRVSFEV 
Sbjct: 30  RDFLTLGDFTPDELVGLLDLAAALKQDWQAGRGGEPLYGKTLAMIFEKPSTRTRVSFEVG 89

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG  + LS  E+QL R ET+ DTA+VLSRYVDA+++R  +H+ + EL   AT+PVI
Sbjct: 90  MQQLGGRVLNLSPRELQLSRGETLADTARVLSRYVDALMVRAYSHATVEELAAAATIPVI 149

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ++AD++T  EH+G ++G   ++ GD NN+ H+ + GAA     L +A P
Sbjct: 150 NGLTDLYHPCQVMADLLTIREHKGRLRGIRVAYVGDSNNVAHTWLLGAALLGLHLRLACP 209

Query: 186 IGSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EHV 240
            G EP  E L    + AR  GA+V + HD V AV+GA  V+TD W SM QE +  +    
Sbjct: 210 PGYEPHPEILALAASLARGTGATVEVGHDPVTAVRGADVVYTDVWTSMGQEGEEEDRRRA 269

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F P+QVN  L++ A PD +FMHCLPAHRGEEV + VLDGP SVV+D+AENRLH QKAILL
Sbjct: 270 FAPYQVNAQLVAHAAPDYIFMHCLPAHRGEEVTSGVLDGPHSVVWDQAENRLHAQKAILL 329


>gi|312136279|ref|YP_004003616.1| ornithine carbamoyltransferase [Methanothermus fervidus DSM 2088]
 gi|311223998|gb|ADP76854.1| ornithine carbamoyltransferase [Methanothermus fervidus DSM 2088]
          Length = 302

 Score =  301 bits (772), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 153/303 (50%), Positives = 208/303 (68%), Gaps = 10/303 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH   + +I    +  +I++A+K KN      + K L  KVLAMIFEKPSTRTRVSFEVA
Sbjct: 2   KHVLSVCDIKDE-VEELIDIAEKFKNGK---IKEKVLKDKVLAMIFEKPSTRTRVSFEVA 57

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG+ ++L  SE+QLGR E I DTAKV+SRYVD I++R   H  ++EL +++T+PVI
Sbjct: 58  VLQLGGNALYLPSSELQLGRGELIADTAKVMSRYVDGIMIRANRHKDVIELAKHSTIPVI 117

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ +AD+ T +E++G    KL ++ GDGNN+ +SLI  ++     +++A+P
Sbjct: 118 NGLTDEEHPCQALADMQTIKEYKGGFNIKL-AFVGDGNNVCNSLILISSILGIDISVASP 176

Query: 186 IGSEPRNEYLN----WARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HV 240
            G EP N+ +N     A+  GA + +  DA++AVKGA  V+TD WISM QE + +     
Sbjct: 177 KGYEPSNKIVNKALKIAKKTGAKINITSDAIEAVKGADVVYTDVWISMGQENERKTRLKA 236

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+ +QVN  LMS A  DA+FMHCLPA RGEE  ++V+DGP SVV+D+AENRLHTQKAIL 
Sbjct: 237 FKKYQVNKKLMSHAKEDAIFMHCLPAVRGEETTSDVIDGPNSVVWDQAENRLHTQKAILY 296

Query: 301 WCF 303
             F
Sbjct: 297 KIF 299


>gi|289595836|ref|YP_003482532.1| ornithine carbamoyltransferase [Aciduliprofundum boonei T469]
 gi|289533623|gb|ADD07970.1| ornithine carbamoyltransferase [Aciduliprofundum boonei T469]
          Length = 306

 Score =  301 bits (771), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 151/290 (52%), Positives = 193/290 (66%), Gaps = 5/290 (1%)

Query: 16  SSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIF 75
              L  II++  ++K     +   +PL  K +AMIFEKPSTRTRVSFEVAM  LGG  ++
Sbjct: 12  KDELEEIIDLGLEMKRRQRMVEVYEPLKDKSMAMIFEKPSTRTRVSFEVAMTQLGGHALY 71

Query: 76  LSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPC 135
           LS  +MQLGR ETI DTA+VLSRYVDAIV R   H  ++EL E A+VPVINAL D  HPC
Sbjct: 72  LSPRDMQLGRGETIADTARVLSRYVDAIVYRAYKHENVVELAENASVPVINALDDLEHPC 131

Query: 136 QIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYL 195
           QI+AD+MT +E +G  +G   ++ GDGNN+ HSL+ GAA       +A P G EP+ + +
Sbjct: 132 QIVADLMTIKEKKGGFRGLKLAYVGDGNNVAHSLMLGAAIVGMNFYMACPDGYEPKKDIV 191

Query: 196 NWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREEHVFQPFQVNLSL 250
             AR      GA + + HD V+AVK A  ++TD W+SM  E  K     VF+P+QVN  L
Sbjct: 192 GEARKIANETGAKIVITHDPVEAVKDADVIYTDVWVSMGDEAEKEIRLKVFKPYQVNEEL 251

Query: 251 MSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           +  A  + +FMHCLPAHRG EV ++V+D   SVVFDEAENRLH QKAIL+
Sbjct: 252 VRHAKSNYIFMHCLPAHRGYEVTDDVIDSRNSVVFDEAENRLHAQKAILV 301


>gi|94495447|ref|ZP_01302027.1| ornithine carbamoyltransferase [Sphingomonas sp. SKA58]
 gi|94424835|gb|EAT09856.1| ornithine carbamoyltransferase [Sphingomonas sp. SKA58]
          Length = 309

 Score =  301 bits (770), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 149/307 (48%), Positives = 206/307 (67%), Gaps = 11/307 (3%)

Query: 6   KHFADLSNISSSNLSCIIEV--------AKKIKNSSENIFENKPLSGKVLAMIFEKPSTR 57
           KHF +LS+     ++ +I          A K K +++    + PL+G  LAMIFEK STR
Sbjct: 3   KHFLNLSDAGGDAIAAMIADAIDRKAARAGKPKGAAD---ADAPLAGHTLAMIFEKNSTR 59

Query: 58  TRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELT 117
           TRVSF++A++ LGG ++ L G+  QLGR E+I DTA+VLSR VDAI++RT +H+++ E+ 
Sbjct: 60  TRVSFDMAIRQLGGTSLILDGATSQLGRGESIADTARVLSRMVDAIMIRTDDHAKVEEMA 119

Query: 118 EYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFN 177
            YATVPVIN LTD +HPCQI+AD++T  EH  ++ G  ++W GDGNN+LHS++E A    
Sbjct: 120 HYATVPVINGLTDLSHPCQIVADLLTVVEHGLALPGSQWAWLGDGNNVLHSIVEAAGLLK 179

Query: 178 YLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE 237
           + + +  P G +P   +   AR  G+++ L  DA +AV GA  + TDTWISM Q     +
Sbjct: 180 FDVRMGIPHGYDPDPGFAEAARAAGSAIMLTRDAAEAVAGADIIVTDTWISMGQAHADEK 239

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
                PFQV   LM  A PDA F+HCLPAHRGEEV+  V+DGPQS+++DEAENR+H QK+
Sbjct: 240 LAAMMPFQVTPDLMRQAKPDAKFLHCLPAHRGEEVVEAVIDGPQSLIWDEAENRIHGQKS 299

Query: 298 ILLWCFG 304
           +LLW  G
Sbjct: 300 VLLWALG 306


>gi|220930280|ref|YP_002507189.1| ornithine carbamoyltransferase [Clostridium cellulolyticum H10]
 gi|220000608|gb|ACL77209.1| ornithine carbamoyltransferase [Clostridium cellulolyticum H10]
          Length = 305

 Score =  300 bits (768), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 144/304 (47%), Positives = 211/304 (69%), Gaps = 5/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH   L+N++S+ +  ++++++K+K  ++   ++  L GK L MIF K STRTRVSFEV 
Sbjct: 2   KHLLSLNNLNSNEIQDLLKLSEKLKRQTKEGVQHHLLKGKTLGMIFSKSSTRTRVSFEVG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG ++FLS +++QLGR E+I DTA VLSRY+D I++RT N S + +L +Y T+PVI
Sbjct: 62  MYQLGGYSLFLSSNDIQLGRGESIFDTANVLSRYIDGIMIRTFNQSDVEDLAKYGTIPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQI+AD++T  EH+G ++G   ++ GDGNN+ HSL+ G A+    ++IA+P
Sbjct: 122 NGLTDEMHPCQILADLLTIYEHKGKLEGLKLAYIGDGNNVAHSLLHGCAKTGMDISIASP 181

Query: 186 IGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HV 240
            G E  + Y++ A+      G+ V L  D V+A+  A  V+ DTWISM QE +  E+ ++
Sbjct: 182 KGYECDSRYVDEAKEAAKSIGSKVVLTQDPVEAISKADVVYADTWISMGQEDQKEEKLNI 241

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F P+Q+N  L + A  DA+F+HCLPA+RG EV  +++DG QSV+FDEAENRLH QKA++ 
Sbjct: 242 FMPYQINSQLFAKAKEDAIFLHCLPAYRGYEVTEDIIDGAQSVIFDEAENRLHAQKAVMA 301

Query: 301 WCFG 304
              G
Sbjct: 302 TLMG 305


>gi|125974373|ref|YP_001038283.1| ornithine carbamoyltransferase [Clostridium thermocellum ATCC
           27405]
 gi|256005548|ref|ZP_05430508.1| ornithine carbamoyltransferase [Clostridium thermocellum DSM 2360]
 gi|281418919|ref|ZP_06249937.1| ornithine carbamoyltransferase [Clostridium thermocellum JW20]
 gi|125714598|gb|ABN53090.1| ornithine carbamoyltransferase [Clostridium thermocellum ATCC
           27405]
 gi|255990456|gb|EEU00578.1| ornithine carbamoyltransferase [Clostridium thermocellum DSM 2360]
 gi|281407376|gb|EFB37636.1| ornithine carbamoyltransferase [Clostridium thermocellum JW20]
 gi|316941531|gb|ADU75565.1| ornithine carbamoyltransferase [Clostridium thermocellum DSM 1313]
          Length = 307

 Score =  300 bits (767), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 148/304 (48%), Positives = 201/304 (66%), Gaps = 5/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +H   L +++  +   I ++A+K+K   +    +  L GK L MIF K STRTRVSFEV 
Sbjct: 2   EHLISLHDLTVEDFESIFKLAEKLKRQQKEGIPHHLLKGKTLGMIFTKSSTRTRVSFEVG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLS +++QLGR ETI DTA+VLSRYVD I++RT   S + +L  Y  VPVI
Sbjct: 62  MYQLGGYPLFLSANDIQLGRGETIYDTAQVLSRYVDGIMIRTFAQSDVEDLARYGNVPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQI+AD+ T  EH+G++KG   ++ GDGNN+ +SL+ G A+    + +A+P
Sbjct: 122 NGLTDLMHPCQILADLFTIYEHKGTLKGLKLAYVGDGNNVANSLLHGCAKVGMDIAVASP 181

Query: 186 IGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HV 240
            G E  +  +  A+      GA++ L  D  +A+K A  V+TDTW+SM QE +  E   V
Sbjct: 182 KGYECDSRIVEEAKEDAKASGANILLTEDPEEAIKDADVVYTDTWVSMGQESEKEERIKV 241

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F P+QVN +L S AH DA+F+HCLPA+RG EV  +V+DG QSV+FDEAENRLH QKAI+ 
Sbjct: 242 FMPYQVNNTLFSKAHEDAIFLHCLPAYRGYEVTEDVIDGSQSVIFDEAENRLHVQKAIMA 301

Query: 301 WCFG 304
              G
Sbjct: 302 LLMG 305


>gi|78044926|ref|YP_361070.1| ornithine carbamoyltransferase [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|123575554|sp|Q3A9W4|OTC_CARHZ RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|77997041|gb|ABB15940.1| ornithine carbamoyltransferase [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 311

 Score =  300 bits (767), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 150/304 (49%), Positives = 200/304 (65%), Gaps = 5/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F  +++++   +  ++++A ++K   +       L GK LAMIF K STRTRVSFEV 
Sbjct: 8   RDFLSMNDLTGEEIEEVLDLASELKIRQKKGISTPILKGKTLAMIFSKNSTRTRVSFEVG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +F++ ++ QL R E I DTA+VLSR VD I++RT +HS + EL  YA VPVI
Sbjct: 68  MVQLGGYPLFITATDSQLSRGEPIADTARVLSRMVDGIMIRTYSHSEVEELAYYADVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQI+AD++T +EH+G ++G   +W GDGNN+ HSL+ GAA+    + +ATP
Sbjct: 128 NGLTDYEHPCQIMADLLTIKEHKGQLRGLKVAWVGDGNNVCHSLMIGAAKVGMEVAVATP 187

Query: 186 IGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HV 240
            G EP  +    A+ +    G  + L HD V+AV GA  V TD W SM QE ++ E   V
Sbjct: 188 PGYEPDQKVSLIAQKETSRWGTKLLLTHDPVEAVTGADVVVTDVWASMGQEAESAERVKV 247

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+P+QVN  L+S A  D +F+HCLPAHRGEEV  EV+DG  SVVF EAENRLH QKAIL 
Sbjct: 248 FEPYQVNGELVSHAKQDFIFLHCLPAHRGEEVTAEVIDGEHSVVFAEAENRLHAQKAILT 307

Query: 301 WCFG 304
              G
Sbjct: 308 LLLG 311


>gi|117927017|ref|YP_867634.1| ornithine carbamoyltransferase [Magnetococcus sp. MC-1]
 gi|117610773|gb|ABK46228.1| ornithine carbamoyltransferase [Magnetococcus sp. MC-1]
          Length = 321

 Score =  300 bits (767), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 150/296 (50%), Positives = 196/296 (66%), Gaps = 7/296 (2%)

Query: 11  LSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLG 70
           L ++     + + + A  +K   E       L G+ LAM+FEK STRTRVSFE  M  LG
Sbjct: 14  LFDLRDEEFTVLFQRATTLKRKLERHEPVHSLDGRTLAMLFEKSSTRTRVSFEAGMFQLG 73

Query: 71  GDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTD 130
           G  +FLS  ++QLGR E + D+A+VLSRYVD I++RT +H+ +  + EYA+VPVIN LTD
Sbjct: 74  GKALFLSSRDIQLGRGEGVKDSARVLSRYVDGIMVRTFDHANVEIMAEYASVPVINGLTD 133

Query: 131 NTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEP 190
             HPCQ++ADI TFEE RGS+KGK  +W GDGNN+ ++ I+ A R+ + L +A P+G EP
Sbjct: 134 TLHPCQVLADIFTFEEKRGSLKGKRVAWVGDGNNMANTWIQAAVRYGFHLTLACPLGYEP 193

Query: 191 RNEYLNWARNQ------GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHVFQP 243
             + L+ AR +       AS+ L  D  Q V  AH V TD W SM QE ++   + VF  
Sbjct: 194 DGDILSAARKELAEREVDASLTLVRDPRQGVDRAHLVTTDVWTSMGQEGESDTRKAVFAA 253

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           +QV+  LM+ A  +ALFMHCLPAHRGEEV   VL+G QSVV+DEAENRLH QKAIL
Sbjct: 254 YQVDSGLMAAADAEALFMHCLPAHRGEEVTAAVLEGSQSVVWDEAENRLHVQKAIL 309


>gi|311067615|ref|YP_003972538.1| ornithine carbamoyltransferase [Bacillus atrophaeus 1942]
 gi|310868132|gb|ADP31607.1| ornithine carbamoyltransferase [Bacillus atrophaeus 1942]
          Length = 317

 Score =  299 bits (766), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 150/302 (49%), Positives = 203/302 (67%), Gaps = 11/302 (3%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIK-NSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           Y K    L ++S +++S ++  A  +K N  + IF+     GK LAMIFEK STRTRVSF
Sbjct: 14  YGKDLLTLKDLSEADISALLTEAADLKQNKIQPIFQ-----GKTLAMIFEKSSTRTRVSF 68

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E  M  LGG+ +FLS  ++QLGR ET+ DTAKVLS YVDAI++RT  H ++ EL E+A +
Sbjct: 69  EAGMAQLGGNALFLSQKDLQLGRGETVADTAKVLSGYVDAIMIRTFEHEKVEELAEHADI 128

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVIN LTD  HPCQ +AD++T +E +G +KG   ++ GDGNN+ HSL+ G A+    ++I
Sbjct: 129 PVINGLTDKYHPCQALADLLTIKEVKGKLKGVKVAYIGDGNNVAHSLMVGCAKMGCDVSI 188

Query: 183 ATPIGSEPRNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE 238
           A+P G E  +E +N A+      G+S+ L  D  +AVKGA  +++D + SM QE +  E 
Sbjct: 189 ASPKGYEVLDEAVNAAKEYAGVSGSSITLTADPGEAVKGADVIYSDVFTSMGQEAETNER 248

Query: 239 -HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
             VF P+QVN SL+  A PD  F+HCLPAHR EEV  E++DGP S VF +AENRLH QKA
Sbjct: 249 LTVFTPYQVNASLVKHAKPDYTFLHCLPAHREEEVTAEIIDGPNSAVFQQAENRLHVQKA 308

Query: 298 IL 299
           +L
Sbjct: 309 LL 310


>gi|295696783|ref|YP_003590021.1| ornithine carbamoyltransferase [Bacillus tusciae DSM 2912]
 gi|295412385|gb|ADG06877.1| ornithine carbamoyltransferase [Bacillus tusciae DSM 2912]
          Length = 318

 Score =  299 bits (766), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 155/303 (51%), Positives = 201/303 (66%), Gaps = 11/303 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F DL++ +S  L  ++ +A  +K   +     +PL+GK L MIFEK STRTRVSFEV 
Sbjct: 11  RDFLDLADFTSDELRGLLRLAAVLKEKQKAGERVQPLAGKTLGMIFEKSSTRTRVSFEVG 70

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FL+  + QLGR E I DTA+VLSRYVD I++RT +H  + EL EYATVPVI
Sbjct: 71  MVQLGGHALFLASHDTQLGRGEPIPDTARVLSRYVDGIMIRTFSHESVRELAEYATVPVI 130

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ++AD MT  EH+  ++G   ++ GDGNN+ +S + GA  F   L +ATP
Sbjct: 131 NGLTDLHHPCQVLADAMTILEHKSRLEGVTVAYVGDGNNMANSWLVGAPLFGMNLRVATP 190

Query: 186 IGSE------PRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
            G E       R + L  A   G  ++L HD  +AV GA  ++TD W SM QE + REE 
Sbjct: 191 QGYECDPGVAARAQEL--AARAGTEMSLVHDPREAVAGADVIYTDVWASMGQEAE-REER 247

Query: 240 V--FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
           +  F  F+V  +L++ A PD LFMHCLPAHRGEEV  +V+DGP SV+FDEAENRLH QKA
Sbjct: 248 LRAFAGFEVTPALVARAAPDYLFMHCLPAHRGEEVAPDVIDGPHSVIFDEAENRLHAQKA 307

Query: 298 ILL 300
           IL+
Sbjct: 308 ILV 310


>gi|269467874|gb|EEZ79617.1| ornithine carbamoyltransferase [uncultured SUP05 cluster bacterium]
          Length = 299

 Score =  299 bits (765), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 146/300 (48%), Positives = 205/300 (68%), Gaps = 4/300 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF +L+++S+++L  II+ A  +K   ++   N  L  K LAMIF+K STRTRVSFE  
Sbjct: 3   KHFINLNDLSNNDLQQIIDQAIALKKQHKSGEINNALQNKTLAMIFDKSSTRTRVSFEAG 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLS  ++QLGR E I D+A V+S  VDAI+MR ++H  +   +++++VP+I
Sbjct: 63  MTQLGGHALFLSDRDIQLGRGEPIIDSAIVISSMVDAIMMRVSSHDDITTFSQHSSVPII 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NAL+D +HPCQ++AD+MT++E+ GS+KGK  +W GDGNN+ H+ ++ A  F + LNIATP
Sbjct: 123 NALSDESHPCQLLADMMTYQEYNGSIKGKTVAWIGDGNNMCHTYMQAAKAFGFTLNIATP 182

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREEHVFQPF 244
            G EP   +++   +    + L  DA  A   A  V TD W SM QE  + + E  F+ F
Sbjct: 183 KGYEPEQSFVSQYAD---FINLCADAQTACDNADLVVTDVWASMGQESEQTKRETAFKDF 239

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QVN +LM  A  +A+FMHCLPAHRGEEV   V+DG QS+V++EAENRLH QKA+LL+  G
Sbjct: 240 QVNTALMESAKSNAIFMHCLPAHRGEEVSANVIDGKQSLVWNEAENRLHAQKALLLFLLG 299


>gi|152986546|ref|YP_001346993.1| ornithine carbamoyltransferase [Pseudomonas aeruginosa PA7]
 gi|150961704|gb|ABR83729.1| ornithine carbamoyltransferase [Pseudomonas aeruginosa PA7]
          Length = 305

 Score =  299 bits (765), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 144/295 (48%), Positives = 196/295 (66%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF    + S   L  +I    ++K+        +PL  +VL M+FEK STRTR+SFE  
Sbjct: 4   RHFLSFMDYSPEELIGLIRRGSELKDLRNRGVLYEPLKSRVLGMVFEKASTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E IGD+A+V+SR +D +++RT  HS L E   ++ VPVI
Sbjct: 64  MIQLGGQAIFLSPRDTQLGRGEPIGDSARVMSRMLDGVMIRTFAHSTLTEFAAHSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS++GK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFHEHRGSIQGKTVAWIGDGNNMCNSYIEAALKFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQPF 244
            G EP+ E++  A   G  + +  D  +AV GAH V TD W SM QE +A     +F+P+
Sbjct: 184 EGYEPKAEFVALA---GERLRIVRDPREAVAGAHLVSTDVWASMGQEDEAAARIALFRPY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QVN +L+  A  D LFMHCLPAHRGEE+  E+LD P+SV +D+AENRLH QKA+L
Sbjct: 241 QVNAALLDGAADDVLFMHCLPAHRGEEISEELLDDPRSVAWDQAENRLHAQKALL 295


>gi|254173482|ref|ZP_04880154.1| ornithine carbamoyltransferase [Thermococcus sp. AM4]
 gi|214032174|gb|EEB73004.1| ornithine carbamoyltransferase [Thermococcus sp. AM4]
          Length = 315

 Score =  299 bits (765), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 146/301 (48%), Positives = 195/301 (64%), Gaps = 5/301 (1%)

Query: 11  LSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLG 70
           L + +   L  I++ A+ +K  ++    ++ L GK LAMIF+KPSTRTR+SFEV +  LG
Sbjct: 13  LQDFTREELETILKTAEMMKIWNKIGKPHRVLEGKTLAMIFQKPSTRTRISFEVGIYQLG 72

Query: 71  GDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTD 130
           G  ++L+  ++QL R ETI DTA+VLSRYVD I+ R   H  + +L +YA+VPVIN L+D
Sbjct: 73  GYGLYLNAQDLQLRRGETIADTARVLSRYVDGIMARVYAHKDVEDLAKYASVPVINGLSD 132

Query: 131 NTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEP 190
            +HPCQ +AD  T  E +G ++G    + GDGNN+ HSL+    +    + +ATP G EP
Sbjct: 133 FSHPCQALADYQTILEKKGRIQGLKIVYVGDGNNVAHSLMIAGTKLGAHVVVATPEGYEP 192

Query: 191 RNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH-VFQPFQ 245
               + WA       G S  L HD VQAVK A  ++TD W SM QE +A E   +FQPFQ
Sbjct: 193 DERVIKWAEQNAAESGGSFELTHDPVQAVKDADVIYTDVWASMGQEAEAEERRKIFQPFQ 252

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGI 305
           VN  L+  A PD +FMHCLPAHRGEEV ++V+D P SVVFD+AENRLH QKA++    G 
Sbjct: 253 VNKELVKHAKPDYIFMHCLPAHRGEEVTDDVIDSPNSVVFDQAENRLHAQKAVMALVMGG 312

Query: 306 I 306
           I
Sbjct: 313 I 313


>gi|77165891|ref|YP_344416.1| ornithine carbamoyltransferase [Nitrosococcus oceani ATCC 19707]
 gi|123593641|sp|Q3J8G0|OTC_NITOC RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|76884205|gb|ABA58886.1| ornithine carbamoyltransferase [Nitrosococcus oceani ATCC 19707]
          Length = 304

 Score =  298 bits (764), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 154/299 (51%), Positives = 198/299 (66%), Gaps = 5/299 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT P HF  L ++ +  +  ++  A  +K         +PL  +VL M+FEK STRTRVS
Sbjct: 1   MTVP-HFLTLFDLPADEIRQLVRRAIDLKALQRQGKIYEPLKNQVLGMLFEKSSTRTRVS 59

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FEV M  LGG+ +FLS  + QLGR E + DTA+VLSR VD +++RT +HS L   + Y+ 
Sbjct: 60  FEVGMIQLGGNAVFLSPRDTQLGRGEPLEDTARVLSRMVDCLMVRTFSHSMLEHFSAYSQ 119

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVINALTD+ HPCQ++ADI T+ EHRG ++G+  +W GDGNN+  S I  A +F++ L+
Sbjct: 120 VPVINALTDSYHPCQLLADIQTYFEHRGDIQGRTVAWIGDGNNMCQSYINAACQFDFQLH 179

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREEHV 240
           IATP G  P    L  AR +   V +  +  +AV+GA  V TD W SM QE  K R    
Sbjct: 180 IATPAGYGPDPAILQMARER---VQIIAEPREAVRGADLVVTDVWTSMGQEKEKHRRLQD 236

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
              +QVN  LMS+A  DALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA+L
Sbjct: 237 LADYQVNGELMSLAKRDALFMHCLPAHRGEEVSAEVIDGPQSVVWDEAENRLHAQKALL 295


>gi|254434875|ref|ZP_05048383.1| ornithine carbamoyltransferase [Nitrosococcus oceani AFC27]
 gi|207091208|gb|EDZ68479.1| ornithine carbamoyltransferase [Nitrosococcus oceani AFC27]
          Length = 306

 Score =  298 bits (764), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 154/299 (51%), Positives = 198/299 (66%), Gaps = 5/299 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT P HF  L ++ +  +  ++  A  +K         +PL  +VL M+FEK STRTRVS
Sbjct: 3   MTVP-HFLTLFDLPADEIRQLVRRAIDLKALQRQGKIYEPLKNQVLGMLFEKSSTRTRVS 61

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FEV M  LGG+ +FLS  + QLGR E + DTA+VLSR VD +++RT +HS L   + Y+ 
Sbjct: 62  FEVGMIQLGGNAVFLSPRDTQLGRGEPLEDTARVLSRMVDCLMVRTFSHSMLEHFSAYSQ 121

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVINALTD+ HPCQ++ADI T+ EHRG ++G+  +W GDGNN+  S I  A +F++ L+
Sbjct: 122 VPVINALTDSYHPCQLLADIQTYFEHRGDIQGRTVAWIGDGNNMCQSYINAACQFDFQLH 181

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREEHV 240
           IATP G  P    L  AR +   V +  +  +AV+GA  V TD W SM QE  K R    
Sbjct: 182 IATPAGYGPDPAILQMARER---VQIIAEPREAVRGADLVVTDVWTSMGQEKEKHRRLQD 238

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
              +QVN  LMS+A  DALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA+L
Sbjct: 239 LADYQVNGELMSLAKRDALFMHCLPAHRGEEVSAEVIDGPQSVVWDEAENRLHAQKALL 297


>gi|327401264|ref|YP_004342103.1| Ornithine carbamoyltransferase [Archaeoglobus veneficus SNP6]
 gi|327316772|gb|AEA47388.1| Ornithine carbamoyltransferase [Archaeoglobus veneficus SNP6]
          Length = 305

 Score =  298 bits (763), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 147/300 (49%), Positives = 201/300 (67%), Gaps = 1/300 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH   +S++++  L+ I+E+A+K+K           L  K LAMIFE PSTRTRVSFEVA
Sbjct: 2   KHLLSISDLTAEELAEILELAEKLKAERYKGVVTDYLKNKSLAMIFELPSTRTRVSFEVA 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  ++L  +E+QLGR E I DTA+VLSRYV AI+MR  NHS L E   Y++VPVI
Sbjct: 62  MTDLGGHALYLGWNELQLGRGEPIKDTARVLSRYVHAIMMRVRNHSTLEEFAAYSSVPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L++  HPCQIIAD++T +E++GS++    +W GDGNN+ +SLI   A     + ++TP
Sbjct: 122 NGLSNLEHPCQIIADLLTIKEYKGSLEDVKVAWVGDGNNVCNSLILATALAGMEIVVSTP 181

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQPF 244
            G EP    +  A+   A++    + V+AVK A  ++TD W+SM QE + R+    F P+
Sbjct: 182 SGYEPDESIIKKAKELKANLKFESNPVKAVKDADVIYTDVWVSMGQESEKRKRLKDFGPY 241

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QVN  L+ +A  D + MHCLPAHRGEE+ +EV++G  SV+FD+AENRLH QKAILL   G
Sbjct: 242 QVNKKLVDVAKEDVIVMHCLPAHRGEEITDEVIEGASSVIFDQAENRLHAQKAILLKLIG 301


>gi|310644303|ref|YP_003949062.1| ornithine carbamoyltransferase (argf) [Paenibacillus polymyxa SC2]
 gi|309249254|gb|ADO58821.1| Ornithine carbamoyltransferase (ArgF) [Paenibacillus polymyxa SC2]
          Length = 318

 Score =  298 bits (763), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 145/304 (47%), Positives = 198/304 (65%), Gaps = 5/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F +L + S   +  +I++A +IK   +N    +PL GK L +IFEK STRTRVSFEV 
Sbjct: 15  RDFLELDDYSPEEIQYLIDLAIEIKRKHKNGEAYQPLKGKTLGLIFEKSSTRTRVSFEVG 74

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLS +++QLGR E I D A+V+SRY+D I++RT  H  ++EL  YA+VPVI
Sbjct: 75  MYQLGGHALFLSKNDIQLGRGEPISDMAQVMSRYLDGIMIRTFGHDNVVELARYASVPVI 134

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D  HPCQ++AD  T  E +G +KG   ++ GDGNN+ HSL+ G A+    ++IA+P
Sbjct: 135 NGLSDLAHPCQVLADYQTLYEQKGKLKGLKLAYIGDGNNMAHSLLIGGAKLGVHVSIASP 194

Query: 186 IGSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EHV 240
            G EP    +      A+  G+ + +     +AVK A  ++TD W SM  E + +E E  
Sbjct: 195 AGYEPDPSVIAVSREIAKQTGSEIVITQSPQEAVKDADAIYTDVWASMGFEEEQKERELA 254

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F  FQVN  L+ +A PD LF+HCLPAHRGEEV   V+DGP SV+FDEAENRLH QKA+L+
Sbjct: 255 FADFQVNEELVKLAKPDYLFLHCLPAHRGEEVSAGVIDGPNSVIFDEAENRLHAQKALLV 314

Query: 301 WCFG 304
              G
Sbjct: 315 ALMG 318


>gi|83644597|ref|YP_433032.1| ornithine carbamoyltransferase [Hahella chejuensis KCTC 2396]
 gi|83632640|gb|ABC28607.1| ornithine carbamoyltransferase [Hahella chejuensis KCTC 2396]
          Length = 304

 Score =  298 bits (762), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 149/295 (50%), Positives = 193/295 (65%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L + S + L  +IE A ++K    +   + P+ G+VL MIFEK STRTRVSFE  
Sbjct: 4   RHFLTLCDFSPTELEYLIERAIQLKAKHRSKQAHTPMQGQVLGMIFEKSSTRTRVSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
              LGG  IFLS  + QLGR E I D+A+VLSR VD I++RT  HS+L    +Y++ PVI
Sbjct: 64  AAQLGGSAIFLSPRDTQLGRGEPIEDSARVLSRMVDIIMIRTFEHSKLELFAKYSSAPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+ HPCQ++ADI T+ EHRG+++GK  +W GDGNN+ +S I  A +F + L +A P
Sbjct: 124 NALTDDYHPCQLLADIQTYVEHRGTIRGKKVAWIGDGNNMCNSYINAARQFGFELAVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREEHVFQPF 244
            G EP    +         V +F     AV GAH V TD W SM QE  +A  E  F  F
Sbjct: 184 EGYEPMQSLVE---QNADRVKIFRTPSDAVAGAHLVVTDVWASMGQEQEQAEREKAFAAF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QV+  LM+ A PDALFMHCLPAHRGEE+  ++LD  +SVV+DEAENRLH QKA++
Sbjct: 241 QVSPELMNKAAPDALFMHCLPAHRGEEISTDMLDDQRSVVWDEAENRLHAQKALM 295


>gi|302184727|ref|ZP_07261400.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. syringae
           642]
          Length = 306

 Score =  298 bits (762), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 148/295 (50%), Positives = 194/295 (65%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  + + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSMMDYTPDELLGLIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I D+AKV+SR +DA+V+RT  HS L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSHRDTQLGRGEPIADSAKVMSRMLDAVVIRTYAHSNLTEFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS+KGK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFLEHRGSIKGKTVAWIGDGNNMCNSYIEAAIQFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP  E+L  A   G  V +  D   AV GAH V TD W SM QE + AR + +F PF
Sbjct: 184 AGYEPNAEFLALA---GERVTVVRDPKAAVAGAHLVSTDVWTSMGQEEETARRKKLFAPF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QV  +L+ +A  D LFMHCLPAHRGEE+  ++LD  +SV +D+AENRLH QKA+L
Sbjct: 241 QVTRALLDLADKDVLFMHCLPAHRGEEISVDLLDDSRSVAWDQAENRLHAQKALL 295


>gi|315229813|ref|YP_004070249.1| ornithine carbamoyltransferase [Thermococcus barophilus MP]
 gi|315182841|gb|ADT83026.1| ornithine carbamoyltransferase [Thermococcus barophilus MP]
          Length = 315

 Score =  298 bits (762), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 146/301 (48%), Positives = 194/301 (64%), Gaps = 5/301 (1%)

Query: 11  LSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLG 70
           L + +   +  I+E AK +K  ++    ++ L GK LAMIF+KPSTRTR+SFEV M  LG
Sbjct: 13  LQDFTREEIETILETAKMMKIWNKIGKPHRVLEGKTLAMIFQKPSTRTRISFEVGMYQLG 72

Query: 71  GDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTD 130
           G  ++L+  ++QL R ETI DTA+VLSRYVD I+ R   H  + +L +YA+VPVIN L+D
Sbjct: 73  GYALYLNAQDLQLRRGETIADTARVLSRYVDGIMARVYAHKDVEDLAKYASVPVINGLSD 132

Query: 131 NTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEP 190
            +HPCQ +AD MT  E +G ++G    + GDGNN+ HSL+    +    + +ATP G EP
Sbjct: 133 FSHPCQALADYMTIWEKKGRIQGIKVVYVGDGNNVAHSLMIAGTKLGADVVVATPEGYEP 192

Query: 191 RNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQPFQ 245
             + + WA       G S  L HD V AVK A  ++TD W SM QE +A     +F+PFQ
Sbjct: 193 NEKVIKWAEKNAAESGGSFELLHDPVNAVKDADVIYTDVWASMGQEAEAEMRRKIFKPFQ 252

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGI 305
           VN  L+  A PD +FMHCLPAHRGEEV ++V+D P SVV+D+AENRLH QKA L    G 
Sbjct: 253 VNKELVKHAKPDYIFMHCLPAHRGEEVTDDVIDSPNSVVWDQAENRLHAQKAALALVMGG 312

Query: 306 I 306
           I
Sbjct: 313 I 313


>gi|330950005|gb|EGH50265.1| ornithine carbamoyltransferase [Pseudomonas syringae Cit 7]
          Length = 306

 Score =  298 bits (762), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 147/295 (49%), Positives = 195/295 (66%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  + + +   LS +I    ++K+        +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSMMDYTPDELSGLIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I D+AKV+SR +DA+++RT  HS L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSHRDTQLGRGEPIADSAKVMSRMLDAVMIRTYAHSNLTEFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS++GK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFLEHRGSIQGKTVAWIGDGNNMCNSYIEAAIQFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP  E+L  A   G  V +  D   AV GAH V TD W SM QE + AR + +F PF
Sbjct: 184 AGYEPNAEFLALA---GERVTVVRDPKAAVAGAHLVSTDVWTSMGQEEETARRKKLFAPF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QV  +L+ +A  D LFMHCLPAHRGEE+  ++LD  +SV +D+AENRLH QKA+L
Sbjct: 241 QVTRALLDLADKDVLFMHCLPAHRGEEISVDLLDDSRSVAWDQAENRLHAQKALL 295


>gi|51894155|ref|YP_076846.1| ornithine carbamoyltransferase [Symbiobacterium thermophilum IAM
           14863]
 gi|56749115|sp|Q67JZ8|OTC_SYMTH RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|51857844|dbj|BAD42002.1| ornithine carbamoyltransferase [Symbiobacterium thermophilum IAM
           14863]
          Length = 310

 Score =  298 bits (762), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 145/299 (48%), Positives = 198/299 (66%), Gaps = 5/299 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F  L + S   L  ++E+A   K   +    ++PL GK L M F KPSTRTR+SFEV 
Sbjct: 7   RDFISLHDWSRDELEEVLELAMWQKARLKAGIRDEPLKGKQLGMYFAKPSTRTRLSFEVG 66

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           ++ LGGD +FLS  ++QL R E+I DTA+V+SR++D I++RT +H  ++EL E+AT+PVI
Sbjct: 67  IRQLGGDALFLSAHDLQLQRGESIADTARVMSRFLDGIMIRTFSHREVVELAEWATIPVI 126

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ++AD++T  E  G++ G   ++ GDGNN+ HSL++G A+F   + +A+P
Sbjct: 127 NGLTDEEHPCQVVADLLTALERFGTLPGLKLAYVGDGNNVAHSLMDGGAKFGMHVVVASP 186

Query: 186 IGSEPRNEYLNWAR----NQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH-V 240
            G +P    +  A+      G  V +  D V AV GA  V+TD W SM QE +A +    
Sbjct: 187 EGYQPDPARVARAQVTAARYGGLVEVVTDPVLAVTGAQIVYTDVWASMGQEAEAEQRRKA 246

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           F  +QV   LM  A P+A+FMHCLPAHRGEEV  EV+DGPQS VFDEAENRLH QKAI+
Sbjct: 247 FAGYQVTAELMRCAAPEAIFMHCLPAHRGEEVAAEVIDGPQSAVFDEAENRLHAQKAIM 305


>gi|104780409|ref|YP_606907.1| ornithine carbamoyltransferase [Pseudomonas entomophila L48]
 gi|95109396|emb|CAK14096.1| ornithine carbamoyltransferase [Pseudomonas entomophila L48]
          Length = 306

 Score =  297 bits (761), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 148/295 (50%), Positives = 193/295 (65%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L + ++  L  +I    ++K+  +     +PL  +VL MIFEK STRTRVSFE  
Sbjct: 4   RHFLSLMDFTADELLGVIRRGIELKDLRKRGVLFEPLKSRVLGMIFEKSSTRTRVSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I D+A VLS  VDA+++RT  HS L E   ++ VPVI
Sbjct: 64  MIQLGGQAIFLSPRDTQLGRGEPIADSAIVLSSMVDAVMIRTHAHSTLTEFAAHSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D +HPCQ++AD+ TF EHRGS++GK  +W GDG N+ +S IE A +F++ L I  P
Sbjct: 124 NGLSDESHPCQLLADMQTFMEHRGSIQGKTVTWVGDGFNMCNSYIEAAVQFDFQLRITCP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP   +L      G  V +  D  +AV+GAH V TD W SM QE + AR    F P+
Sbjct: 184 GGYEPDPRFLQLG---GERVQIIRDPKEAVRGAHLVTTDVWTSMGQEEETARRLAHFAPY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QV   L+ +A PDALFMHCLPAHRGEE+  ++LD P+SV +DEAENRLH QKA+L
Sbjct: 241 QVTRELLDLAAPDALFMHCLPAHRGEEISQDLLDDPRSVAWDEAENRLHAQKALL 295


>gi|57640806|ref|YP_183284.1| ornithine carbamoyltransferase [Thermococcus kodakarensis KOD1]
 gi|73921523|sp|Q5JI16|OTC_PYRKO RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|57159130|dbj|BAD85060.1| ornithine carbamoyltransferase [Thermococcus kodakarensis KOD1]
          Length = 315

 Score =  297 bits (761), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 145/301 (48%), Positives = 196/301 (65%), Gaps = 5/301 (1%)

Query: 11  LSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLG 70
           L + +   L  I++ A+ +K  ++    ++ L GK LAMIF+KPSTRTR+SFEV +  LG
Sbjct: 13  LQDFTREELETILKTAEMMKIWNKIGKPHRVLEGKTLAMIFQKPSTRTRISFEVGIYQLG 72

Query: 71  GDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTD 130
           G  ++L+  ++QL R ETI DTA+VLSRYVD I+ R  +H  + +L +YA+VPVIN L+D
Sbjct: 73  GYGLYLNAQDLQLRRGETIADTARVLSRYVDGIMARVFDHKDVEDLAKYASVPVINGLSD 132

Query: 131 NTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEP 190
            +HPCQ +AD  T  E +G ++G    + GDGNN+ HSL+    +    + +ATP G EP
Sbjct: 133 FSHPCQALADYQTILEKKGRIQGLKIVYVGDGNNVAHSLMIAGTKLGANVVVATPEGYEP 192

Query: 191 RNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH-VFQPFQ 245
             + + WA       G S  L HD VQAVK A  ++TD W SM QE +A E   +F PFQ
Sbjct: 193 DPKVIKWAEQNAAESGGSFELLHDPVQAVKDADVIYTDVWASMGQEAEAEERRKIFMPFQ 252

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGI 305
           VN  L+  A PD +FMHCLPAHRGEEV ++V+D P SVVFD+AENRLH QKA++    G 
Sbjct: 253 VNKELVKHAKPDYIFMHCLPAHRGEEVTDDVIDSPNSVVFDQAENRLHAQKAVMALVMGG 312

Query: 306 I 306
           I
Sbjct: 313 I 313


>gi|307822449|ref|ZP_07652681.1| ornithine carbamoyltransferase [Methylobacter tundripaludum SV96]
 gi|307737015|gb|EFO07860.1| ornithine carbamoyltransferase [Methylobacter tundripaludum SV96]
          Length = 302

 Score =  297 bits (761), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 147/301 (48%), Positives = 196/301 (65%), Gaps = 8/301 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           P+HF  L ++S   L  +I     +KN+ +  ++  PL G+VLAMIFEK STRTR+SFE 
Sbjct: 3   PRHFISLLDLSGDELRSLINRGIVLKNNRDPDYQ--PLKGQVLAMIFEKSSTRTRISFES 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M H GG  +FLS  + QLGR E + D+A+V+S  VD I++RT  H  +    +Y++VPV
Sbjct: 61  GMSHFGGSALFLSPRDTQLGRGEPLQDSARVISSMVDCIMLRTDKHETVTTFAQYSSVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD  HPCQ++AD+ T+ EHRG +KGK  +W GDGNN+ HS I  A   ++ LNIA 
Sbjct: 121 INGLTDLQHPCQLLADMQTYFEHRGDIKGKTVTWIGDGNNMCHSYIHAATVLDFTLNIAC 180

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EHVFQP 243
           P   +P  + +  A   G  V  F   + A + +  V TD W SM QE + ++ E  F+ 
Sbjct: 181 PKDYQPLQDIVEAA---GERVRFFDTPLAAAQNSDLVVTDVWASMGQEEEQKQREMAFKN 237

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL--LW 301
           +QVN  +M +AH DALFMHCLPAHRGEEV  +V+DG QSV+FDEAENRLH QKA+L  L 
Sbjct: 238 YQVNAEVMKVAHNDALFMHCLPAHRGEEVSADVIDGAQSVIFDEAENRLHAQKALLEFLL 297

Query: 302 C 302
           C
Sbjct: 298 C 298


>gi|242279256|ref|YP_002991385.1| ornithine carbamoyltransferase [Desulfovibrio salexigens DSM 2638]
 gi|242122150|gb|ACS79846.1| ornithine carbamoyltransferase [Desulfovibrio salexigens DSM 2638]
          Length = 325

 Score =  297 bits (761), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 148/298 (49%), Positives = 202/298 (67%), Gaps = 4/298 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +H   ++++  S L  ++  AK++K+   N   N  L GK + MIFEK STRTRVSF+VA
Sbjct: 3   RHLLKINDVPRSELGQLLLRAKELKD---NKIRNNALEGKTVIMIFEKASTRTRVSFDVA 59

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           ++ LGG +IF++ +E QLGR+E + DTA+VLSRY DA+V+RT    ++  L EY +VPVI
Sbjct: 60  IEQLGGHSIFMTPAESQLGRSEPLEDTAQVLSRYADALVVRTFGQDKVRTLAEYGSVPVI 119

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD  HPCQ+++D++T  E    ++    +W GDGNN+ HS I  A  F + L +A P
Sbjct: 120 NALTDRYHPCQVLSDMLTIYERTPDLENVHVAWVGDGNNMAHSWINAAIYFPFYLTLAFP 179

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EHVFQPF 244
            G EP ++ L+ A + GA + L +D V+AVKGAH V TD + SM QE + ++ E  F  +
Sbjct: 180 KGYEPDHDILSRALSMGAKINLSYDPVEAVKGAHYVNTDVFASMGQEEEQKKRELAFAAY 239

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           QVN  L+  A PD   MHCLPAHRGEEV  EVLDGP+S++FD+AENRLH QKAIL W 
Sbjct: 240 QVNDELLKHADPDCKVMHCLPAHRGEEVTAEVLDGPRSIIFDQAENRLHMQKAILEWA 297


>gi|49084340|gb|AAT51193.1| PA3537 [synthetic construct]
          Length = 306

 Score =  297 bits (761), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 143/295 (48%), Positives = 196/295 (66%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF    + S   L  +I    ++K+        +PL  +VL M+FEK STRTR+SFE  
Sbjct: 4   RHFLSFMDYSPEELIGLIRRGSELKDLRNRGVLYEPLKSRVLGMVFEKASTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E IGD+A+V+SR +D +++RT  H+ L E   ++ VPVI
Sbjct: 64  MIQLGGQAIFLSPRDTQLGRGEPIGDSARVMSRMLDGVMIRTFAHATLTEFAAHSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS++GK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFHEHRGSIQGKTVAWIGDGNNMCNSYIEAALKFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQPF 244
            G EP+ E++  A   G  + +  D  +AV GAH V TD W SM QE +A     +F+P+
Sbjct: 184 EGYEPKAEFVALA---GDRLRVVRDPREAVAGAHLVSTDVWASMGQEDEAAARIALFRPY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QVN +L+  A  D LFMHCLPAHRGEE+  E+LD P+SV +D+AENRLH QKA+L
Sbjct: 241 QVNAALLDGAADDVLFMHCLPAHRGEEISEELLDDPRSVAWDQAENRLHAQKALL 295


>gi|46579509|ref|YP_010317.1| ornithine carbamoyltransferase [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120602942|ref|YP_967342.1| ornithine carbamoyltransferase [Desulfovibrio vulgaris DP4]
 gi|56404382|sp|Q72D35|OTC_DESVH RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|189036323|sp|A1VEP9|OTC_DESVV RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|46448923|gb|AAS95576.1| ornithine carbamoyltransferase [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120563171|gb|ABM28915.1| ornithine carbamoyltransferase [Desulfovibrio vulgaris DP4]
 gi|311233323|gb|ADP86177.1| ornithine carbamoyltransferase [Desulfovibrio vulgaris RCH1]
          Length = 300

 Score =  297 bits (761), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 143/300 (47%), Positives = 200/300 (66%), Gaps = 4/300 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           PKHF  + ++       ++E AK++K++    +  + L GKV  +IFEK STRTR+SFEV
Sbjct: 2   PKHFTRIRDLGFEGAWKVLERAKEMKDTG---YRGRTLEGKVATLIFEKASTRTRISFEV 58

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           A++HLGG TIF++ +E QLGR+E + DTA+V+SRY D +++RT   +++ EL  + ++PV
Sbjct: 59  AVRHLGGTTIFMTPAESQLGRSEPLRDTARVISRYTDCMIVRTFGQAKIDELASFGSIPV 118

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           +NALTD  HPCQ+++D++T  E    +     +W GDGNN+ +S IE A  F + L +A 
Sbjct: 119 VNALTDEGHPCQVMSDVLTMYERTPDLSQVRVAWIGDGNNMANSWIEAAMYFPFELFMAF 178

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQ-EFKAREEHVFQP 243
           P G EP  + L  A   GA + L  D   A+ GAH V TD W SM Q E + R E  F+ 
Sbjct: 179 PEGYEPDRQLLGLALEAGAKIFLTRDPHMAIDGAHYVNTDVWASMGQEEEQKRREAAFKG 238

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           F ++ +LM  AHPDA FMHCLPAHRGEEV +EV++ P S+V+D+AENRLH QKAIL W F
Sbjct: 239 FCIDGALMGRAHPDAKFMHCLPAHRGEEVTDEVMESPASIVWDQAENRLHMQKAILEWVF 298


>gi|331006661|ref|ZP_08329942.1| Ornithine carbamoyltransferase [gamma proteobacterium IMCC1989]
 gi|330419529|gb|EGG93914.1| Ornithine carbamoyltransferase [gamma proteobacterium IMCC1989]
          Length = 311

 Score =  297 bits (760), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 149/302 (49%), Positives = 202/302 (66%), Gaps = 4/302 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L+++S+  L+ II+ A ++K     +  +K L GKVL MIFEK STRTRVSFE  
Sbjct: 12  RHFLTLNDLSADELNIIIQRAIELKKIRSEVRLHKTLEGKVLGMIFEKSSTRTRVSFEAG 71

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  +FLS ++ QLGR E I D+A+V+S  VD +++RT  H  +    EY+ VP+I
Sbjct: 72  IAQLGGSGLFLSSNDTQLGRGEPIEDSARVISSMVDIVMIRTYAHQSIQTFAEYSKVPII 131

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NAL+D+ HPCQ++ADI T+ EHRG+ +GK   W GDGNN+ HS I  A   ++ L+IA P
Sbjct: 132 NALSDDYHPCQLLADIQTYTEHRGNPQGKTVVWVGDGNNMCHSYINAARLCDFTLHIACP 191

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQPF 244
            G EP  E +  A N    + LFH+  +AVKGA  V TDTW SM QE + +  E  F  F
Sbjct: 192 KGYEPNAELM--AAN-ADRIRLFHNTEEAVKGADWVVTDTWASMGQEEEKKIREDAFAAF 248

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QVN  LM +A+ DA+FMHCLPA+RG E+ + ++D P SVV+DEAENRLH QKA++ +  G
Sbjct: 249 QVNEELMQLANKDAIFMHCLPAYRGLEISDTIMDSPCSVVWDEAENRLHAQKALMEFLLG 308

Query: 305 II 306
            I
Sbjct: 309 AI 310


>gi|15598733|ref|NP_252227.1| ornithine carbamoyltransferase [Pseudomonas aeruginosa PAO1]
 gi|116051536|ref|YP_789628.1| ornithine carbamoyltransferase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218890236|ref|YP_002439100.1| ornithine carbamoyltransferase [Pseudomonas aeruginosa LESB58]
 gi|254236461|ref|ZP_04929784.1| ornithine carbamoyltransferase, anabolic [Pseudomonas aeruginosa
           C3719]
 gi|254242240|ref|ZP_04935562.1| ornithine carbamoyltransferase, anabolic [Pseudomonas aeruginosa
           2192]
 gi|296387960|ref|ZP_06877435.1| ornithine carbamoyltransferase [Pseudomonas aeruginosa PAb1]
 gi|313108882|ref|ZP_07794865.1| ornithine carbamoyltransferase, anabolic [Pseudomonas aeruginosa
           39016]
 gi|12230948|sp|P11724|OTC_PSEAE RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|9949687|gb|AAG06925.1|AE004774_3 ornithine carbamoyltransferase, anabolic [Pseudomonas aeruginosa
           PAO1]
 gi|115586757|gb|ABJ12772.1| ornithine carbamoyltransferase, anabolic [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126168392|gb|EAZ53903.1| ornithine carbamoyltransferase, anabolic [Pseudomonas aeruginosa
           C3719]
 gi|126195618|gb|EAZ59681.1| ornithine carbamoyltransferase, anabolic [Pseudomonas aeruginosa
           2192]
 gi|218770459|emb|CAW26224.1| ornithine carbamoyltransferase, anabolic [Pseudomonas aeruginosa
           LESB58]
 gi|310881367|gb|EFQ39961.1| ornithine carbamoyltransferase, anabolic [Pseudomonas aeruginosa
           39016]
          Length = 305

 Score =  297 bits (760), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 143/295 (48%), Positives = 196/295 (66%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF    + S   L  +I    ++K+        +PL  +VL M+FEK STRTR+SFE  
Sbjct: 4   RHFLSFMDYSPEELIGLIRRGSELKDLRNRGVLYEPLKSRVLGMVFEKASTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E IGD+A+V+SR +D +++RT  H+ L E   ++ VPVI
Sbjct: 64  MIQLGGQAIFLSPRDTQLGRGEPIGDSARVMSRMLDGVMIRTFAHATLTEFAAHSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS++GK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFHEHRGSIQGKTVAWIGDGNNMCNSYIEAALKFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQPF 244
            G EP+ E++  A   G  + +  D  +AV GAH V TD W SM QE +A     +F+P+
Sbjct: 184 EGYEPKAEFVALA---GDRLRVVRDPREAVAGAHLVSTDVWASMGQEDEAAARIALFRPY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QVN +L+  A  D LFMHCLPAHRGEE+  E+LD P+SV +D+AENRLH QKA+L
Sbjct: 241 QVNAALLDGAADDVLFMHCLPAHRGEEISEELLDDPRSVAWDQAENRLHAQKALL 295


>gi|212223581|ref|YP_002306817.1| ornithine carbamoyltransferase [Thermococcus onnurineus NA1]
 gi|212008538|gb|ACJ15920.1| ornithine carbamoyltransferase [Thermococcus onnurineus NA1]
          Length = 315

 Score =  297 bits (760), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 143/301 (47%), Positives = 197/301 (65%), Gaps = 5/301 (1%)

Query: 11  LSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLG 70
           L + +   +  I++ A+ +K  ++    ++ L GK LAMIF+KPSTRTR+SFEV +  LG
Sbjct: 13  LQDFTREEIETILKTAEMMKIWNKIGKPHRVLEGKTLAMIFQKPSTRTRISFEVGIYQLG 72

Query: 71  GDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTD 130
           G  ++L+ +++QL R ETI DTA+VLSRYVD I+ R  +H  +++L +YA VPVIN L+D
Sbjct: 73  GYGLYLNANDLQLRRGETIADTARVLSRYVDGIMARVFDHQDVVDLAKYADVPVINGLSD 132

Query: 131 NTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEP 190
            +HPCQ +AD  T  E +G ++G    + GDGNN+ HSL+    +    + +ATP G EP
Sbjct: 133 FSHPCQALADYQTILEKKGRIQGLKVVYVGDGNNVAHSLMIAGTKLGAHVVVATPEGYEP 192

Query: 191 RNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH-VFQPFQ 245
               + WA       G S  L HD V+AVK A  ++TD W SM QE +A E   +F+PFQ
Sbjct: 193 DKRVIKWAEQNAAESGGSFELLHDPVKAVKDADVIYTDVWASMGQEAEAEERRKIFKPFQ 252

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGI 305
           VN  L+  A PD +FMHCLPAHRG+EV ++V+D P SVVFDEAENRLH QKA++    G 
Sbjct: 253 VNKDLVKHAKPDYIFMHCLPAHRGDEVTDDVIDSPNSVVFDEAENRLHAQKAVMALVMGG 312

Query: 306 I 306
           I
Sbjct: 313 I 313


>gi|332188918|ref|ZP_08390621.1| ornithine carbamoyltransferase [Sphingomonas sp. S17]
 gi|332011058|gb|EGI53160.1| ornithine carbamoyltransferase [Sphingomonas sp. S17]
          Length = 307

 Score =  297 bits (760), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 145/306 (47%), Positives = 197/306 (64%), Gaps = 8/306 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-----PLSGKVLAMIFEKPSTRTRV 60
           +HF +L++     ++ I+  A+  K +     + +     PLSG VLAM+FEK STRTRV
Sbjct: 4   RHFLNLADAGPEGVTAILTDARVRKAARAGFTKGRVDADAPLSGHVLAMVFEKNSTRTRV 63

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF++A++ LGG +I L    MQLGR ETI DTA++LS Y DAI++RT +H+++ E+  YA
Sbjct: 64  SFDMAIRQLGGTSIVLDAGTMQLGRGETIADTARILSGYTDAIMIRTDDHAKVEEMAHYA 123

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +VPVIN LTD +HPCQI+AD++T  E    + G   +W GDGNN+LHS++E      + +
Sbjct: 124 SVPVINGLTDLSHPCQIMADLLTVIEAGKPLSGMKVAWLGDGNNVLHSIVEAGGLLGFDV 183

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
             A P G  P    L   R +        D   AV+GA  V TDTWISM Q     +   
Sbjct: 184 VAACPNGYHPEPGTLELGRGRATCTT---DPRVAVEGADIVVTDTWISMGQAHVEEKLAA 240

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
             PFQVN  LM++A PDA F+HCLPAHR EEV ++V+DGPQS+++ EAENRLH QK++L 
Sbjct: 241 MMPFQVNSELMALAKPDAKFLHCLPAHREEEVTSDVIDGPQSLIWPEAENRLHAQKSVLR 300

Query: 301 WCFGII 306
           WCFG I
Sbjct: 301 WCFGQI 306


>gi|70732188|ref|YP_261944.1| ornithine carbamoyltransferase [Pseudomonas fluorescens Pf-5]
 gi|68346487|gb|AAY94093.1| ornithine carbamoyltransferase [Pseudomonas fluorescens Pf-5]
          Length = 306

 Score =  297 bits (760), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 147/295 (49%), Positives = 196/295 (66%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSLMDCTPEELVSVIRRGIELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E IGD A V+SR +DA+++RT  HS L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSPRDTQLGRGEPIGDCAIVMSRMLDAVMIRTFAHSTLTEFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS++GK  +W GDGNN+ +S IE A +F++ L IA P
Sbjct: 124 NGLSDDLHPCQLLADMQTFLEHRGSIQGKTVAWIGDGNNMCNSYIEAAIQFDFQLRIACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP  +++  A   G  V +  D  +AV+GAH V TD W SM QE + A+   +F PF
Sbjct: 184 EGYEPNADFVAQA---GERVTIVRDPREAVRGAHLVSTDVWTSMGQEEETAKRLQLFAPF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QVN +L+ +A  D LFMHCLPAHRGEE+  ++LD P+SV +D+AENRLH QKA+L
Sbjct: 241 QVNRALLDLAAEDVLFMHCLPAHRGEEISLDLLDDPRSVAWDQAENRLHAQKALL 295


>gi|52079621|ref|YP_078412.1| ornithine carbamoyltransferase [Bacillus licheniformis ATCC 14580]
 gi|52784984|ref|YP_090813.1| ornithine carbamoyltransferase [Bacillus licheniformis ATCC 14580]
 gi|319646585|ref|ZP_08000814.1| ArgF protein [Bacillus sp. BT1B_CT2]
 gi|52002832|gb|AAU22774.1| ornithine carbamoyltransferase [Bacillus licheniformis ATCC 14580]
 gi|52347486|gb|AAU40120.1| ArgF [Bacillus licheniformis ATCC 14580]
 gi|317391173|gb|EFV71971.1| ArgF protein [Bacillus sp. BT1B_CT2]
          Length = 316

 Score =  296 bits (759), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 147/300 (49%), Positives = 203/300 (67%), Gaps = 11/300 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIK-NSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           K F  L + S   +  +++ A  +K N  ++IF+     GK LAMIFEK STRTRVSFE 
Sbjct: 17  KDFLSLKDFSKEEIVYLLKEAAAMKRNKIQDIFK-----GKTLAMIFEKSSTRTRVSFEA 71

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG+ +FLS  +MQLGR ETI DTAKVLSRYVDAI++RT  H ++ EL ++A +PV
Sbjct: 72  GMAQLGGNALFLSSKDMQLGRGETIADTAKVLSRYVDAIMIRTFEHEKVEELAKHAEIPV 131

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD  HPCQ ++D++T +E +G++KG    + GDGNN+ HSL+ G A+    + +A+
Sbjct: 132 INGLTDLFHPCQALSDLLTIQEMKGTLKGLKAVYVGDGNNVAHSLLIGCAKVGCDITVAS 191

Query: 185 PIGSEPRNEYLN----WARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-H 239
           P G EP  + +     +A   GA+V + +D V AV+ A  +++D + SM QE +A E   
Sbjct: 192 PKGYEPNQDVVKLAETFAEESGAAVTITNDPVSAVQQADVIYSDVFTSMGQEEEAEERMK 251

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           +F P+QVN +L+S A PD +F+HCLPAHR EEV  E++DGP S VF +AENRLH QKA+L
Sbjct: 252 IFAPYQVNGTLVSHAKPDYIFLHCLPAHREEEVTAEIIDGPNSAVFQQAENRLHVQKALL 311


>gi|332703917|ref|ZP_08424005.1| Ornithine carbamoyltransferase [Desulfovibrio africanus str. Walvis
           Bay]
 gi|332554066|gb|EGJ51110.1| Ornithine carbamoyltransferase [Desulfovibrio africanus str. Walvis
           Bay]
          Length = 325

 Score =  296 bits (759), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 147/300 (49%), Positives = 201/300 (67%), Gaps = 4/300 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF D+ ++  S    ++  AK++K++      ++ L+GKVL MIFEK STRTR+SFE+A
Sbjct: 6   KHFLDILDMPRSQSWALVTRAKEMKDTDHR---SQVLAGKVLVMIFEKASTRTRLSFEMA 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           ++HLGGDTIF++  E QLGR+E + DTA+V+SRY   +++RT    +L EL EYA+VPV+
Sbjct: 63  VRHLGGDTIFMTPHESQLGRSEPLKDTARVISRYCAGMIVRTFGQEKLEELAEYASVPVV 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NAL+D  HPCQ+++D++T  E   S K    +W GDGNN+ HS I  A  F + L++A P
Sbjct: 123 NALSDLHHPCQVLSDLLTMYERTPSFKDLKVAWIGDGNNMAHSWINAAIYFPFYLSLAVP 182

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREEHVFQPF 244
            G EP    LN A   GA + + H+   A+ GAH V TD W SM QE  +      F  F
Sbjct: 183 KGFEPDARILNKAVQLGARIHVSHEPKLAMDGAHYVNTDVWASMGQESEQGARSKPFANF 242

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QVN  L+ +A P+   MHCLPAHRGEE+ +EV++GP S+V+D+AENRLH QKAIL W FG
Sbjct: 243 QVNDELLKLADPEVKVMHCLPAHRGEEITDEVMEGPASIVWDQAENRLHMQKAILEWVFG 302


>gi|330973087|gb|EGH73153.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 306

 Score =  296 bits (759), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 147/295 (49%), Positives = 194/295 (65%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  + + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSMMDYTPDELLGLIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I D+AKV+SR +DA+++RT  HS L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSHRDTQLGRGEPIADSAKVMSRMLDAVMIRTYAHSNLTEFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS+KGK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFLEHRGSIKGKTVAWVGDGNNMCNSYIEAAIQFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP  E+L  A   G  V +  D   AV GAH V TD W SM QE + AR + +F PF
Sbjct: 184 AGYEPNAEFLALA---GERVTVVRDPKAAVAGAHLVSTDVWTSMGQEEETARRKKLFAPF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QV  +L+ +A  D LFMHCLPAHRGEE+  ++LD  +SV +D+AENRLH QKA+L
Sbjct: 241 QVTRALLDLADKDVLFMHCLPAHRGEEISVDLLDDSRSVAWDQAENRLHAQKALL 295


>gi|239907290|ref|YP_002954031.1| ornithine carbamoyltransferase [Desulfovibrio magneticus RS-1]
 gi|239797156|dbj|BAH76145.1| ornithine carbamoyltransferase [Desulfovibrio magneticus RS-1]
          Length = 302

 Score =  296 bits (759), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 143/300 (47%), Positives = 200/300 (66%), Gaps = 4/300 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           P+HF  + + S    + I++ A  +K +      +  L+GK   +IFEK STRTRVSFEV
Sbjct: 2   PRHFLTILDFSRDEAARILDRAAAMKAADHR---SDLLAGKTCILIFEKASTRTRVSFEV 58

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           A++HLGG  IF++ ++ QLGR E I DTA+VLSRY D +++RT  H +L++L  Y ++PV
Sbjct: 59  AVRHLGGWPIFMTQNDSQLGRDEPIRDTARVLSRYADCLIVRTFGHDKLVDLAGYGSIPV 118

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           +NAL+D  HPCQI+AD++T  EH G + G   ++ GDGNNI HS+I  AARF   + IA+
Sbjct: 119 VNALSDAYHPCQIMADLLTMREHSGRLDGLKLAYVGDGNNIAHSIINAAARFPIRVAIAS 178

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQP 243
           P G +P    +  AR QGA V +  D  +A  GA  ++TD W SM QE + A    +F  
Sbjct: 179 PDGYKPDPAVVAKAREQGADVTITTDPAEAAAGADYLYTDVWASMGQEAEHAARVKIFAG 238

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +Q+N +L++ A P A  +HCLPAHRGEE+ + V++GP S+V+DEAENRLH QKAIL W F
Sbjct: 239 YQINDALLAKAAPGAKVLHCLPAHRGEEITDAVMEGPSSIVWDEAENRLHVQKAILEWVF 298


>gi|66047128|ref|YP_236969.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. syringae
           B728a]
 gi|63257835|gb|AAY38931.1| Ornithine carbamoyltransferase [Pseudomonas syringae pv. syringae
           B728a]
          Length = 306

 Score =  296 bits (758), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 147/295 (49%), Positives = 194/295 (65%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  + + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSMMDYTPDELLGLIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I D+AKV+SR +DA+++RT  HS L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSHRDTQLGRGEPIADSAKVMSRMLDAVMIRTYAHSNLTEFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS+KGK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFLEHRGSIKGKTVAWIGDGNNMCNSYIEAAIQFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP  E+L  A   G  V +  D   AV GAH V TD W SM QE + AR + +F PF
Sbjct: 184 AGYEPNAEFLALA---GERVTVVRDPKAAVAGAHLVSTDVWTSMGQEEETARRKKLFAPF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QV  +L+ +A  D LFMHCLPAHRGEE+  ++LD  +SV +D+AENRLH QKA+L
Sbjct: 241 QVTRALLDLADKDVLFMHCLPAHRGEEISVDLLDDSRSVAWDQAENRLHAQKALL 295


>gi|16126481|ref|NP_421045.1| ornithine carbamoyltransferase [Caulobacter crescentus CB15]
 gi|221235261|ref|YP_002517698.1| ornithine carbamoyltransferase [Caulobacter crescentus NA1000]
 gi|32699477|sp|Q9A653|OTC_CAUCR RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|13423751|gb|AAK24213.1| ornithine carbamoyltransferase, anabolic [Caulobacter crescentus
           CB15]
 gi|220964434|gb|ACL95790.1| ornithine carbamoyltransferase [Caulobacter crescentus NA1000]
          Length = 311

 Score =  296 bits (758), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 144/310 (46%), Positives = 193/310 (62%), Gaps = 5/310 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-----PLSGKVLAMIFEKPST 56
           MT P+HF DL  +  + L  +++ A   K + +   + K     P   +VL+MIF+K ST
Sbjct: 1   MTQPRHFIDLWKLDGATLRLLLDDAHARKAARKGWPQGKVDADAPAKDRVLSMIFQKNST 60

Query: 57  RTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLEL 116
           RTR SF+ AM+ LGG  I  + S+MQLGR ETI DTAKVLSR VDA+++R  +H+ +   
Sbjct: 61  RTRFSFDAAMRQLGGSAIISTASDMQLGRGETIEDTAKVLSRMVDAVMIRANSHADVERF 120

Query: 117 TEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARF 176
            + +TVP+IN LTD +HPCQI+ADI+T EEHRG + GK  +W GDGNN+  S I  A   
Sbjct: 121 AQVSTVPIINGLTDKSHPCQIMADILTIEEHRGPIAGKTIAWVGDGNNVCSSFIHAAPLL 180

Query: 177 NYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR 236
            + L IA P         L  A      V++  D   AV GA  V  DTW+SM       
Sbjct: 181 GFELKIACPAVYHADLHDLARAEGLQGKVSMTTDPKAAVSGADVVVADTWVSMGDTDHDE 240

Query: 237 EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
                +P+QV+  LM +A  + +F+HCLPAHRGEEV + VLDGP+S+V+DEAENR+H QK
Sbjct: 241 RLAALEPYQVDDRLMDLAAGNGVFLHCLPAHRGEEVTDAVLDGPRSLVWDEAENRIHAQK 300

Query: 297 AILLWCFGII 306
           ++L WCFG I
Sbjct: 301 SVLAWCFGAI 310


>gi|114320260|ref|YP_741943.1| ornithine carbamoyltransferase [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226654|gb|ABI56453.1| ornithine carbamoyltransferase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 303

 Score =  296 bits (758), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 146/297 (49%), Positives = 195/297 (65%), Gaps = 4/297 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
           +P+HF  L + +   L  +I  A ++K+  +    ++PL GKVL M+FEK STRTRV+FE
Sbjct: 2   HPRHFLTLLDFTPDELRRVIHRASELKHIRDQGQLHEPLRGKVLGMVFEKSSTRTRVAFE 61

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
             M  LGG  IFLS  + QLGR E + DTA+VLSR VD I++RT  H  L    EY+ VP
Sbjct: 62  AGMNQLGGSAIFLSPRDTQLGRGEPVEDTARVLSRMVDIIMIRTYGHEVLERFAEYSRVP 121

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN L+D  HPCQ++ADI  +E HRGS++G+  +W GDGNN+ HS I  A + ++ L IA
Sbjct: 122 VINGLSDRFHPCQLLADIQAYEAHRGSIQGRTVAWVGDGNNMCHSWINAARQLDFQLRIA 181

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQ 242
            P G +P  + ++     G  V++  D  +AV+G H V TD W SM QE +A+     F 
Sbjct: 182 VPEGYDPDPDLIHAG---GDRVSVHRDPREAVEGVHLVTTDVWASMGQEEEAKARMKAFS 238

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F V+ +LM +A  DA+FMHCLPAHRGEEV   V+DGPQSVV+DEAENRLH  KA++
Sbjct: 239 GFCVDDALMGLAAKDAVFMHCLPAHRGEEVSASVIDGPQSVVWDEAENRLHAHKALM 295


>gi|296332546|ref|ZP_06875007.1| ornithine carbamoyltransferase [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305673827|ref|YP_003865499.1| ornithine carbamoyltransferase [Bacillus subtilis subsp. spizizenii
           str. W23]
 gi|296150464|gb|EFG91352.1| ornithine carbamoyltransferase [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305412071|gb|ADM37190.1| ornithine carbamoyltransferase [Bacillus subtilis subsp. spizizenii
           str. W23]
          Length = 314

 Score =  296 bits (758), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 149/302 (49%), Positives = 201/302 (66%), Gaps = 11/302 (3%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIK-NSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           Y K    L  +S  +++ ++  A ++K N  + IF+     GK LAMIFEK STRTRVSF
Sbjct: 10  YGKDLLTLKGLSEQDINALLAEAGELKRNKIQPIFQ-----GKTLAMIFEKSSTRTRVSF 64

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E  M  LGG  +FLS  ++QLGR ETI DTAKVLS YVDAI++RT  H ++ EL + A +
Sbjct: 65  EAGMAQLGGSALFLSQKDLQLGRGETIADTAKVLSGYVDAIMIRTYEHEKVEELAKEADI 124

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVIN LTD  HPCQ +AD++T +E +G +KG   ++ GDGNN+ HSL+ G A+    ++I
Sbjct: 125 PVINGLTDKYHPCQALADLLTIKEMKGKLKGVKVAYIGDGNNVAHSLMIGCAKMGCEISI 184

Query: 183 ATPIGSEPRNEYLNWAR----NQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE 238
           A+P G E  +E +  A+      GAS+ L  D V+AVK A  +++D + SM QE + +E 
Sbjct: 185 ASPKGYEVLDEAVEAAKTSALQSGASITLTADPVEAVKDADVIYSDVFTSMGQEAEEQER 244

Query: 239 -HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
             VF P+QVN +L+S A PD  F+HCLPAHR EEV  E++DGP S VF +AENRLH QKA
Sbjct: 245 LAVFAPYQVNAALVSHAKPDYTFLHCLPAHREEEVTAEIIDGPNSAVFQQAENRLHVQKA 304

Query: 298 IL 299
           +L
Sbjct: 305 LL 306


>gi|167462073|ref|ZP_02327162.1| ornithine carbamoyltransferase [Paenibacillus larvae subsp. larvae
           BRL-230010]
 gi|322383017|ref|ZP_08056847.1| ornithine carbamoyltransferase-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
 gi|321153040|gb|EFX45500.1| ornithine carbamoyltransferase-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
          Length = 319

 Score =  296 bits (758), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 144/304 (47%), Positives = 200/304 (65%), Gaps = 5/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F  LS+ S   L  ++ +AK +K   ++   ++ L GK L MIFEK STRTRVSFEV 
Sbjct: 16  RDFLSLSDYSPEELHYLLHLAKDLKQKQKSGIPHQKLLGKSLGMIFEKSSTRTRVSFEVG 75

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLS +++QLGR ETI DTA+ LSRY+D I++RT  HS++++L   AT+PVI
Sbjct: 76  MFQLGGQALFLSKNDIQLGRGETIHDTAQTLSRYIDGIMIRTFEHSKVIDLARGATIPVI 135

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD++HPCQ + D MT  EH+G + G   ++ GDGNN++HSL+ GAA+F+    +A+P
Sbjct: 136 NGLTDSSHPCQALTDYMTVLEHKGKLAGLKIAYIGDGNNMVHSLLIGAAKFSMQAAVASP 195

Query: 186 IGSEPRNEYLNWAR----NQGASVALFHDAVQAVKGAHCVFTDTWISMN-QEFKAREEHV 240
            G  P  + +  A+      G S+ +  +  +A+  A  V+TD W SM  +E +A  E  
Sbjct: 196 EGYMPDKQVIQTAKEVASQTGGSILITQEPKEAIAEADIVYTDVWASMGFEEEQAARERA 255

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F  +QVN  L+  A PD LFMHCLPAHRGEEV  E++DG  S+VFD+AE RLH QKA++L
Sbjct: 256 FVNYQVNEELVQFAKPDYLFMHCLPAHRGEEVSAEIIDGKHSIVFDQAEKRLHAQKAVML 315

Query: 301 WCFG 304
              G
Sbjct: 316 ALMG 319


>gi|167629524|ref|YP_001680023.1| ornithine carbamoyltransferase [Heliobacterium modesticaldum Ice1]
 gi|167592264|gb|ABZ84012.1| ornithine carbamoyltransferase [Heliobacterium modesticaldum Ice1]
          Length = 318

 Score =  296 bits (758), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 144/299 (48%), Positives = 197/299 (65%), Gaps = 5/299 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F  L + S   +   I++A+++K   ++   +  L+GK L MIF K STRTRVSFEV 
Sbjct: 16  RDFLSLHDFSRDEIFYFIDLARQLKALQKDRIPHPYLAGKTLGMIFTKSSTRTRVSFEVG 75

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG+ +FLS +++QLGR E I DTA+VLSRYVD I++RT  HS ++EL +YA +PVI
Sbjct: 76  MYQLGGNALFLSSADIQLGRGEPIKDTARVLSRYVDGIMIRTFAHSDVVELAQYADIPVI 135

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ++AD+MT  E++G   G   ++ GDGNN+ H L+ G A+    + I TP
Sbjct: 136 NGLTDLLHPCQVLADLMTIVEYKGKTDGLKMTFIGDGNNMAHELMFGGAKAGMDVVICTP 195

Query: 186 IGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HV 240
               P  E +      A+  G S+ L  D V A K A  ++TD W SM QE +A+E    
Sbjct: 196 EAYRPEPEIVRIATEDAKAHGGSITLMSDPVAASKDADVLYTDVWASMGQEGEAQERAQA 255

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           FQ F ++ ++M  AHP A+ +HCLPAHRGEE+ +EV++GPQS VFDEAENRLH QKAI+
Sbjct: 256 FQGFMIDGTIMKAAHPKAIVLHCLPAHRGEEITDEVIEGPQSAVFDEAENRLHAQKAIM 314


>gi|313497445|gb|ADR58811.1| Ornithine carbamoyltransferase [Pseudomonas putida BIRD-1]
          Length = 306

 Score =  296 bits (758), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 148/295 (50%), Positives = 193/295 (65%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L + ++  L  +I    ++K+  +     +PL  +VL MIFEK STRTRVSFE  
Sbjct: 4   RHFLSLLDFTTDELLGVIRRGIELKDLRKRGVLFEPLKNRVLGMIFEKSSTRTRVSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E IGD+A VLS  VDA+++RT  HS L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSPRDTQLGRGEPIGDSAIVLSSMVDAVMIRTHAHSTLTEFAAKSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D +HPCQ++AD+ TF EHRGS++GK  +W GDG N+ +S IE A +F++ L IA P
Sbjct: 124 NGLSDESHPCQLLADMQTFVEHRGSIQGKTVTWIGDGFNMCNSYIEAARQFDFQLRIACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP   ++      G  V +  DA +AV+ AH V TD W SM QE + AR    F P+
Sbjct: 184 EGYEPDQRFMALG---GDRVQIIRDAREAVRDAHLVVTDVWTSMGQEEETARRLAHFAPY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QV   L+ +A PD LFMHCLPAHRGEE+  ++LD P+SV +DEAENRLH QKA+L
Sbjct: 241 QVTRELLDLAAPDVLFMHCLPAHRGEEISQDLLDDPRSVAWDEAENRLHAQKALL 295


>gi|261419032|ref|YP_003252714.1| ornithine carbamoyltransferase [Geobacillus sp. Y412MC61]
 gi|297530996|ref|YP_003672271.1| ornithine carbamoyltransferase [Geobacillus sp. C56-T3]
 gi|319765849|ref|YP_004131350.1| ornithine carbamoyltransferase [Geobacillus sp. Y412MC52]
 gi|261375489|gb|ACX78232.1| ornithine carbamoyltransferase [Geobacillus sp. Y412MC61]
 gi|297254248|gb|ADI27694.1| ornithine carbamoyltransferase [Geobacillus sp. C56-T3]
 gi|317110715|gb|ADU93207.1| ornithine carbamoyltransferase [Geobacillus sp. Y412MC52]
          Length = 312

 Score =  296 bits (757), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 146/265 (55%), Positives = 192/265 (72%), Gaps = 5/265 (1%)

Query: 41  PLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYV 100
           PLSGK +AMIFEKPSTRTRVSFEV M  LGG  ++L+G+++QLGR ETI DTA+VLS+YV
Sbjct: 45  PLSGKTMAMIFEKPSTRTRVSFEVGMIQLGGQAMYLNGNDLQLGRGETIADTARVLSQYV 104

Query: 101 DAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSG 160
           D +++RT  H ++ EL EYA+VPVIN LTD+ HPCQ +AD++T  E + + +G   ++ G
Sbjct: 105 DVMMIRTFAHQKVEELAEYASVPVINGLTDDDHPCQALADLLTIYEAKKTFQGVKLAYVG 164

Query: 161 DGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARN----QGASVALFHDAVQAVK 216
           DGNN+ ++L+  AA+    + IA P G EP+ EY+  AR      GA+V + HD ++AV 
Sbjct: 165 DGNNVANALLAAAAKVGMDIFIACPPGYEPKEEYVEAARQIGEKTGATVVVTHDPLEAVA 224

Query: 217 GAHCVFTDTWISMNQEFKAREE-HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINE 275
           GA  ++TD W SM QE ++ E   VFQP+QVN  L   A PD LF+HCLPAHRGEEV   
Sbjct: 225 GADAIYTDVWTSMGQESESAERLQVFQPYQVNEELAKAAKPDYLFLHCLPAHRGEEVTAG 284

Query: 276 VLDGPQSVVFDEAENRLHTQKAILL 300
           V+DGP SVVF++A NRLH QKAIL+
Sbjct: 285 VMDGPNSVVFEQAGNRLHAQKAILV 309


>gi|242399560|ref|YP_002994985.1| Ornithine carbamoyltransferase [Thermococcus sibiricus MM 739]
 gi|242265954|gb|ACS90636.1| Ornithine carbamoyltransferase [Thermococcus sibiricus MM 739]
          Length = 315

 Score =  296 bits (757), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 145/301 (48%), Positives = 195/301 (64%), Gaps = 5/301 (1%)

Query: 11  LSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLG 70
           L + +   +  I++ A+ +K  ++    ++ L GK LAMIF+KPSTRTR+SFEV +  LG
Sbjct: 13  LQDFTREEIETILKTAEMMKIWNKIGKPHRVLEGKTLAMIFQKPSTRTRISFEVGIYQLG 72

Query: 71  GDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTD 130
           G  ++L+  ++QL R ETI DTA+VLSRYVD I+ R  +H  +++L +Y +VPVIN L+D
Sbjct: 73  GYGLYLNAQDLQLRRGETIADTARVLSRYVDGIMARVFDHQDVVDLAKYGSVPVINGLSD 132

Query: 131 NTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEP 190
            +HPCQ +AD MT +E +G ++G    + GDGNN+ HSL+    +    + +ATP G EP
Sbjct: 133 FSHPCQALADYMTIKEKKGRIEGIKVVYVGDGNNVAHSLMIAGTKLGANVVVATPEGYEP 192

Query: 191 RNEYLNWAR----NQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH-VFQPFQ 245
               + WA       G S  L HD VQAVK A  ++TD W SM QE +A E   VF PFQ
Sbjct: 193 DARVIKWAEENAAESGGSFELLHDPVQAVKDADVIYTDVWASMGQEAEAEERRKVFMPFQ 252

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGI 305
           VN  L+  A  D +FMHCLPAHRGEEV ++V+D P SVVFDEAENRLH QKA +    G 
Sbjct: 253 VNKDLVKHAKKDYIFMHCLPAHRGEEVTDDVVDSPNSVVFDEAENRLHAQKAAMALIMGG 312

Query: 306 I 306
           I
Sbjct: 313 I 313


>gi|261883843|ref|ZP_06007882.1| ornithine carbamoyltransferase [Campylobacter fetus subsp.
           venerealis str. Azul-94]
          Length = 215

 Score =  296 bits (757), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 138/210 (65%), Positives = 170/210 (80%), Gaps = 1/210 (0%)

Query: 49  MIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTT 108
           MIFEK STRTRVSF+V M+ LGG+TI L+GSEMQLGR+ETI DTAKVLSRYVDAI++RTT
Sbjct: 1   MIFEKLSTRTRVSFDVGMRQLGGETIMLTGSEMQLGRSETIADTAKVLSRYVDAIMIRTT 60

Query: 109 NHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHS 168
            H R+LEL EYATVPVINALTD+THPCQI+AD++T+EEHRG +KGK F+W GDGNN+LHS
Sbjct: 61  AHERMLELAEYATVPVINALTDDTHPCQIMADVLTYEEHRGPIKGKTFAWMGDGNNVLHS 120

Query: 169 LIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWIS 228
           L+E AARF+  +NIAT  GSEP+++Y++WAR+ GA +    D  +A  GA C+ TDTW+S
Sbjct: 121 LVEAAARFDLNVNIATRKGSEPKSQYIDWARSIGAGIMSTTDPEKAASGADCMVTDTWVS 180

Query: 229 MNQEFKAREEHVFQPFQVNLSLMSMA-HPD 257
           M QE  AR  +VF P QVN  LM++  H D
Sbjct: 181 MGQEDHARAHNVFIPDQVNQPLMAVVEHKD 210


>gi|229588686|ref|YP_002870805.1| ornithine carbamoyltransferase [Pseudomonas fluorescens SBW25]
 gi|229360552|emb|CAY47409.1| ornithine carbamoyltransferase [Pseudomonas fluorescens SBW25]
          Length = 306

 Score =  296 bits (757), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 146/295 (49%), Positives = 195/295 (66%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L + +   L  +I    ++K+        +PL  +VL MIFEK STRTRVSFE  
Sbjct: 4   RHFLSLMDCTPEELVSVIRRGIELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRVSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I D+A+V+SR +DA+++RT  HS + E   ++ VPVI
Sbjct: 64  MIQLGGQAIFLSSRDTQLGRGEPIADSARVMSRMLDAVMIRTFAHSTVTEFAAHSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS++GK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFLEHRGSIQGKTVAWIGDGNNMCNSYIEAAIQFDFHLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP  E+L  A  +   V L  D   AV GAH V TD W SM QE + A+   +F P+
Sbjct: 184 EGFEPSAEFLAKADGR---VQLLRDPKDAVVGAHLVSTDVWTSMGQEDETAKRLALFAPY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QV   L+ +A PD LFMHCLPAHRGEE+  ++LD P+SV +D+AENRLH QKA+L
Sbjct: 241 QVTRELLDLAAPDVLFMHCLPAHRGEEISLDLLDDPRSVAWDQAENRLHAQKALL 295


>gi|308071072|ref|YP_003872677.1| Ornithine carbamoyltransferase (OTCase) [Paenibacillus polymyxa
           E681]
 gi|305860351|gb|ADM72139.1| Ornithine carbamoyltransferase (OTCase) [Paenibacillus polymyxa
           E681]
          Length = 318

 Score =  296 bits (757), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 144/300 (48%), Positives = 197/300 (65%), Gaps = 5/300 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F +L N S   +  +I++A +IK   +N    +PL GK L +IFEK STRTRVSFEV 
Sbjct: 15  RDFLELDNYSPEEIQYLIDLAIEIKRKHKNGETYQPLKGKTLGLIFEKSSTRTRVSFEVG 74

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLS +++QLGR E I D A+V+SRY+D I++RT  H  ++EL  YA+VPVI
Sbjct: 75  MYQLGGHALFLSKNDIQLGRGEPISDMAQVMSRYLDGIMIRTFGHDNVVELARYASVPVI 134

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D  HPCQ++AD  T  E +G +KG   ++ GDGNN+ HSL+ G A+    ++IA+P
Sbjct: 135 NGLSDLAHPCQVLADYQTLYEQKGKLKGLKLAYIGDGNNMAHSLLIGGAKLGVHVSIASP 194

Query: 186 IGSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EHV 240
            G EP    +      A+  G+ + +     +AV+ A  ++TD W SM  E + +E E  
Sbjct: 195 AGYEPDPNVVAASREIAKQTGSEIVITQSPQEAVQDADAIYTDVWASMGFEEEQKERELA 254

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F  FQVN  L+ +A PD LF+HCLPAHRGEEV   V+DGP SV+FDEAENRLH QKA+L+
Sbjct: 255 FADFQVNEELVKLAKPDYLFLHCLPAHRGEEVSAGVIDGPNSVIFDEAENRLHAQKALLV 314


>gi|330898566|gb|EGH29985.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 306

 Score =  296 bits (757), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 146/295 (49%), Positives = 195/295 (66%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  + + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSMMDYTPDELLGLIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I D+AKV+SR +DA+++RT  HS L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSHRDTQLGRGEPIADSAKVMSRMLDAVMIRTYAHSNLTEFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS++GK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFLEHRGSIQGKTVAWIGDGNNMCNSYIEAAIQFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP  E+L  A   G  V +  D   AV+GAH V TD W SM QE + AR + +F PF
Sbjct: 184 AGYEPNAEFLALA---GERVTVVRDPKAAVEGAHLVSTDVWTSMGQEEETARRKKLFAPF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QV  +L+ +A  D LFMHCLPAHRGEE+  ++LD  +SV +D+AENRLH QKA+L
Sbjct: 241 QVTRALLDLADKDVLFMHCLPAHRGEEISVDLLDDARSVAWDQAENRLHAQKALL 295


>gi|330937569|gb|EGH41509.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. pisi str.
           1704B]
          Length = 305

 Score =  296 bits (757), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 146/295 (49%), Positives = 195/295 (66%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  + + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSMMDYTPDELLGLIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I D+AKV+SR +DA+++RT  HS L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSHRDTQLGRGEPIADSAKVMSRMLDAVMIRTYAHSNLTEFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS++GK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFLEHRGSIQGKTVAWIGDGNNMCNSYIEAAIQFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP  E+L  A   G  V +  D   AV+GAH V TD W SM QE + AR + +F PF
Sbjct: 184 AGYEPNAEFLALA---GERVTVVRDPKAAVEGAHLVSTDVWTSMGQEEETARRKKLFAPF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QV  +L+ +A  D LFMHCLPAHRGEE+  ++LD  +SV +D+AENRLH QKA+L
Sbjct: 241 QVTRALLDLADKDVLFMHCLPAHRGEEISVDLLDDARSVAWDQAENRLHAQKALL 295


>gi|326796229|ref|YP_004314049.1| ornithine carbamoyltransferase [Marinomonas mediterranea MMB-1]
 gi|326546993|gb|ADZ92213.1| Ornithine carbamoyltransferase [Marinomonas mediterranea MMB-1]
          Length = 301

 Score =  295 bits (756), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 152/296 (51%), Positives = 196/296 (66%), Gaps = 4/296 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           P+HF  L ++++     +I  A ++K         +PL  +VLAMIFEK STRTRVSFE 
Sbjct: 3   PRHFLTLKDLTTEEFKQLISRAIELKKMQREGVIYEPLKNRVLAMIFEKSSTRTRVSFES 62

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M   GG  +FLS  + QLGR E I D+AKV+S  VDA+++RT  H ++    + ++VPV
Sbjct: 63  GMAQFGGHALFLSPRDTQLGRGEPIEDSAKVISSMVDAVMIRTFEHDKVEVFAQNSSVPV 122

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALTD+ HPCQ++AD+ T+EEHRGS++GK   W GDGNN+ HS I  AA  N+ L +A 
Sbjct: 123 INALTDDFHPCQLLADMQTYEEHRGSIEGKKVVWVGDGNNMCHSYINAAAILNFHLVVAC 182

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQ-EFKAREEHVFQP 243
           P G EP  E +   +   A V + +DA  AVK +  V TD + SM Q E +A+ E  F  
Sbjct: 183 PTGYEPNAELVTANK---AFVTITNDAKAAVKDSDLVVTDVFASMGQEEEQAQREKDFDG 239

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           FQVN  LMS+AH DALFMHCLPAHRGEEV   V+D P SVV+DEAENRLH QKA+L
Sbjct: 240 FQVNEELMSLAHDDALFMHCLPAHRGEEVTAGVIDHPDSVVWDEAENRLHAQKALL 295


>gi|95928617|ref|ZP_01311364.1| ornithine carbamoyltransferase [Desulfuromonas acetoxidans DSM 684]
 gi|95135407|gb|EAT17059.1| ornithine carbamoyltransferase [Desulfuromonas acetoxidans DSM 684]
          Length = 304

 Score =  295 bits (756), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 145/294 (49%), Positives = 193/294 (65%), Gaps = 1/294 (0%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAM 66
           HF  L++ +++ L  I  + K++K+  +    +  L+GK L MIFEK STRTR+SFEV M
Sbjct: 4   HFLCLTDWTAAELDAIFALTKELKDKQKQGIAHPLLAGKTLGMIFEKSSTRTRISFEVGM 63

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
             LGG  +FLS S  QLGR E I DTA+V+SRYVD I++RT +   + EL  YA VPVIN
Sbjct: 64  YQLGGHALFLSSSNTQLGRGEPIKDTARVMSRYVDGIMIRTFSQEGIEELARYADVPVIN 123

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI 186
           ALTD+ HPCQ++AD+ T  EH+GS K +++ W GDGNN+ HS I  AA   + L +ATP 
Sbjct: 124 ALTDSYHPCQVMADLFTVLEHKGSYKDQVYCWIGDGNNMAHSWINAAAVLGFELRVATPK 183

Query: 187 GSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHVFQPFQ 245
           G EP    +  A   GA +   +D +QA  GA  + TD W SM QE +  + E  F  FQ
Sbjct: 184 GYEPDTSVIERAEQLGAKITYTNDPLQAAWGADVLNTDVWASMGQEQEQLQREKDFVGFQ 243

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           +N  ++  A  D L +HCLPAHRGEE+ ++V++G  SVVFDEAENRLH QKAI+
Sbjct: 244 INAEVIDAADGDCLVLHCLPAHRGEEITDDVIEGRHSVVFDEAENRLHVQKAIM 297


>gi|330877352|gb|EGH11501.1| ornithine carbamoyltransferase [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330966680|gb|EGH66940.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. actinidiae
           str. M302091]
          Length = 306

 Score =  295 bits (756), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 147/295 (49%), Positives = 194/295 (65%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  + + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSMMDYTPDELLGLIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I D+AKV+SR +DA+++RT  HS L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSHRDTQLGRGEPIADSAKVISRMLDAVMIRTYAHSNLTEFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS+KGK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFLEHRGSIKGKTVAWIGDGNNMCNSYIEAAIQFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP  E+L  A   G  V +  D   AV GAH V TD W SM QE + AR + +F PF
Sbjct: 184 AGYEPNPEFLALA---GERVTVVRDPKAAVAGAHLVSTDVWTSMGQEEETARRKALFAPF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QV  +L+ +A  D LFMHCLPAHRGEE+  ++LD  +SV +D+AENRLH QKA+L
Sbjct: 241 QVTRALLDLADKDVLFMHCLPAHRGEEISVDLLDDARSVAWDQAENRLHAQKALL 295


>gi|254448634|ref|ZP_05062093.1| ornithine carbamoyltransferase [gamma proteobacterium HTCC5015]
 gi|198261823|gb|EDY86109.1| ornithine carbamoyltransferase [gamma proteobacterium HTCC5015]
          Length = 302

 Score =  295 bits (756), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 147/295 (49%), Positives = 191/295 (64%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L + SSS L  +I  A +++         +PL  +VLAM+FEK STRTR+SFE  
Sbjct: 4   RHFLTLLDFSSSELEQLIARASELRQMQHRGEIYEPLKNQVLAMVFEKSSTRTRISFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M   GG  IFLS    Q+GR E I DTA+V+SR VD I++RT  HS+L     ++ VPVI
Sbjct: 64  MAQFGGHAIFLSPQGTQIGRGEPIEDTARVMSRMVDGIMVRTFEHSKLETFAAHSQVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+ HPCQ++AD+  F E RGS++G   +W GDGNN+ HS I  A +F + LNIA P
Sbjct: 124 NALTDDYHPCQLLADVQAFSEARGSIQGATVTWIGDGNNMCHSYINAARQFGFQLNIACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQPF 244
            G EP+ + L  A   G +  +  D V+A + A  V TD W SM QE + +  E  F  +
Sbjct: 184 EGYEPKADILEAA---GDAARIVRDPVEAARDAQLVTTDVWASMGQEEEQKLREQAFARY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QV+  +M  A  DALFMHCLPAHRGEEV   V+DGPQS+V+D+AENRLH QKA+L
Sbjct: 241 QVDDRVMQAADNDALFMHCLPAHRGEEVSASVIDGPQSIVWDQAENRLHAQKALL 295


>gi|167041258|gb|ABZ06014.1| putative aspartate/ornithine carbamoyltransferase, Asp/Orn binding
           domain protein [uncultured marine microorganism
           HF4000_005D21]
 gi|167045762|gb|ABZ10408.1| putative aspartate/ornithine carbamoyltransferase, Asp/Orn binding
           domain protein [uncultured marine bacterium
           HF4000_APKG3108]
          Length = 307

 Score =  295 bits (756), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 141/305 (46%), Positives = 209/305 (68%), Gaps = 7/305 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-----PLSGKVLAMIFEKPSTRTRV 60
           K+F ++S I    L  I++ AK  K    ++ +N      PL GK+L MIFEKPSTRTR+
Sbjct: 2   KNFINISEIPKGELKLILDNAKSRKEKRSSLSKNTIDADVPLDGKILIMIFEKPSTRTRI 61

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRA-ETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           SF++A+K LGG ++ L+  E+  GR  E++ DTAK+LS+Y D +++RT  H  + E ++Y
Sbjct: 62  SFDLAVKQLGGKSLILNPDEIHYGRGNESLHDTAKILSQYGDIVMLRTHAHKNVEEFSKY 121

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
             +P+IN LTD +HPCQI++D+MTFEE +G +K K  ++ GDGNN+++SLIE + +F++ 
Sbjct: 122 LDIPIINGLTDLSHPCQIMSDVMTFEELKGPIKNKKIAYLGDGNNVVYSLIEASVQFDFE 181

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREE 238
           L IA P   EP    L WA+    ++++  D ++AV  A CV TD WISM ++  K +++
Sbjct: 182 LCIACPKSCEPNKNILKWAKKNNENISVITDPLKAVNSADCVMTDKWISMSDKVNKKKKK 241

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
            + +P+Q+N  +M  A+ DA+FMHCLPA RGEEVINEV+DG QS V+ EA NR+H QK+I
Sbjct: 242 KILKPYQINKKIMKQANKDAIFMHCLPAARGEEVINEVIDGKQSAVWLEALNRIHIQKSI 301

Query: 299 LLWCF 303
           + WC 
Sbjct: 302 IEWCL 306


>gi|240103209|ref|YP_002959518.1| ornithine carbamoyltransferase [Thermococcus gammatolerans EJ3]
 gi|239910763|gb|ACS33654.1| Ornithine carbamoyltransferase (argF) [Thermococcus gammatolerans
           EJ3]
          Length = 315

 Score =  295 bits (755), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 143/301 (47%), Positives = 196/301 (65%), Gaps = 5/301 (1%)

Query: 11  LSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLG 70
           L + +   +  I++ A+ +K  ++    ++ L GK LAMIF+KPSTRTR+SFEV +  LG
Sbjct: 13  LQDFTREEIETILKTAEMMKIWNKIGKPHRVLEGKTLAMIFQKPSTRTRISFEVGIYQLG 72

Query: 71  GDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTD 130
           G  ++L+ +++QL R ETI DTA+VLSRYVD I+ R   H  + +L +YA+VPVIN L+D
Sbjct: 73  GYGLYLNANDLQLRRGETIADTARVLSRYVDGIMARVYAHKDVEDLAKYASVPVINGLSD 132

Query: 131 NTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEP 190
            +HPCQ +AD  T  E +G ++G    + GDGNN+ HSL+    +    + +ATP G EP
Sbjct: 133 FSHPCQALADYQTILEKKGRIQGLKVVYVGDGNNVAHSLMIAGTKLGANVVVATPEGYEP 192

Query: 191 RNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH-VFQPFQ 245
               + WA       G S  L HD V+AVK A  ++TD W SM QE +A E   +F+PFQ
Sbjct: 193 DERVIKWAEQNAAESGGSFELLHDPVKAVKDADVIYTDVWASMGQETEAEERRKIFKPFQ 252

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGI 305
           VN  L+  A PD +FMHCLPAHRGEEV ++V+D P SVVFD+AENRLH QKA++    G 
Sbjct: 253 VNKELVKHAKPDYIFMHCLPAHRGEEVTDDVIDSPNSVVFDQAENRLHAQKAVMALVMGG 312

Query: 306 I 306
           I
Sbjct: 313 I 313


>gi|294495280|ref|YP_003541773.1| ornithine carbamoyltransferase [Methanohalophilus mahii DSM 5219]
 gi|292666279|gb|ADE36128.1| ornithine carbamoyltransferase [Methanohalophilus mahii DSM 5219]
          Length = 301

 Score =  295 bits (755), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 140/305 (45%), Positives = 202/305 (66%), Gaps = 11/305 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVA-----KKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           KH   ++++S  ++  I+E       K+IK    ++ +NK L     AMIFEK STRTRV
Sbjct: 2   KHVLSMTDLSKEDIMDILETGEDLKEKRIKGKVTDLLKNKSL-----AMIFEKSSTRTRV 56

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFEVAM  +GG +++L+  +MQ+GR ET+ DTAKVLSRYV AI  R  +HS + EL E+A
Sbjct: 57  SFEVAMSDMGGHSLYLNQRDMQIGRGETVADTAKVLSRYVSAITARVNSHSTVEELAEHA 116

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVINAL+D  HPCQI+AD++T +E++ +++G+  +W GDGNN+ +S+I G       +
Sbjct: 117 TVPVINALSDKEHPCQILADLLTIKEYKSTLEGQKLTWVGDGNNVCNSMILGCVIVGMEI 176

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREEH 239
            +A P G EP ++ +  AR  G  V +  D ++A   A  ++TD WISM ++E + +   
Sbjct: 177 AVACPDGYEPDDDIVKMAREMGGKVEILRDPIEASTDADVLYTDVWISMGDEEERDKRLS 236

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
               +Q+N +L+ +A  D + MHCLPAHRGEE+  EV+DG  SVVFD+AENRLH QKA++
Sbjct: 237 DLADYQINSTLLDVAKNDVIIMHCLPAHRGEEISAEVMDGTHSVVFDQAENRLHAQKALI 296

Query: 300 LWCFG 304
           L   G
Sbjct: 297 LKLIG 301


>gi|257486617|ref|ZP_05640658.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|289624949|ref|ZP_06457903.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. aesculi
           str. NCPPB3681]
 gi|289650474|ref|ZP_06481817.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. aesculi
           str. 2250]
 gi|298488728|ref|ZP_07006757.1| Ornithine carbamoyltransferase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298156801|gb|EFH97892.1| Ornithine carbamoyltransferase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|330867239|gb|EGH01948.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. aesculi
           str. 0893_23]
 gi|330989522|gb|EGH87625.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. lachrymans
           str. M301315]
 gi|331010099|gb|EGH90155.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 306

 Score =  295 bits (755), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 151/298 (50%), Positives = 196/298 (65%), Gaps = 10/298 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVA---KKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           +HF  + + +   L  +I      K ++N  E +FE  PL  +VL MIFEK STRTR+SF
Sbjct: 4   RHFLSMMDYTPDELLGLIRRGVELKDLRNRGE-LFE--PLKNRVLGMIFEKSSTRTRLSF 60

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E  M  LGG  IFLS  + QLGR E I D+AKV+SR +DA+++RT  HS L E    + V
Sbjct: 61  EAGMIQLGGQAIFLSHRDTQLGRGEPIADSAKVMSRMLDAVMIRTYAHSNLTEFAANSRV 120

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVIN L+D+ HPCQ++AD+ TF EHRGS+KGK  +W GDGNN+ +S IE A +F++ L +
Sbjct: 121 PVINGLSDDLHPCQLLADMQTFLEHRGSIKGKTVAWIGDGNNMCNSYIEAAIQFDFQLRV 180

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVF 241
           A P G EP  E+L  A   G  V +  D   AV GAH V TD W SM QE + AR   +F
Sbjct: 181 ACPAGYEPNPEFLALA---GERVTIVRDPKAAVAGAHLVSTDVWTSMGQEEETARRMALF 237

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            PFQV  +L+ +A  D LFMHCLPAHRGEE+  ++LD  +SV +D+AENRLH QKA+L
Sbjct: 238 APFQVTRALLDLADKDVLFMHCLPAHRGEEISVDLLDDSRSVAWDQAENRLHAQKALL 295


>gi|303247113|ref|ZP_07333388.1| ornithine carbamoyltransferase [Desulfovibrio fructosovorans JJ]
 gi|302491539|gb|EFL51424.1| ornithine carbamoyltransferase [Desulfovibrio fructosovorans JJ]
          Length = 351

 Score =  295 bits (755), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 144/303 (47%), Positives = 201/303 (66%), Gaps = 4/303 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           +  P+HF  + + S    + +++ A  +K      + +  L GK   ++FEK STRTRVS
Sbjct: 48  IVMPQHFLTILDFSKQEAAALLDRAAAMKAVD---YRSDLLDGKTCILVFEKASTRTRVS 104

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FEVA++HLGG  IF++ ++ QLGR E I DTA+VLSRY D +++RT  H +L EL    +
Sbjct: 105 FEVAVRHLGGWPIFMTQNDSQLGRDEPIRDTARVLSRYADCLIVRTFGHHKLEELAAAGS 164

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           +PV+NAL+D  HPCQI+AD++T  EH G ++G   ++ GDGNNI HSLI  AARF + + 
Sbjct: 165 IPVVNALSDEYHPCQIMADLLTMREHSGGLEGLTLAFVGDGNNIAHSLINAAARFPFRVV 224

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREEHV 240
           +A P G +P    +  AR +GA VA+  D  +A KGA  ++TD W SM QE  +A     
Sbjct: 225 VAAPKGYQPDPAVVARAREEGADVAVVDDPAEAAKGADYLYTDVWASMGQESEQAIRARA 284

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F  FQ+N +L+++A PD   +HCLPAHRGEE+ + V++GP SVV+DEAENRLH QKAIL 
Sbjct: 285 FAGFQINDALVALAKPDVRVLHCLPAHRGEEITDSVMEGPHSVVWDEAENRLHVQKAILE 344

Query: 301 WCF 303
           W F
Sbjct: 345 WIF 347


>gi|56419331|ref|YP_146649.1| ornithine carbamoyltransferase [Geobacillus kaustophilus HTA426]
 gi|56379173|dbj|BAD75081.1| ornithine carbamoyltransferase [Geobacillus kaustophilus HTA426]
          Length = 312

 Score =  295 bits (754), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 147/265 (55%), Positives = 191/265 (72%), Gaps = 5/265 (1%)

Query: 41  PLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYV 100
           PLSGK +AMIFEKPSTRTRVSFEV M  LGG  ++L+G+++QLGR ETI DTA+VLS+YV
Sbjct: 45  PLSGKTMAMIFEKPSTRTRVSFEVGMIQLGGQAMYLNGNDLQLGRGETIADTARVLSQYV 104

Query: 101 DAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSG 160
           D I++RT  H ++ EL EYA+VPVIN LTD+ HPCQ +AD++T  E + + +G   ++ G
Sbjct: 105 DVIMIRTFAHQKVEELAEYASVPVINGLTDDDHPCQALADLLTIYEVKKTFQGVKLAYVG 164

Query: 161 DGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWA----RNQGASVALFHDAVQAVK 216
           DGNN+ ++L+  AA+    + IA P G EP+ EY+  A       GA+V + HD + AV 
Sbjct: 165 DGNNVANALLVAAAKVGMDVAIACPPGYEPKKEYVEAACRIGEQTGAAVTVTHDPLVAVA 224

Query: 217 GAHCVFTDTWISMNQEFKAREE-HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINE 275
           GA  ++TD W SM QE ++ E   VFQP+QVN  L+  A PD LF+HCLPAHRGEEV   
Sbjct: 225 GADAIYTDVWTSMGQESESAERLQVFQPYQVNEELVKAAKPDYLFLHCLPAHRGEEVTAG 284

Query: 276 VLDGPQSVVFDEAENRLHTQKAILL 300
           V+DGP SVVF++A NRLH QKAILL
Sbjct: 285 VMDGPNSVVFEQAGNRLHAQKAILL 309


>gi|254784926|ref|YP_003072354.1| ornithine carbamoyltransferase [Teredinibacter turnerae T7901]
 gi|237684230|gb|ACR11494.1| ornithine carbamoyltransferase [Teredinibacter turnerae T7901]
          Length = 304

 Score =  295 bits (754), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 158/299 (52%), Positives = 194/299 (64%), Gaps = 5/299 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           P+H   LS+++S  L  II  A  +K S        PL+ K L MIFEK STRTRVSFE 
Sbjct: 3   PRHLLSLSDLTSEELEAIIANAIALKKSHYEGNAPLPLANKTLGMIFEKSSTRTRVSFEA 62

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG  IFLS  + QLGR E I D+A+VLSR VD I++RT   + L     Y+ VPV
Sbjct: 63  GMTQLGGSAIFLSPRDTQLGRGEPIEDSARVLSRMVDIIMIRTFEQADLERFAAYSRVPV 122

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALTD  HPCQ++AD+ TF EHRGS KGK  +W GDGNN+ HS I  A   ++ L IA 
Sbjct: 123 INALTDTFHPCQLLADVQTFVEHRGSPKGKTVAWVGDGNNMCHSYINAARLCDFQLRIAC 182

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EHVFQP 243
           P G EP  E L  A N    V + +    AVKGAH V TD W SM QE + +E E  F  
Sbjct: 183 PRGFEPDPELL--AAN-ADRVTVVNSPADAVKGAHWVATDVWASMGQESEQKEREKQFAG 239

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQ-SVVFDEAENRLHTQKAILLW 301
           FQVN  LM++A PDA+FMHCLPAHRGEEV  E+++  + +VV+DEAENRLH QKA++L+
Sbjct: 240 FQVNHELMALAQPDAVFMHCLPAHRGEEVSAELMEDEKFTVVWDEAENRLHAQKALMLF 298


>gi|237798766|ref|ZP_04587227.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331021619|gb|EGI01676.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 306

 Score =  295 bits (754), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 146/295 (49%), Positives = 194/295 (65%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  + + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSMMDYTPDELLGMIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I D+AKV+SR +DA+++RT  HS L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSHRDTQLGRGEPIADSAKVMSRMLDAVMIRTYAHSNLTEFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS+KGK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFLEHRGSIKGKTVAWIGDGNNMCNSYIEAAIQFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP  ++L  A   G  V +  D   AV GAH V TD W SM QE + AR + +F PF
Sbjct: 184 AGYEPSPQFLALA---GDRVTVVRDPKAAVTGAHLVSTDVWTSMGQEEETARRKALFAPF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QV  +L+ +A  D LFMHCLPAHRGEE+  ++LD  +SV +D+AENRLH QKA+L
Sbjct: 241 QVTRALLDLAASDVLFMHCLPAHRGEEISADLLDDSRSVAWDQAENRLHAQKALL 295


>gi|77460748|ref|YP_350255.1| ornithine carbamoyltransferase [Pseudomonas fluorescens Pf0-1]
 gi|77384751|gb|ABA76264.1| ornithine carbamoyltransferase [Pseudomonas fluorescens Pf0-1]
          Length = 307

 Score =  295 bits (754), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 147/299 (49%), Positives = 195/299 (65%), Gaps = 4/299 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M   +HF  L + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+S
Sbjct: 1   MMSARHFLSLMDCTPEELVSVIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRIS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  IFLS  + QLGR E IGD A V+S  +DA+++RT  HS L E    + 
Sbjct: 61  FEAGMIQLGGQAIFLSPRDTQLGRGEPIGDCAIVMSSMLDAVMIRTFAHSTLTEFAANSR 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN L+D+ HPCQ++AD+ TF EHRGS++GK  +W GDGNN+ +S IE A +F++ L 
Sbjct: 121 VPVINGLSDDLHPCQLLADMQTFLEHRGSIQGKTVAWIGDGNNMCNSYIEAAIQFDFQLR 180

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHV 240
           +A P G EP  E++  A   G  V +  D   AV+GAH V TD W SM QE + A+   +
Sbjct: 181 VACPEGYEPNPEFVAKA---GDRVTIVRDPKDAVRGAHLVSTDVWTSMGQEEETAKRLKL 237

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           F PFQVN +L+ +A  D LFMHCLPAHRGEE+  ++LD P+SV +D+AENRLH QKA+L
Sbjct: 238 FAPFQVNRALLDLAADDVLFMHCLPAHRGEEISLDLLDDPRSVAWDQAENRLHAQKALL 296


>gi|114799893|ref|YP_759321.1| ornithine carbamoyltransferase [Hyphomonas neptunium ATCC 15444]
 gi|123129109|sp|Q0C4M2|OTC_HYPNA RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|114740067|gb|ABI78192.1| ornithine carbamoyltransferase [Hyphomonas neptunium ATCC 15444]
          Length = 308

 Score =  295 bits (754), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 144/304 (47%), Positives = 193/304 (63%), Gaps = 5/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-----PLSGKVLAMIFEKPSTRTRV 60
           +HF D+  + S+ L  I++ A  +K +     + K     PL G  LAMIFEK STRTR 
Sbjct: 4   RHFLDIWPLESAELRAILDQAHAMKKARAGWPKGKIDAGAPLDGHTLAMIFEKSSTRTRF 63

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF++AM+ LGG +I  + ++MQLGR ET+ DTAKVLSR+VDA+++R  +H+ +    + A
Sbjct: 64  SFDMAMRQLGGSSITATSNDMQLGRGETVEDTAKVLSRFVDAVMIRANDHADVEAFADAA 123

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +VPVIN LTD +HPCQI+AD+MT EEH  +++G   +W GDGNN+  S I  A +F + L
Sbjct: 124 SVPVINGLTDRSHPCQIMADLMTLEEHGLTLRGARLAWVGDGNNVCASFIHAAPKFGFSL 183

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            + TP    P  + L  A      + L+  A +AV GA  V  DT++SM      R   +
Sbjct: 184 AVGTPKRFAPDEDDLEIAAELQGRIDLYETAEEAVAGADVVIADTFVSMGDVDAERRLEI 243

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
             P+ V   LM +A   A F+HCLPAHRGEEV  EV+DGP S+VFDEAENRLH QKAIL 
Sbjct: 244 LDPYAVTEELMELAAGGAKFLHCLPAHRGEEVDAEVIDGPASLVFDEAENRLHAQKAILR 303

Query: 301 WCFG 304
           WC G
Sbjct: 304 WCLG 307


>gi|169830551|ref|YP_001716533.1| ornithine carbamoyltransferase [Candidatus Desulforudis audaxviator
           MP104C]
 gi|169637395|gb|ACA58901.1| ornithine carbamoyltransferase [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 309

 Score =  295 bits (754), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 146/300 (48%), Positives = 201/300 (67%), Gaps = 7/300 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPL-SGKVLAMIFEKPSTRTRVSFEV 64
           + F  + + S S L  +  +A+ +K   +   E  PL +GK LAMIF+KPSTRTRVSFE 
Sbjct: 7   RDFLSILDFSVSELEAVFSLARDLKRK-QRAGEAHPLCAGKTLAMIFQKPSTRTRVSFEA 65

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG  ++L+ +++QLGR ET+ DTA+VLSRYVD I++RT   S + EL  +A VPV
Sbjct: 66  GMFQLGGHALYLNAADLQLGRGETVADTARVLSRYVDGIMIRTFKQSDVEELAAHAEVPV 125

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD  HPCQI+AD +T  EH+G + G   ++ GDGNN+ HSL+ G AR    + +++
Sbjct: 126 INGLTDWEHPCQILADFLTILEHKGRLAGLKLAYVGDGNNVAHSLLLGGARLGMRVAVSS 185

Query: 185 PIGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEH 239
           P G EP  + ++ A  +    G +V L  D   AV+ A  V TDTW SM +E + +    
Sbjct: 186 PRGYEPAPDLVSRAAAEAVRTGGAVELTTDPAAAVRDADVVVTDTWASMGRESEHSARVK 245

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F P+QVN +L++ A PD +FMHCLPAHRGEEV++ V+DGP+SV++DEAENRLH QKA+L
Sbjct: 246 AFAPYQVNEALVAHARPDYIFMHCLPAHRGEEVVDAVMDGPRSVIWDEAENRLHVQKALL 305


>gi|148546363|ref|YP_001266465.1| ornithine carbamoyltransferase [Pseudomonas putida F1]
 gi|148510421|gb|ABQ77281.1| ornithine carbamoyltransferase [Pseudomonas putida F1]
          Length = 306

 Score =  295 bits (754), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 147/295 (49%), Positives = 192/295 (65%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L + ++  L  +I    ++K+  +     +PL  +VL MIFEK STRTRVSFE  
Sbjct: 4   RHFLSLLDFTTDELLGVIRRGIELKDLRKRGVLFEPLKNRVLGMIFEKSSTRTRVSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E IGD+A VLS  VD +++RT  HS L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSPRDTQLGRGEPIGDSAIVLSSMVDVVMIRTHAHSTLTEFAAKSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D +HPCQ++AD+ TF EHRGS++GK  +W GDG N+ +S IE A +F++ L IA P
Sbjct: 124 NGLSDESHPCQLLADMQTFVEHRGSIQGKTVTWIGDGFNMCNSYIEAARQFDFQLRIACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP   ++      G  V +  DA +AV+ AH V TD W SM QE + AR    F P+
Sbjct: 184 EGYEPDQRFMALG---GDRVQIIRDAKEAVRDAHLVVTDVWTSMGQEEETARRLAHFAPY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QV   L+ +A PD LFMHCLPAHRGEE+  ++LD P+SV +DEAENRLH QKA+L
Sbjct: 241 QVTRELLDLAAPDVLFMHCLPAHRGEEISQDLLDDPRSVAWDEAENRLHAQKALL 295


>gi|151039|gb|AAA25720.1| ornithine carbamoyltransferase (EC 2.1.3.3) [Pseudomonas
           aeruginosa]
          Length = 305

 Score =  294 bits (753), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 142/295 (48%), Positives = 195/295 (66%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF    + S   L  +I    ++K+        +PL  +VL M+FEK STRTR+SFE  
Sbjct: 4   RHFLSFMDYSPEELIGLIRRGSELKDLRNRGVLYEPLKSRVLGMVFEKASTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E IGD+A+V+SR +D +++RT  H+ L E   ++ VPVI
Sbjct: 64  MIQLGGQAIFLSPRDTQLGRGEPIGDSARVMSRMLDGVMIRTFAHATLTEFAAHSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS++GK  +W GDGNN+ +S IE   +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFHEHRGSIQGKTVAWIGDGNNMCNSYIEEEMKFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQPF 244
            G EP+ E++  A   G  + +  D  +AV GAH V TD W SM QE +A     +F+P+
Sbjct: 184 EGYEPKAEFVALA---GDRLRVVRDPREAVAGAHLVSTDVWASMGQEDEAAARIAMFRPY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QVN +L+  A  D LFMHCLPAHRGEE+  E+LD P+SV +D+AENRLH QKA+L
Sbjct: 241 QVNAALLDGAADDVLFMHCLPAHRGEEISEELLDDPRSVAWDQAENRLHAQKALL 295


>gi|213970858|ref|ZP_03398981.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. tomato T1]
 gi|301384507|ref|ZP_07232925.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. tomato
           Max13]
 gi|302059901|ref|ZP_07251442.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. tomato
           K40]
 gi|302130500|ref|ZP_07256490.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|213924381|gb|EEB57953.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. tomato T1]
 gi|331015663|gb|EGH95719.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. lachrymans
           str. M302278PT]
          Length = 306

 Score =  294 bits (753), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 146/295 (49%), Positives = 193/295 (65%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  + + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSMMDYTPDELLGLIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I D+AKV+SR +DA+++RT  H  L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSHRDTQLGRGEPIADSAKVISRMLDAVMIRTYAHDNLTEFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS+KGK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFLEHRGSIKGKTVAWIGDGNNMCNSYIEAAIQFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP  E+L  A   G  V +  D   AV GAH V TD W SM QE + AR + +F PF
Sbjct: 184 AGYEPNPEFLALA---GERVTVVRDPQAAVAGAHLVSTDVWTSMGQEEETARRKALFAPF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QV  +L+ +A  D LFMHCLPAHRGEE+  ++LD  +SV +D+AENRLH QKA+L
Sbjct: 241 QVTRALLDLADKDVLFMHCLPAHRGEEISVDLLDDARSVAWDQAENRLHAQKALL 295


>gi|256828061|ref|YP_003156789.1| ornithine carbamoyltransferase [Desulfomicrobium baculatum DSM
           4028]
 gi|256577237|gb|ACU88373.1| ornithine carbamoyltransferase [Desulfomicrobium baculatum DSM
           4028]
          Length = 298

 Score =  294 bits (753), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 143/299 (47%), Positives = 199/299 (66%), Gaps = 4/299 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF  ++++ ++    ++  AK++K+     + +  L+GK LAMIFEK STRTRVSFEV 
Sbjct: 2   KHFLSINSLMATEAMDLVLRAKEMKDGD---YRSDLLAGKTLAMIFEKASTRTRVSFEVG 58

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           ++HLGGDTIF++ ++ QLGR+E + DTA+VLSRYV  +V+RT     + +L  Y ++PV+
Sbjct: 59  IRHLGGDTIFMTPADSQLGRSEPLKDTARVLSRYVQGMVVRTFAQKNVEDLARYGSIPVV 118

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD  HPCQI++D++T  E    +K  + SW GDGNN+ HS I  +  F + LNIA+P
Sbjct: 119 NALTDMYHPCQIMSDMLTIYERTTHLKDLVISWIGDGNNMAHSWINASVYFGFQLNIASP 178

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREEHVFQPF 244
            G  P    L  A   GA V +  D   A+ G+H V TD W SM QE  + R E  F  +
Sbjct: 179 EGYAPNTAVLERAWKMGAKVFVTDDPKAAIAGSHFVNTDVWASMGQEAEQKRREKAFAGY 238

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           QV+  L+++A P+A  +HCLPAHRGEE+   V +GPQS+VFD+AENRLH QKAIL W +
Sbjct: 239 QVDDELLALADPNAKVLHCLPAHRGEEISEAVFEGPQSIVFDQAENRLHMQKAILEWIY 297


>gi|28871306|ref|NP_793925.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|32699437|sp|Q87XL4|OTC_PSESM RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|28854557|gb|AAO57620.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. tomato
           str. DC3000]
          Length = 306

 Score =  294 bits (752), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 146/295 (49%), Positives = 193/295 (65%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  + + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSMMDYTPDELLGLIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I D+AKV+SR +DA+++RT  H  L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSHRDTQLGRGEPIADSAKVISRMLDAVMIRTYAHDNLTEFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS+KGK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFLEHRGSIKGKTVAWIGDGNNMCNSYIEAAIQFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP  E+L  A   G  V +  D   AV GAH V TD W SM QE + AR + +F PF
Sbjct: 184 AGYEPNPEFLALA---GERVTVVRDPKAAVAGAHLVSTDVWTSMGQEEETARRKALFAPF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QV  +L+ +A  D LFMHCLPAHRGEE+  ++LD  +SV +D+AENRLH QKA+L
Sbjct: 241 QVTRALLDLADKDVLFMHCLPAHRGEEISVDLLDDARSVAWDQAENRLHAQKALL 295


>gi|138894348|ref|YP_001124801.1| ornithine carbamoyltransferase [Geobacillus thermodenitrificans
           NG80-2]
 gi|196248042|ref|ZP_03146744.1| ornithine carbamoyltransferase [Geobacillus sp. G11MC16]
 gi|134265861|gb|ABO66056.1| Ornithine carbamoyltransferase [Geobacillus thermodenitrificans
           NG80-2]
 gi|196212826|gb|EDY07583.1| ornithine carbamoyltransferase [Geobacillus sp. G11MC16]
          Length = 312

 Score =  293 bits (751), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 146/300 (48%), Positives = 206/300 (68%), Gaps = 5/300 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F  L + S+  +  ++ +A  +K   +      PL+GK +AMIFEKPSTRTRVSFEV 
Sbjct: 10  RDFLTLLDFSTEEIFDLLALAGDLKAKQKAGMPYTPLAGKTMAMIFEKPSTRTRVSFEVG 69

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  ++L+ +++QLGR ETI DTA+VLS+YVD I++RT  H ++ EL EYA++PVI
Sbjct: 70  MIQLGGSALYLNSNDLQLGRGETIADTARVLSQYVDVIMIRTFAHQKVEELAEYASIPVI 129

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD++T  E + + +G   ++ GDGNN+ ++L+  AA+    + IA P
Sbjct: 130 NGLTDDDHPCQALADLLTIYEVKKTFQGIKLAYVGDGNNVANALLAAAAKVGMDVAIACP 189

Query: 186 IGSEPRNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HV 240
            G EP+  Y+  AR      GA+V + HD ++AV GA  ++TD W SM QE ++ E   V
Sbjct: 190 PGYEPKAAYVEAARQIGEKTGAAVTVTHDPLEAVAGADAIYTDVWTSMGQESESDERLQV 249

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           FQP+QVN +L+  A PD +F+HCLPAHRGEEV   V+DGP S+VF++A NRLH QKAIL+
Sbjct: 250 FQPYQVNEALVKAAKPDYIFLHCLPAHRGEEVTAGVMDGPNSMVFEQAGNRLHAQKAILV 309


>gi|330981573|gb|EGH79676.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 306

 Score =  293 bits (751), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 145/295 (49%), Positives = 194/295 (65%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  + + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSMMDYTPDELLGLIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I D+AKV+SR +DA+++RT  HS L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSHRDTQLGRGEPIADSAKVMSRMLDAVMIRTYAHSNLTEFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS++GK  +W GDG N+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFLEHRGSIQGKTVAWIGDGKNMCNSYIEAAIQFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP  E+L  A   G  V +  D   AV+GAH V TD W SM QE + AR + +F PF
Sbjct: 184 AGYEPNAEFLALA---GEGVTVVRDPKAAVEGAHLVSTDVWTSMGQEEETARRKKLFAPF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QV  +L+ +A  D LFMHCLPAHRGEE+  ++LD  +SV +D+AENRLH QKA+L
Sbjct: 241 QVTRALLDLADKDVLFMHCLPAHRGEEISVDLLDDARSVAWDQAENRLHAQKALL 295


>gi|206896477|ref|YP_002247399.1| ornithine carbamoyltransferase [Coprothermobacter proteolyticus DSM
           5265]
 gi|206739094|gb|ACI18172.1| ornithine carbamoyltransferase [Coprothermobacter proteolyticus DSM
           5265]
          Length = 312

 Score =  293 bits (751), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 140/268 (52%), Positives = 186/268 (69%), Gaps = 5/268 (1%)

Query: 42  LSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVD 101
           L GK LAMIF+KPSTRTRV+FEV M  LGG  ++LS ++MQL R ETI DTA+VLSR+VD
Sbjct: 44  LKGKTLAMIFQKPSTRTRVAFEVGMYQLGGYALYLSSNDMQLRRGETIADTARVLSRFVD 103

Query: 102 AIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGD 161
            I+ R  +H  +++L +Y +VPVIN L+D  HP Q++AD +T  E  G++KG   ++ GD
Sbjct: 104 GIMARVFDHQDVVDLAKYGSVPVINGLSDEEHPSQVLADFLTIWEKFGTLKGLKLAYVGD 163

Query: 162 GNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWAR----NQGASVALFHDAVQAVKG 217
           GNN+ HSL+  A      + +ATP G EP++ Y+  A+      G+SV +  D V+AV G
Sbjct: 164 GNNVAHSLLLAAGLVGMDIAVATPQGYEPKSFYVEKAKELAARHGSSVQVLRDPVEAVTG 223

Query: 218 AHCVFTDTWISMNQEFKAREE-HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEV 276
           A+ V+TD W SM QE +  E   +F+P+QVN  LMS A  +A+F+HCLPAHRGEEV++EV
Sbjct: 224 ANAVYTDVWASMGQEAEHEERLKIFKPYQVNPELMSHADKNAIFLHCLPAHRGEEVVDEV 283

Query: 277 LDGPQSVVFDEAENRLHTQKAILLWCFG 304
            D PQS +FDEAENRLH  KAIL    G
Sbjct: 284 ADSPQSAIFDEAENRLHAHKAILALLMG 311


>gi|26987815|ref|NP_743240.1| ornithine carbamoyltransferase [Pseudomonas putida KT2440]
 gi|32699438|sp|Q88NX4|OTC_PSEPK RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|24982513|gb|AAN66704.1|AE016298_8 ornithine carbamoyltransferase [Pseudomonas putida KT2440]
          Length = 306

 Score =  293 bits (751), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 147/295 (49%), Positives = 192/295 (65%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L + ++  L  +I    ++K+  +     +PL  +VL MIFEK STRTRVSFE  
Sbjct: 4   RHFLSLLDFTTDELLGVIRHGIELKDLRKRGVLFEPLKNRVLGMIFEKSSTRTRVSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E IGD+A VLS  VD +++RT  HS L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSPRDTQLGRGEPIGDSAIVLSSMVDVVMIRTHAHSTLTEFAAKSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D +HPCQ++AD+ TF EHRGS++GK  +W GDG N+ +S IE A +F++ L IA P
Sbjct: 124 NGLSDESHPCQLLADMQTFVEHRGSIQGKTVTWIGDGFNMCNSYIEAARQFDFQLRIACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP   ++      G  V +  DA +AV+ AH V TD W SM QE + AR    F P+
Sbjct: 184 EGYEPDQRFMALG---GDRVQIIRDAREAVRDAHLVVTDVWTSMGQEEETARRLAHFAPY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QV   L+ +A PD LFMHCLPAHRGEE+  ++LD P+SV +DEAENRLH QKA+L
Sbjct: 241 QVTRELLDLAAPDVLFMHCLPAHRGEEISQDLLDDPRSVAWDEAENRLHAQKALL 295


>gi|320325621|gb|EFW81683.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. glycinea
           str. B076]
 gi|320327095|gb|EFW83109.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330879071|gb|EGH13220.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 306

 Score =  293 bits (751), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 149/297 (50%), Positives = 195/297 (65%), Gaps = 8/297 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSS--ENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
           +HF  + + +   L  +I    ++K+      +FE  PL  +VL MIFEK STRTR+SFE
Sbjct: 4   RHFLSMMDYTPDELLGLIRRGVELKDLRIRGELFE--PLKNRVLGMIFEKSSTRTRLSFE 61

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
             M  LGG  IFLS  + QLGR E I D+AKV+SR +DA+++RT  HS L E    + VP
Sbjct: 62  AGMIQLGGQAIFLSHRDTQLGRGEPIADSAKVMSRMLDAVMIRTYAHSNLTEFAANSRVP 121

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN L+D+ HPCQ++AD+ TF EHRGS+KGK  +W GDGNN+ +S IE A +F++ L +A
Sbjct: 122 VINGLSDDLHPCQLLADMQTFLEHRGSIKGKTVAWIGDGNNMCNSYIEAAIQFDFQLRVA 181

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQ 242
            P G EP  E+L  A   G  V +  D   AV GAH V TD W SM QE + AR   +F 
Sbjct: 182 CPAGYEPNPEFLALA---GERVTIVRDPKAAVAGAHLVSTDVWTSMGQEEETARRMALFA 238

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           PFQV  +L+ +A  D LFMHCLPAHRGEE+  ++LD  +SV +D+AENRLH QKA+L
Sbjct: 239 PFQVTRALLDLAKKDVLFMHCLPAHRGEEISVDLLDDSRSVAWDQAENRLHAQKALL 295


>gi|317130875|ref|YP_004097157.1| ornithine carbamoyltransferase [Bacillus cellulosilyticus DSM 2522]
 gi|315475823|gb|ADU32426.1| ornithine carbamoyltransferase [Bacillus cellulosilyticus DSM 2522]
          Length = 325

 Score =  293 bits (750), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 151/300 (50%), Positives = 197/300 (65%), Gaps = 6/300 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K F  L+ + + ++  ++E A  +K   +       L GK L MIFEK STRTRVSFEV 
Sbjct: 20  KDFLTLAELETEDILFLLEEAIDLKQKQKQGIPQTDLQGKTLGMIFEKSSTRTRVSFEVG 79

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  ++QLGR E+I DTAKVLSRYV+ I++RT  H ++ EL E+AT+PVI
Sbjct: 80  MLQLGGHAIFLSSKDIQLGRGESIHDTAKVLSRYVNGIMIRTFEHEKVEELAEHATIPVI 139

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLNIAT 184
           N LTD  HP Q++AD++T  EH+G +KG    + GDG NN+ HSLIEGAA+    + IA+
Sbjct: 140 NGLTDLHHPAQVLADLLTILEHKGKLKGLKLCYIGDGNNNVAHSLIEGAAKVGMNIAIAS 199

Query: 185 PIGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-H 239
           P   EP  + L      A  Q +S++  +D ++AVK A  V TD W SM QE +  E  +
Sbjct: 200 PNAYEPNADILKGANADAEKQNSSISFTNDPIEAVKDADVVVTDVWASMGQEDEQEERIN 259

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+PFQVN +L   A  D +F+HCLPAHR EEV  E++DG  SVVFDEAENRLH QKA+L
Sbjct: 260 AFKPFQVNSNLCKHAKDDFIFLHCLPAHREEEVTAEIIDGTHSVVFDEAENRLHAQKALL 319


>gi|323698300|ref|ZP_08110212.1| ornithine carbamoyltransferase [Desulfovibrio sp. ND132]
 gi|323458232|gb|EGB14097.1| ornithine carbamoyltransferase [Desulfovibrio desulfuricans ND132]
          Length = 299

 Score =  293 bits (750), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 147/300 (49%), Positives = 190/300 (63%), Gaps = 4/300 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           PKHF  + +I    +  +I  AK++K+          L GK L +IFEK STRTRVSFEV
Sbjct: 2   PKHFLTILDIPKDEVRQVILRAKEMKDGK---VRTDLLDGKTLLLIFEKASTRTRVSFEV 58

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            ++ LGG+ +F+S  + QLGR+E I DTA+VLSRY D I+MRT    +L  L +Y  +PV
Sbjct: 59  GVRQLGGEPVFISARDSQLGRSEPIKDTARVLSRYADGIIMRTFGQEKLETLVDYGDIPV 118

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           +NALTD  HPCQ++ADI+T  E    +     +W GDGNN+ HS I GAA F Y L++A 
Sbjct: 119 VNALTDEYHPCQVMADILTMYERTPDLDKVKVAWVGDGNNMAHSFINGAAAFGYELSLAC 178

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV-FQP 243
           P G  P    L+ A N GA + L  D  +AV GA  V TD W SM QE + ++  V F  
Sbjct: 179 PEGYAPDAAILDKAVNLGARITLTDDPKRAVDGADYVNTDVWASMGQEEEQKKREVAFAG 238

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           + V+ +LM +A P A FMHCLPAHRGEEV   V + P S+V+D+AENRLH QKAIL W F
Sbjct: 239 YMVDEALMGLAAPGASFMHCLPAHRGEEVSEAVFESPASIVWDQAENRLHAQKAILEWIF 298


>gi|167035326|ref|YP_001670557.1| ornithine carbamoyltransferase [Pseudomonas putida GB-1]
 gi|166861814|gb|ABZ00222.1| ornithine carbamoyltransferase [Pseudomonas putida GB-1]
          Length = 306

 Score =  293 bits (750), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 146/295 (49%), Positives = 191/295 (64%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L + ++  L  +I    ++K+  +     +PL  +VL MIFEK STRTRVSFE  
Sbjct: 4   RHFLSLLDFTTDELLGVIRRGIELKDLRKRGVLFEPLKNRVLGMIFEKSSTRTRVSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E IGD+A VLS  +D +++RT  HS L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSPRDTQLGRGEPIGDSAIVLSSMLDVVMIRTHAHSTLTEFAAKSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D +HPCQ++AD+ TF EHRGS++GK  +W GDG N+ +S IE A +F++ L IA P
Sbjct: 124 NGLSDESHPCQLLADMQTFLEHRGSIQGKTVTWIGDGFNMCNSYIEAARQFDFQLRIACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP   ++      G  V +  D  QAV+ AH V TD W SM QE + AR    F P+
Sbjct: 184 EGYEPDQRFMALG---GDRVQIIRDVKQAVRDAHLVVTDVWTSMGQEEETARRLAHFAPY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QV   L+ +A PD LFMHCLPAHRGEE+  ++LD P+SV +DEAENRLH QKA+L
Sbjct: 241 QVTRELLDLAAPDVLFMHCLPAHRGEEISQDLLDDPRSVAWDEAENRLHAQKALL 295


>gi|134298154|ref|YP_001111650.1| ornithine carbamoyltransferase [Desulfotomaculum reducens MI-1]
 gi|134050854|gb|ABO48825.1| ornithine carbamoyltransferase [Desulfotomaculum reducens MI-1]
          Length = 315

 Score =  293 bits (749), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 143/294 (48%), Positives = 194/294 (65%), Gaps = 5/294 (1%)

Query: 11  LSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLG 70
           L + +   +  I++ A++IK   +    +  L GK L MIF+K STRTRVSFEV M  LG
Sbjct: 16  LHDYTVDEVKLILQEAQRIKAMQKAGIPHPYLQGKTLGMIFQKSSTRTRVSFEVGMYQLG 75

Query: 71  GDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTD 130
           G  +FLS  ++Q+GR E++ DTA+VLSR +D I++RT     + EL EYA +PVIN LTD
Sbjct: 76  GYALFLSPKDIQMGRGESVADTARVLSRMLDGIMIRTFAQEEVEELAEYADIPVINGLTD 135

Query: 131 NTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEP 190
            THPCQI+AD +T +EH+G + G   ++ GDGNNI HSL+ G A+    + +A+P G +P
Sbjct: 136 RTHPCQILADFLTIQEHKGQLAGLKLAYVGDGNNIAHSLLYGCAKVGMDICVASPEGYQP 195

Query: 191 RNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EHVFQPFQ 245
             + ++     AR  GA V +  D V A++ A  V TD W SM QE + RE E  F  +Q
Sbjct: 196 DAQIVSQAKEDARTTGAKVEVVSDPVVAMQAADVVITDVWASMGQEAEQRERERAFAGYQ 255

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           VN  L + A PD +F+HCLPAHRGEEV  E++DGP SVV+DEAENRLH QKA++
Sbjct: 256 VNSDLCAHAKPDFIFLHCLPAHRGEEVTAEIIDGPHSVVWDEAENRLHAQKAVM 309


>gi|304312845|ref|YP_003812443.1| Ornithine carbamoyltransferase [gamma proteobacterium HdN1]
 gi|301798578|emb|CBL46808.1| Ornithine carbamoyltransferase [gamma proteobacterium HdN1]
          Length = 305

 Score =  293 bits (749), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 152/300 (50%), Positives = 195/300 (65%), Gaps = 4/300 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L++ S   L  I+  A ++K         +P   KVL MIFEK STRTRVSFE A
Sbjct: 4   RHFLTLNDFSPEELRGILARAIELKKMLREGTPYEPFKNKVLGMIFEKSSTRTRVSFESA 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M   GG  +FLS  + QLGR E + DTA+VLSR VD I++RT  H ++    +Y+ VPVI
Sbjct: 64  MIQCGGGALFLSPRDTQLGRGEPLSDTARVLSRMVDIIMIRTFEHEKVETFAQYSQVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+ HPCQ++AD+ TF EHRG ++GK  +W GDGNN+ +S +  A +F + LNIA P
Sbjct: 124 NALTDSFHPCQLLADMQTFVEHRGDIRGKTVTWVGDGNNMCNSYMNAARQFGFHLNIACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQPF 244
            G EP    L  A NQ A V L HD   AV+ +H V TD W SM QE + +     F  +
Sbjct: 184 PGFEPDAAVL--ANNQ-AHVTLMHDPKAAVRASHLVVTDVWASMGQEQEQQARIAAFANY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QV+ +LM +A  DALFMHCLPAHRGEEV  E+LD P++VV+DEAENRLH QKA++    G
Sbjct: 241 QVSPALMDLAADDALFMHCLPAHRGEEVSAEMLDDPRAVVWDEAENRLHAQKALMEVLLG 300


>gi|330889557|gb|EGH22218.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. mori str.
           301020]
          Length = 281

 Score =  293 bits (749), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 147/274 (53%), Positives = 187/274 (68%), Gaps = 7/274 (2%)

Query: 27  KKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRA 86
           K ++N  E +FE  PL  +VL MIFEK STRTR+SFE  M  LGG  IFLS  + QLGR 
Sbjct: 3   KDLRNRGE-LFE--PLKNRVLGMIFEKSSTRTRLSFEAGMIQLGGQAIFLSHRDTQLGRG 59

Query: 87  ETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEE 146
           E I D+AKV+SR +DA+++RT  HS L E    + VPVIN L+D+ HPCQ++AD+ TF E
Sbjct: 60  EPIADSAKVMSRMLDAVMIRTYAHSNLTEFAANSRVPVINGLSDDLHPCQLLADMQTFLE 119

Query: 147 HRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVA 206
           HRGS+KGK  +W GDGNN+ +S IE A +F++ L +A P G EP  E+L  A   G  V 
Sbjct: 120 HRGSIKGKTVAWIGDGNNMCNSYIEAAIQFDFQLRVACPAGYEPNPEFLALA---GERVT 176

Query: 207 LFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPFQVNLSLMSMAHPDALFMHCLP 265
           +  D   AV GAH V TD W SM QE + AR   +F PFQV  +L+ +A  D LFMHCLP
Sbjct: 177 IVRDPKAAVAGAHLVSTDVWTSMGQEEETARRMALFAPFQVTRALLDLADKDVLFMHCLP 236

Query: 266 AHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           AHRGEE+  ++LD  +SV +D+AENRLH QKA+L
Sbjct: 237 AHRGEEISVDLLDDSRSVAWDQAENRLHAQKALL 270


>gi|302343312|ref|YP_003807841.1| ornithine carbamoyltransferase [Desulfarculus baarsii DSM 2075]
 gi|301639925|gb|ADK85247.1| ornithine carbamoyltransferase [Desulfarculus baarsii DSM 2075]
          Length = 309

 Score =  293 bits (749), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 139/300 (46%), Positives = 198/300 (66%), Gaps = 1/300 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH   + ++++  +  +IE A+++K      +   PL+GK +AMIFEKPSTRTRVSFEV 
Sbjct: 7   KHLLTIRDLTAQEVLGLIERARQLKAGWRGGYRPTPLAGKSVAMIFEKPSTRTRVSFEVG 66

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  +F++  + Q+ R+E + DTA+VLSRYVD IV+RT  H  + +L  +  VPVI
Sbjct: 67  VFQLGGKALFIASRDSQISRSEPLRDTARVLSRYVDGIVVRTFGHEVVEDLARFGDVPVI 126

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD  HPCQ++ D+ T  E++G V+ ++++W GDGNN+ HS IE AA     L +A P
Sbjct: 127 NALTDRYHPCQVLGDLQTVAEYKGEVRDQVYAWIGDGNNMAHSWIEAAAVLGLRLRLACP 186

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQPF 244
            G +P  E +  AR +GA + L  +  +A  GA  + TD W SM QE +A+     F  F
Sbjct: 187 EGYDPDPEIVAQARARGADILLTREPDEAASGATVINTDVWASMGQEDEAKGRAEAFGGF 246

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
            V+  LMS+A  +A+ +HCLPAHRGEE+ +EV++GPQS ++DEAENRLH QKAI+    G
Sbjct: 247 TVDGRLMSLAAREAIVLHCLPAHRGEEISDEVMEGPQSAIWDEAENRLHMQKAIMEALLG 306


>gi|107103049|ref|ZP_01366967.1| hypothetical protein PaerPA_01004118 [Pseudomonas aeruginosa PACS2]
          Length = 296

 Score =  293 bits (749), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 141/288 (48%), Positives = 193/288 (67%), Gaps = 4/288 (1%)

Query: 13  NISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGD 72
           + S   L  +I    ++K+        +PL  +VL M+FEK STRTR+SFE  M  LGG 
Sbjct: 2   DYSPEELIGLIRRGSELKDLRNRGVLYEPLKSRVLGMVFEKASTRTRLSFEAGMIQLGGQ 61

Query: 73  TIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNT 132
            IFLS  + QLGR E IGD+A+V+SR +D +++RT  H+ L E   ++ VPVIN L+D+ 
Sbjct: 62  AIFLSPRDTQLGRGEPIGDSARVMSRMLDGVMIRTFAHATLTEFAAHSKVPVINGLSDDL 121

Query: 133 HPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRN 192
           HPCQ++AD+ TF EHRGS++GK  +W GDGNN+ +S IE A +F++ L +A P G EP+ 
Sbjct: 122 HPCQLLADMQTFHEHRGSIQGKTVAWIGDGNNMCNSYIEAALKFDFQLRVACPEGYEPKA 181

Query: 193 EYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQPFQVNLSLM 251
           E++  A   G  + +  D  +AV GAH V TD W SM QE +A     +F+P+QVN +L+
Sbjct: 182 EFVALA---GDRLRVVRDPREAVAGAHLVSTDVWASMGQEDEAAARIALFRPYQVNAALL 238

Query: 252 SMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             A  D LFMHCLPAHRGEE+  E+LD P+SV +D+AENRLH QKA+L
Sbjct: 239 DGAADDVLFMHCLPAHRGEEISEELLDDPRSVAWDQAENRLHAQKALL 286


>gi|291483599|dbj|BAI84674.1| ornithine carbamoyltransferase [Bacillus subtilis subsp. natto
           BEST195]
          Length = 319

 Score =  292 bits (748), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 147/302 (48%), Positives = 201/302 (66%), Gaps = 11/302 (3%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIK-NSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           Y K    L ++S  +++ ++  A ++K N  + IF      GK LAMIFEK STRTRVSF
Sbjct: 10  YGKDLLTLKDLSEEDINALLAEAGELKQNKIQPIFH-----GKTLAMIFEKSSTRTRVSF 64

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E  M  LGG+ +FLS  ++QLGR ET+ DTAKVLS YVDAI++RT  H ++ EL + A +
Sbjct: 65  EAGMAQLGGNALFLSQKDLQLGRGETVADTAKVLSGYVDAIMIRTFEHEKVEELAKEADI 124

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVIN LTD  HPCQ +AD++T +E +G +KG   S+ GDGNN+ HSL+ G A+    ++I
Sbjct: 125 PVINGLTDKYHPCQALADLLTIKEIKGKLKGVKVSYIGDGNNVAHSLMIGCAKMGCDISI 184

Query: 183 ATPIGSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE 238
           A+P G E  +E       +A   G+S+ L  D ++AVK A  +++D + SM QE + +E 
Sbjct: 185 ASPKGYEVLDEAAEAAKTYALQSGSSITLTDDPIEAVKDADVIYSDVFTSMGQEAEEQER 244

Query: 239 -HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
             VF P+QVN +L+S A PD  F+HCLPAHR EEV  E++DGP S VF +AENRLH QKA
Sbjct: 245 LAVFAPYQVNAALVSHAKPDYTFLHCLPAHREEEVTAEIIDGPNSAVFQQAENRLHVQKA 304

Query: 298 IL 299
           +L
Sbjct: 305 LL 306


>gi|255320452|ref|ZP_05361633.1| ornithine carbamoyltransferase [Acinetobacter radioresistens SK82]
 gi|262378348|ref|ZP_06071505.1| ornithine carbamoyltransferase [Acinetobacter radioresistens SH164]
 gi|255302424|gb|EET81660.1| ornithine carbamoyltransferase [Acinetobacter radioresistens SK82]
 gi|262299633|gb|EEY87545.1| ornithine carbamoyltransferase [Acinetobacter radioresistens SH164]
          Length = 306

 Score =  292 bits (748), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 145/295 (49%), Positives = 191/295 (64%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++SS  L+ I+E A ++K    N    +P  GKVL MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLRDLSSLELNRILERASELKRMQHNNEVYQPFVGKVLGMIFEKSSTRTRISFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M   GGD IFLS  + QLGR E I D+A+V+S  +D +++RT  H  +     Y+ VPVI
Sbjct: 64  MSQFGGDAIFLSSRDTQLGRGEPIEDSARVISSMLDIVMIRTFGHDIVERFASYSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ++AD+ T+ EHRGS++GK  +W GDGNN+ +S IE A    + L IA+P
Sbjct: 124 NGLTDDHHPCQLLADLQTYIEHRGSIEGKTVAWIGDGNNMCNSYIEAAHMMGFKLKIASP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQPF 244
            G EP+ E+L         V +F++A  A   A  + TD W SM QE + +  E  F  F
Sbjct: 184 AGYEPKEEFLT---EFAHCVEVFNNAEDAAVNADLIVTDVWASMGQEEEQKHREQAFAQF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QVN  LM +AHPD LFMHCLPAHRGEE+   +LD   +VV+DEAENRLH QKA++
Sbjct: 241 QVNEKLMGLAHPDCLFMHCLPAHRGEEISENMLDHKNAVVWDEAENRLHAQKALV 295


>gi|253575901|ref|ZP_04853235.1| ornithine carbamoyltransferase [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251844695|gb|EES72709.1| ornithine carbamoyltransferase [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 320

 Score =  292 bits (747), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 141/305 (46%), Positives = 202/305 (66%), Gaps = 7/305 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F +L++ S+  +  +I++A ++K   +N    +PL GK + +IFEK STRTRVSFEV 
Sbjct: 17  RDFIELTDYSTDEIHYLIDLAIELKRKQKNGEVYQPLLGKTVGLIFEKSSTRTRVSFEVG 76

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
              LGG  +FLS +++QLGR ETI DTA V+SRY+D I++RT  H ++++L  YATVPVI
Sbjct: 77  TYQLGGHALFLSKNDIQLGRGETIADTAGVMSRYLDGIMIRTFGHDKVVDLARYATVPVI 136

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D  HPCQ++AD  T  EH+G ++G   ++ GDGNN+ HSL+ G A+    +++A+P
Sbjct: 137 NGLSDLAHPCQVLADYQTLYEHKGKLQGLKLAYVGDGNNMAHSLMIGGAKLGVHVSVASP 196

Query: 186 IGSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKAREEH 239
            G EP  + +      A+  GA + +  D   AV+ A  ++TD W SM   +E K REE 
Sbjct: 197 EGYEPDPQIVADAQEIAKATGAVIEVVRDPKAAVQEADAIYTDVWASMGFEEEQKIREE- 255

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ +QV+  L   A PD +FMHCLPAHRGEEV   V+DGP S++FD+AENRLH QKA++
Sbjct: 256 AFRNYQVDEQLARYAKPDYVFMHCLPAHRGEEVSEGVIDGPHSIIFDQAENRLHAQKALM 315

Query: 300 LWCFG 304
               G
Sbjct: 316 AALIG 320


>gi|330504581|ref|YP_004381450.1| ornithine carbamoyltransferase [Pseudomonas mendocina NK-01]
 gi|328918867|gb|AEB59698.1| ornithine carbamoyltransferase [Pseudomonas mendocina NK-01]
          Length = 306

 Score =  292 bits (747), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 145/295 (49%), Positives = 193/295 (65%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  + + +   L  +I  A ++K+        +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSMMDYTPDELVGLIRRAIELKDLRNRGVLFEPLKNRVLGMIFEKASTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E IGD A V+S  +DA+++RT  HS L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSPRDTQLGRGEPIGDAAIVMSSMLDAVMIRTFAHSNLTEFAAKSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS+ GK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFLEHRGSIAGKTVAWIGDGNNMCNSYIEAAIQFDFQLKVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQPF 244
            G EP   +L  A   G  V +  D  +AV GAH V TD W SM QE +A +   +F+P+
Sbjct: 184 EGYEPDARFLALA---GDRVQVLRDPREAVAGAHLVSTDVWASMGQEDEAEQRMALFRPY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QV  +L+  A PD LFMHCLPAHRGEE+  ++LD P+SV +D+AENRLH QKA+L
Sbjct: 241 QVTPTLLDNAAPDVLFMHCLPAHRGEEISIDMLDDPRSVAWDQAENRLHAQKALL 295


>gi|83591107|ref|YP_431116.1| ornithine carbamoyltransferase [Moorella thermoacetica ATCC 39073]
 gi|83574021|gb|ABC20573.1| ornithine carbamoyltransferase [Moorella thermoacetica ATCC 39073]
          Length = 314

 Score =  292 bits (747), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 142/304 (46%), Positives = 199/304 (65%), Gaps = 5/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F  L + S   +  ++++A  +K   +    +  L+GK L MIF K STRTRVSFEV 
Sbjct: 11  RDFLSLKDFSREEIFYLLDLADDLKAKLKKREPHPLLAGKTLGMIFTKRSTRTRVSFEVG 70

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FL+  ++QLGR ETI DTA+VLSRY+D I++RT +H  + EL EYA++PVI
Sbjct: 71  MYQLGGYPLFLTKDDLQLGRGETIADTARVLSRYLDGIMIRTYSHREVEELAEYASIPVI 130

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HP Q +ADIMT  E +G ++G   ++ GDGNN+ HSL+ G A+    + IA P
Sbjct: 131 NGLTDFLHPTQALADIMTIREWKGKLQGLNLTFIGDGNNVAHSLMYGGAKVGLNVTIACP 190

Query: 186 IGSEPRNEYLNWAR----NQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHV 240
            G EP  + +  AR      G  +A+ ++  +A +GA  ++TD W SM QE +A +    
Sbjct: 191 SGYEPMPQVVEEARRIAAGNGCQIAVTNNIKEAAEGADILYTDVWASMGQEDEAEKRRQA 250

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+ +Q+N  L+ +A PDA+ +HCLPAHRGEE+ +EV+DGPQS VFDEAENRLH  KAI++
Sbjct: 251 FRKYQINSELLKLAKPDAMVLHCLPAHRGEEITDEVMDGPQSAVFDEAENRLHAHKAIMV 310

Query: 301 WCFG 304
              G
Sbjct: 311 ALMG 314


>gi|325275186|ref|ZP_08141153.1| ornithine carbamoyltransferase [Pseudomonas sp. TJI-51]
 gi|324099673|gb|EGB97552.1| ornithine carbamoyltransferase [Pseudomonas sp. TJI-51]
          Length = 306

 Score =  291 bits (746), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 147/295 (49%), Positives = 194/295 (65%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L + ++  L  +I    ++K+  +     +PL  +VL MIFEK STRTRVSFE  
Sbjct: 4   RHFLSLLDFTTDELLGVIRRGIELKDLRKRGVLFEPLKNRVLGMIFEKSSTRTRVSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E IGD+A VLS  +D +++RT  HS L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSPRDTQLGRGEPIGDSAIVLSSMLDVVMIRTHAHSTLTEFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NAL+D +HPCQ++AD+ TF EHRG+++GK  +W GDG N+ +S IE A +F++ L IA P
Sbjct: 124 NALSDESHPCQLLADMQTFLEHRGTIQGKTVAWIGDGFNMCNSYIEAARQFDFQLRIACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP   ++      G  V +  D  QAV GAH V TD W SM QE + AR    F P+
Sbjct: 184 EGYEPDPRFMAIG---GDHVQIVRDPKQAVSGAHLVTTDVWTSMGQEEETARRLAHFAPY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QV   L+ +A PDALFMHCLPAHRGEE+ +++LD P+SV +D+AENRLH QKA+L
Sbjct: 241 QVTRELLDLAAPDALFMHCLPAHRGEEISHDLLDDPRSVAWDQAENRLHAQKALL 295


>gi|251799700|ref|YP_003014431.1| ornithine carbamoyltransferase [Paenibacillus sp. JDR-2]
 gi|247547326|gb|ACT04345.1| ornithine carbamoyltransferase [Paenibacillus sp. JDR-2]
          Length = 318

 Score =  291 bits (746), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 145/299 (48%), Positives = 197/299 (65%), Gaps = 5/299 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F  L + +   +  +I++A  +K   +     +PL GK L MIFEK STRTRVSFEV 
Sbjct: 16  RDFLMLLDYTPEEIRYLIDLAIDLKKKQKAGEVYQPLKGKTLGMIFEKSSTRTRVSFEVG 75

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  +FLSG+++Q+GR E I DTA+VLSRY+D I++RT  H  ++EL   AT+PVI
Sbjct: 76  IYQLGGQGLFLSGNDLQIGRGEPILDTAQVLSRYLDGIMIRTFAHRNVVELARGATIPVI 135

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD +HPCQ +AD  T  EH+G ++G   ++ GDGNN++HSL+ GAA+    ++IATP
Sbjct: 136 NGLTDLSHPCQALADYQTILEHKGRLEGLKLAYIGDGNNVVHSLMMGAAKLGVDISIATP 195

Query: 186 IGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EHV 240
            G EP  + L      A+  GA + L  D  +A+  A  V++D W SM QE + ++ E  
Sbjct: 196 EGYEPDADLLKQSIDNAKETGARIHLCRDPKEAIADADVVYSDVWASMGQESEQKDRELA 255

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           F  FQVN +L   A  D LFMHCLPAHRGEEV   V+DGP S++FD+AENRLH QKAI+
Sbjct: 256 FANFQVNEALAKYAKKDYLFMHCLPAHRGEEVSEGVIDGPHSIIFDQAENRLHAQKAIM 314


>gi|114567795|ref|YP_754949.1| ornithine carbamoyltransferase [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
 gi|114338730|gb|ABI69578.1| ornithine carbamoyltransferase [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
          Length = 313

 Score =  291 bits (746), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 144/300 (48%), Positives = 203/300 (67%), Gaps = 7/300 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F  + + S   ++ I+EV  ++K   ++   +  L+GK LAMIF+K STRTRV+FEV 
Sbjct: 11  RDFISIHDFSREEIAYILEVGAELKKMQKSGIAHHYLAGKTLAMIFQKASTRTRVAFEVG 70

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLS  ++QLGR ETI DTA+VL+R VD I++RT  H  +LEL ++++VPVI
Sbjct: 71  MYQLGGHALFLSPRDIQLGRGETIKDTAQVLTRMVDGIMIRTFGHEEVLELAQWSSVPVI 130

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HP Q+I D+MT +EH+G+++G   ++ GDGNN+ HSL+ G A+    + IA+P
Sbjct: 131 NGLTDLLHPTQVIGDLMTIKEHKGTLQGLKCAFIGDGNNVAHSLLFGGAKVGMDVAIASP 190

Query: 186 IGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA--REEH 239
            G E     L  AR      GA + +  D V+A+  A  V+TD W SM QE +A  +E+H
Sbjct: 191 GGFEADVSILEMAREDAQESGARLQVLSDPVEAITDADVVYTDVWASMGQEEEADDKEQH 250

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             Q +QVN  L+S+A PDA+ +HCLPA RG+E+ +EV+DGPQS VF+EAENRLH  KAI+
Sbjct: 251 FLQ-YQVNRKLLSLARPDAIVLHCLPAKRGKEITDEVMDGPQSRVFEEAENRLHAHKAIM 309


>gi|206889848|ref|YP_002248512.1| ornithine carbamoyltransferase [Thermodesulfovibrio yellowstonii
           DSM 11347]
 gi|206741786|gb|ACI20843.1| ornithine carbamoyltransferase [Thermodesulfovibrio yellowstonii
           DSM 11347]
          Length = 299

 Score =  291 bits (745), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 142/281 (50%), Positives = 195/281 (69%), Gaps = 1/281 (0%)

Query: 25  VAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLG 84
           + + I+  S   +   PL GK + MIFEKPSTRTRVSFEVA+  LGG  ++LS  E+QL 
Sbjct: 20  IKRAIELKSNKDYLKYPLIGKCVGMIFEKPSTRTRVSFEVAIYQLGGHPVYLSQRELQLS 79

Query: 85  RAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTF 144
           R ET+ DTA+VLSRY++A+V+RT +HS + E  +++ VPVINALTD+ HPCQ +AD+MT 
Sbjct: 80  RGETVKDTAQVLSRYLNAVVIRTFSHSIIEEFAKWSDVPVINALTDSHHPCQAMADMMTI 139

Query: 145 EEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGAS 204
            E +G ++G   ++ GDGNN+ +SLIE +A     +NIATP G EP  E +  A+N    
Sbjct: 140 FEKKGYLEGIKIAYIGDGNNVANSLIEASALTGAKINIATPQGFEPLEESVEKAKNM-TE 198

Query: 205 VALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCL 264
           + LF+D  +A   A  ++TD W+SM +E    ++  F+ FQ+N  L+  A  DA+ MHCL
Sbjct: 199 INLFNDPYEAALDADVIYTDVWLSMGEEQHTEKKEKFKNFQINSILLKKAKKDAIVMHCL 258

Query: 265 PAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGI 305
           PAHRGEE+ +EVLDGPQSVV D+AENRLHT+KAIL +   +
Sbjct: 259 PAHRGEEITDEVLDGPQSVVLDQAENRLHTEKAILEFLLNL 299


>gi|319790661|ref|YP_004152294.1| ornithine carbamoyltransferase [Thermovibrio ammonificans HB-1]
 gi|317115163|gb|ADU97653.1| ornithine carbamoyltransferase [Thermovibrio ammonificans HB-1]
          Length = 309

 Score =  291 bits (745), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 146/300 (48%), Positives = 197/300 (65%), Gaps = 5/300 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K F  + +     +  II ++  +K   +     +PL G   A+IFEKPSTRTRVSFEV 
Sbjct: 2   KDFISMLDADRLFIENIISLSAFLKEKQKKGELYRPLEGFTAALIFEKPSTRTRVSFEVG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  +++     QLGR E I DTA+VLSRYVD IV+RT    R+ EL  YA+VPVI
Sbjct: 62  VYQLGGHGVYMDTQGSQLGRGEPIKDTARVLSRYVDLIVIRTFGQERVEELARYASVPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD  HPCQ++AD+ T  E++G +KG   ++ GDGNN+ +S + GAA        ATP
Sbjct: 122 NALTDQEHPCQVLADLFTIWEYKGELKGLKVAYLGDGNNMCNSWLVGAAYMGMRFYAATP 181

Query: 186 IGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EHV 240
            G EP  +Y+      A++ GA + + +D  +AVK A  ++TD W SM QE +A E   +
Sbjct: 182 KGYEPLEKYVKAAKEIAKSTGAEIVVTNDPEEAVKDADVIYTDVWASMGQEAEAEERRRI 241

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F P+QVN  L+ +A PD LFMHCLPAHRGEEV +EV++G +SVV+D+AENRLHTQKA++L
Sbjct: 242 FTPYQVNGELVKLAKPDFLFMHCLPAHRGEEVTDEVIEGERSVVWDQAENRLHTQKALIL 301


>gi|88800227|ref|ZP_01115795.1| ornithine carbamoyltransferase [Reinekea sp. MED297]
 gi|88777073|gb|EAR08280.1| ornithine carbamoyltransferase [Reinekea sp. MED297]
          Length = 300

 Score =  291 bits (745), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 146/295 (49%), Positives = 197/295 (66%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L++++S     II  A ++K   +    ++PL  +VL MIFEK STRTRVSFE  
Sbjct: 4   RHFLTLNDLTSDEALKIINRAAELKALHKARTVHEPLKNRVLGMIFEKSSTRTRVSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I D+A+VLS+ VDA+++RT  H ++    +Y+TVPVI
Sbjct: 64  MTQLGGSAIFLSPRDTQLGRGEPIEDSARVLSQMVDAVMIRTFEHHKIQTFADYSTVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+ HPCQ++AD+  + E RGS++GK  +W GDGNN+ +S I  A  F++ LNIA P
Sbjct: 124 NALTDDYHPCQLLADVQAYTEARGSIQGKTVTWVGDGNNMCNSYINAAKLFDFQLNIACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQPF 244
            G EP +E L  A   G  V +     +A  GAH V TD W SM QE +A+     F+ +
Sbjct: 184 EGYEPMSELLESA---GDRVHIIRSVEEATAGAHLVTTDVWASMGQEEEAKARMAAFRDY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QV+  LM +A  DA+F+HCLPAHRGEEV  ++LD P+SVVF++A NRLH QKA+L
Sbjct: 241 QVSPKLMDIADKDAVFLHCLPAHRGEEVSEDMLDDPRSVVFEQAGNRLHAQKALL 295


>gi|16078190|ref|NP_389007.1| ornithine carbamoyltransferase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221308966|ref|ZP_03590813.1| ornithine carbamoyltransferase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221313290|ref|ZP_03595095.1| ornithine carbamoyltransferase [Bacillus subtilis subsp. subtilis
           str. NCIB 3610]
 gi|221318214|ref|ZP_03599508.1| ornithine carbamoyltransferase [Bacillus subtilis subsp. subtilis
           str. JH642]
 gi|221322488|ref|ZP_03603782.1| ornithine carbamoyltransferase [Bacillus subtilis subsp. subtilis
           str. SMY]
 gi|321314855|ref|YP_004207142.1| ornithine carbamoyltransferase [Bacillus subtilis BSn5]
 gi|129265|sp|P18186|OTC_BACSU RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|39811|emb|CAA37444.1| unnamed protein product [Bacillus subtilis]
 gi|408120|emb|CAA81542.1| ornithine carbamoyltransferase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|2633462|emb|CAB12966.1| ornithine carbamoyltransferase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|320021129|gb|ADV96115.1| ornithine carbamoyltransferase [Bacillus subtilis BSn5]
          Length = 319

 Score =  291 bits (745), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 147/302 (48%), Positives = 200/302 (66%), Gaps = 11/302 (3%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIK-NSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           Y K    L ++S  +++ ++  A ++K N  + IF      GK LAMIFEK STRTRVSF
Sbjct: 10  YGKDLLTLKDLSEEDINALLAEAGELKQNKIQPIFH-----GKTLAMIFEKSSTRTRVSF 64

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E  M  LGG  +FLS  ++QLGR ET+ DTAKVLS YVDAI++RT  H ++ EL + A +
Sbjct: 65  EAGMAQLGGSALFLSQKDLQLGRGETVADTAKVLSGYVDAIMIRTFEHEKVEELAKEADI 124

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVIN LTD  HPCQ +AD++T +E +G +KG   ++ GDGNN+ HSL+ G A+    ++I
Sbjct: 125 PVINGLTDKYHPCQALADLLTIKEIKGKLKGVKVAYIGDGNNVAHSLMIGCAKMGCDISI 184

Query: 183 ATPIGSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE 238
           A+P G E  +E       +A   G+SV L  D ++AVK A  +++D + SM QE + +E 
Sbjct: 185 ASPKGYEVLDEAAEAAKTYALQSGSSVTLTDDPIEAVKDADVIYSDVFTSMGQEAEEQER 244

Query: 239 -HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
             VF P+QVN +L+S A PD  F+HCLPAHR EEV  E++DGP S VF +AENRLH QKA
Sbjct: 245 LAVFAPYQVNAALVSHAKPDYTFLHCLPAHREEEVTAEIIDGPNSAVFQQAENRLHVQKA 304

Query: 298 IL 299
           +L
Sbjct: 305 LL 306


>gi|294497451|ref|YP_003561151.1| ornithine carbamoyltransferase [Bacillus megaterium QM B1551]
 gi|294347388|gb|ADE67717.1| ornithine carbamoyltransferase [Bacillus megaterium QM B1551]
          Length = 316

 Score =  291 bits (744), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 141/299 (47%), Positives = 198/299 (66%), Gaps = 5/299 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L ++SS ++  ++E A ++K   +N      L GK L +IFEK STRTRVSFE  
Sbjct: 13  KDLLTLKDLSSDDIMSLLESAIELKQKHKNGEIVTSLKGKTLGLIFEKSSTRTRVSFEAG 72

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG+ +FLS  ++Q+GR ETI DTA+VLS ++DAI++RT  HS++ EL +YA++PVI
Sbjct: 73  MMQLGGNALFLSSQDLQIGRGETIADTARVLSEFIDAIMIRTFEHSKIEELADYASIPVI 132

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD++T  EH+ S +G   ++ GDGNN+ HSL+   A+    ++I  P
Sbjct: 133 NGLTDDYHPCQALADLLTIYEHKKSFEGLKVAYVGDGNNVAHSLMIACAKMGIDISIGCP 192

Query: 186 IGSEPRN---EYLN-WARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HV 240
            G EP++    Y+N  A   GA V +  D V+AVK A  ++ D W SM QE +A++   +
Sbjct: 193 DGYEPKDFVTAYVNEIAATTGAKVTITKDPVEAVKNADAIYADVWTSMGQEEEAQQRLKI 252

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           F P+QVN  L + A  D LF+HCLPAHR EEV   ++DGP SVVF +A NR+H QKA+L
Sbjct: 253 FAPYQVNEELAAYAKSDYLFLHCLPAHREEEVTASIIDGPNSVVFQQAGNRMHVQKALL 311


>gi|312959237|ref|ZP_07773755.1| ornithine carbamoyltransferase [Pseudomonas fluorescens WH6]
 gi|311286497|gb|EFQ65060.1| ornithine carbamoyltransferase [Pseudomonas fluorescens WH6]
          Length = 306

 Score =  291 bits (744), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 147/295 (49%), Positives = 192/295 (65%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSLMDCTPEELVSVIRRGIELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I D A V+SR +DA+++RT  HS L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSPRDTQLGRGEPISDCAIVMSRMLDAVMIRTFAHSTLTEFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS++GK  +W GDGNN+ +S IE A +F++ L IA P
Sbjct: 124 NGLSDDLHPCQLLADMQTFLEHRGSIQGKTVAWIGDGNNMCNSYIEAAIQFDFHLRIACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP  E+L  A  +   V L  D   AV GAH V TD W SM QE + A+   +F P+
Sbjct: 184 EGYEPSAEFLAKADGR---VQLLRDPKDAVVGAHLVSTDVWTSMGQEDETAKRLALFAPY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QV  +L+  A PD LFMHCLPAHRGEE+  ++LD P+SV +D+AENRLH QKA+L
Sbjct: 241 QVTRALLDTAAPDVLFMHCLPAHRGEEISLDLLDDPRSVAWDQAENRLHAQKALL 295


>gi|170720294|ref|YP_001747982.1| ornithine carbamoyltransferase [Pseudomonas putida W619]
 gi|169758297|gb|ACA71613.1| ornithine carbamoyltransferase [Pseudomonas putida W619]
          Length = 306

 Score =  291 bits (744), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 144/295 (48%), Positives = 196/295 (66%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L + ++  L  +I    ++K+  +     +PL  +VL MIFEK STRTRVSFE  
Sbjct: 4   RHFLSLLDFTTDELLGVIRRGIELKDLRKRGVLFEPLKNRVLGMIFEKSSTRTRVSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I D+A VLS  VDA+++RT  HS L E    + VP+I
Sbjct: 64  MIQLGGQAIFLSPRDTQLGRGEPISDSAIVLSSMVDAVMIRTHAHSTLTEFAANSRVPLI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D +HPCQ++AD+ TF EHRG+++GK  +W GDG N+ +S IE A +F++ L IA P
Sbjct: 124 NGLSDESHPCQLLADMQTFHEHRGAIQGKTVAWIGDGFNMCNSYIEAARQFDFQLRIACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G +P   ++    ++   V +  D  +AV+GAH V TD W SM QE + AR    F P+
Sbjct: 184 EGYDPDPRFMALGADR---VQIIRDPREAVRGAHLVTTDVWTSMGQEEETARRLAHFAPY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QVN  L+ +A PDALFMHCLPAHRGEE+ +++LD P+SV +D+AENRLH QKA+L
Sbjct: 241 QVNRELLDLAAPDALFMHCLPAHRGEEISHDLLDDPRSVAWDQAENRLHAQKALL 295


>gi|71734279|ref|YP_276032.1| ornithine carbamoyltransferase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|400686|sp|Q02047|OTC1_PSESH RecName: Full=Ornithine carbamoyltransferase 1,
           phaseolotoxin-sensitive; Short=OTCase 1; AltName:
           Full=SOCT
 gi|151405|gb|AAA25909.1| phaseolotoxin sensitive octase [Pseudomonas syringae]
 gi|440574|emb|CAA54264.1| orthinine carbamoyltransferase [Pseudomonas syringae]
 gi|71554832|gb|AAZ34043.1| ornithine carbamoyltransferase [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 306

 Score =  291 bits (744), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 148/297 (49%), Positives = 194/297 (65%), Gaps = 8/297 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSS--ENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
           +HF  + + +   L  +I    ++K+      +FE  PL  +VL MIFEK STRTR+SFE
Sbjct: 4   RHFLSMMDYTPDELLGLIRRGVELKDLRIRGELFE--PLKNRVLGMIFEKSSTRTRLSFE 61

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
             M  LGG  IFLS  + QLGR E I D+AKV+SR +DA+++RT  HS L E    + VP
Sbjct: 62  AGMIQLGGQAIFLSHRDTQLGRGEPIADSAKVMSRMLDAVMIRTYAHSNLTEFAANSRVP 121

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN L+D+ HPCQ++AD+ TF EHRGS+KGK  +W GDGNN+ +S IE A +F++ L +A
Sbjct: 122 VINGLSDDLHPCQLLADMQTFLEHRGSIKGKTVAWIGDGNNMCNSYIEAAIQFDFQLRVA 181

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQ 242
            P G EP  E+L  A   G  V +  D   AV GAH V TD W SM QE + AR   +F 
Sbjct: 182 CPAGYEPNPEFLALA---GERVTIVRDPKAAVAGAHLVSTDVWTSMGQEEETARRMALFA 238

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           PFQV  + + +A  D LFMHCLPAHRGEE+  ++LD  +SV +D+AENRLH QKA+L
Sbjct: 239 PFQVTRASLDLAEKDVLFMHCLPAHRGEEISVDLLDDSRSVAWDQAENRLHAQKALL 295


>gi|149377079|ref|ZP_01894829.1| ornithine carbamoyltransferase [Marinobacter algicola DG893]
 gi|149358615|gb|EDM47087.1| ornithine carbamoyltransferase [Marinobacter algicola DG893]
          Length = 304

 Score =  290 bits (743), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 144/296 (48%), Positives = 198/296 (66%), Gaps = 6/296 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L+++SS  L  +++   +++N        + L  +VLAMIFEK STRTRVSFE  
Sbjct: 4   RHFLTLNDLSSDELESLVDHGTRLRNDWRRGAVRETLKNRVLAMIFEKSSTRTRVSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLS  + QLGR E I D+A V+S  VDA+++RT +H  +      + VPVI
Sbjct: 64  MTQLGGAALFLSPRDTQLGRGEPIEDSAIVISSMVDAVMIRTFSHDTVDAFAAASRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+ HPCQ++AD+ T+ EHRGS++G   +W GDGNN+  S I  A +F + L +A P
Sbjct: 124 NALTDDFHPCQLLADMQTYREHRGSIRGGTVAWIGDGNNMCQSYINAATQFGFNLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQ--EFKAREEHVFQP 243
            G EP +E L   +++   V++ HD  +A +GA  + TD W SM Q  E KAR +  FQ 
Sbjct: 184 EGYEPDSELLKTHQDR---VSVVHDPAEAARGADLLVTDVWASMGQEDEQKAR-QRAFQN 239

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           +Q+N SLM MA  DALFMHCLPAHRGEE+  ++++ P+SVV+DEAENRLH QKA+L
Sbjct: 240 YQINPSLMKMADKDALFMHCLPAHRGEEISADMMEHPRSVVWDEAENRLHAQKALL 295


>gi|89094676|ref|ZP_01167612.1| ornithine carbamoyltransferase [Oceanospirillum sp. MED92]
 gi|89081022|gb|EAR60258.1| ornithine carbamoyltransferase [Oceanospirillum sp. MED92]
          Length = 301

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 152/298 (51%), Positives = 200/298 (67%), Gaps = 10/298 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVA---KKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           +HF  L ++SS  L  +++ A   K I+N  E ++E  PL  KV+AMIFEK STRTRVSF
Sbjct: 4   RHFLTLRDLSSEELRTLVKRASELKAIRNRGE-VYE--PLKNKVMAMIFEKSSTRTRVSF 60

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E  M   GG  +FLS  + QLGR E I D+AKV+S  VD +++RT +H  + E    +TV
Sbjct: 61  EAGMAQFGGHAMFLSPRDTQLGRGEPISDSAKVISSMVDVVMIRTFSHQLVEEFAANSTV 120

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVINALTD  HPCQ++AD+ T+ EHRG ++GK  +W GDGNN+ HS I  A + ++ LNI
Sbjct: 121 PVINALTDEYHPCQLLADMQTYFEHRGDIQGKTVTWIGDGNNMCHSYINAARQLDFKLNI 180

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EHVF 241
           A P G +P  + +  A NQ   + +    V+AV G+  V TD W SM QE + +E E  F
Sbjct: 181 ACPEGFDPDEKLV--AENQ-ERIFITRSPVEAVTGSDLVVTDVWASMGQEEEQKEREAKF 237

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             FQV+ +LM  A+ DALFMHCLPAHRGEEV  ++L+ P+SVVFDEAENRLH QKA+L
Sbjct: 238 DGFQVSPALMDNANKDALFMHCLPAHRGEEVSMDMLEDPRSVVFDEAENRLHAQKALL 295


>gi|330811351|ref|YP_004355813.1| Ornithine carbamoyltransferase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327379459|gb|AEA70809.1| Ornithine carbamoyltransferase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 306

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 145/295 (49%), Positives = 192/295 (65%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSLMDFTPDELLGVIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRISFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E + D A V+S  +DA+++RT  HS L E   ++ VPVI
Sbjct: 64  MIQLGGQAIFLSPRDTQLGRGEPVSDCAIVMSSMLDAVMIRTFAHSTLTEFAAHSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS++GK  +W GDGNN+ +S IE A +F++ L IA P
Sbjct: 124 NGLSDDLHPCQLLADMQTFLEHRGSIQGKTVAWIGDGNNMCNSYIEAALQFDFQLRIACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G +P  E L  A   G  V +  D  QAV GAH V TD W SM QE + A+   +F P 
Sbjct: 184 EGYDPNAELLAKA---GDRVTIVRDPKQAVAGAHLVSTDVWTSMGQEEETAKRLKLFAPL 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QVN +L+ +A  D LFMHCLPAHRGEE+  ++LD P+SV +D+AENRLH QKA+L
Sbjct: 241 QVNRALLDLADADVLFMHCLPAHRGEEISFDLLDDPRSVAWDQAENRLHAQKALL 295


>gi|302035863|ref|YP_003796185.1| ornithine carbamoyltransferase [Candidatus Nitrospira defluvii]
 gi|300603927|emb|CBK40259.1| Ornithine carbamoyltransferase [Candidatus Nitrospira defluvii]
          Length = 326

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 141/304 (46%), Positives = 197/304 (64%), Gaps = 5/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K F +L +I  + L+ ++ +A ++K        +  L G++L ++F+KPSTRTRVSFE  
Sbjct: 16  KDFLELLSIPVAELTGLLRLAAQLKVKQRRGVSHPLLQGRMLGLLFQKPSTRTRVSFEAG 75

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  + L   ++QL R E++ DTA VLSRY+DAIV+RT +H+   E    A++PVI
Sbjct: 76  MNQLGGQAMVLPMGDIQLSRGESVADTAHVLSRYLDAIVLRTFDHAIAEEWAREASIPVI 135

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ ++D++T +E +  +KG   ++ GDGNN+ +SLIE AA+    + +  P
Sbjct: 136 NGLTDLNHPCQALSDLLTIQEKKRRLKGIKIAYVGDGNNVTNSLIEAAAKMGMTIAVGCP 195

Query: 186 IGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREEHV 240
            G +P    ++ AR +    GA + +  D   AVK A  V+TD WISM QE  +A+   +
Sbjct: 196 PGYQPDRGIVDRAREEARQTGAVIEIGADPFVAVKDADVVYTDVWISMGQEREQAKRLKI 255

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
             P+Q+N  L+  A PDAL MHCLPAHRGEE+  EVLDGPQSVVFD+AENRLH QKAIL+
Sbjct: 256 LAPYQLNARLLKCAKPDALVMHCLPAHRGEEISAEVLDGPQSVVFDQAENRLHMQKAILV 315

Query: 301 WCFG 304
              G
Sbjct: 316 RLLG 319


>gi|303242111|ref|ZP_07328601.1| ornithine carbamoyltransferase [Acetivibrio cellulolyticus CD2]
 gi|302590298|gb|EFL60056.1| ornithine carbamoyltransferase [Acetivibrio cellulolyticus CD2]
          Length = 306

 Score =  290 bits (741), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 137/298 (45%), Positives = 203/298 (68%), Gaps = 5/298 (1%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAM 66
           H   L++++   +  I+ +++K+K   +    +  L GK L MIF K STRTRVSFEV M
Sbjct: 3   HLISLNDLTLEEIEQILNLSEKLKKQQQEGVTHHYLKGKTLGMIFTKSSTRTRVSFEVGM 62

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
             LGG  +FLS +++Q+GR ETI DTA+VLSRY+D I++RT  HS + +L +Y  +P+IN
Sbjct: 63  YQLGGYALFLSSNDIQIGRGETIYDTAQVLSRYIDGIMIRTFAHSDVEDLAKYGNIPIIN 122

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI 186
            LTD  HPCQI+AD+ T  EH+G++KG   ++ GDGNNI +SL+ G ++    + I +P 
Sbjct: 123 GLTDLMHPCQILADLFTVYEHKGTLKGLKMAYLGDGNNIANSLLHGCSKVGMDVAIGSPK 182

Query: 187 GSEPRNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVF 241
           G +   + ++ A+      G+++ L  D V+A+K A  V+TDTW+SM QE + +    +F
Sbjct: 183 GYQCDEQVISEAKEAAKISGSNIILTEDPVEAIKDADVVYTDTWVSMGQESEKQSRIKIF 242

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           +P++V+ +L + A  DA+F+HCLPA+RG EV  E++DG QSVVFDEAENRLH QKAI+
Sbjct: 243 EPYKVDGNLFAKAKEDAIFLHCLPAYRGYEVTEEIIDGSQSVVFDEAENRLHVQKAIM 300


>gi|158522503|ref|YP_001530373.1| ornithine carbamoyltransferase [Desulfococcus oleovorans Hxd3]
 gi|158511329|gb|ABW68296.1| ornithine carbamoyltransferase [Desulfococcus oleovorans Hxd3]
          Length = 305

 Score =  290 bits (741), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 140/296 (47%), Positives = 194/296 (65%), Gaps = 2/296 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L ++   +   + + A ++K        +  LSG+V+ MIF+K STRTRVSFE A
Sbjct: 3   KDITTLYDMEKEDFQILFDSALELKKRQRMGIYDAVLSGRVMGMIFDKHSTRTRVSFEAA 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  I++S  +MQ+ RAE + DTA+VLSRY+DA+V+RT + S + E  +YA +PVI
Sbjct: 63  MTRLGGTVIYMSSRDMQIARAEPVKDTARVLSRYIDALVIRTYSQSLIEEYAQYADIPVI 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NAL+D  HPCQ+++D++T  EH+G  +G   +W GDGNN+ HS I  AA     L +  P
Sbjct: 123 NALSDKYHPCQVLSDLLTVIEHKGGYQGVRIAWVGDGNNVAHSWIAAAAVLGLDLVLGCP 182

Query: 186 IGSEPRNEYLNWARNQG-ASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQP 243
               P  + L  AR +G  SV + +DA +AV GA  ++TD W SM QE + RE   VF+P
Sbjct: 183 ADYMPDPDILENARQKGNGSVTVVNDAAEAVAGADVIYTDVWASMGQEEEHRERLAVFEP 242

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           FQVN +L  +A  DA+ MHCLPAHRGEE+   VL+GP+SVV+D+AEN++H  KAIL
Sbjct: 243 FQVNDALAGLAKKDAIVMHCLPAHRGEEITEAVLEGPRSVVWDQAENKMHMHKAIL 298


>gi|89098075|ref|ZP_01170961.1| ornithine carbamoyltransferase [Bacillus sp. NRRL B-14911]
 gi|89087238|gb|EAR66353.1| ornithine carbamoyltransferase [Bacillus sp. NRRL B-14911]
          Length = 318

 Score =  290 bits (741), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 140/299 (46%), Positives = 201/299 (67%), Gaps = 5/299 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K F  L++ S + +  +++ A+K+KN+S    ++K L+GK+L MIFEKPSTRTRVSFE  
Sbjct: 16  KDFLTLADFSKNTILGLVQKARKMKNASLLGKDSKSLNGKILGMIFEKPSTRTRVSFEAG 75

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  ++L+ +++Q+GR ET+ DTAKVLS+YVDAI++RT +H  + EL  +A +PVI
Sbjct: 76  MIQLGGSALYLNSNDLQIGRGETVADTAKVLSQYVDAIMIRTFSHGMVEELALHADIPVI 135

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ +AD++T  E +G ++G    ++GDGNN+ HSL+  AA+    L IA P
Sbjct: 136 NGLTDLYHPCQALADLLTIYEVKGRLEGLKLVYAGDGNNVAHSLMIAAAKVGMNLTIAAP 195

Query: 186 IGSEPRNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HV 240
            G EP+ + L  A+      GA + + + A++A  GA  ++TD W SM QE +  E   +
Sbjct: 196 PGYEPQEKVLALAKQFGKETGAEIEVVNSAIEAAAGADILYTDVWTSMGQEQENAERLEI 255

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           F+ +QVN  L + A  D  F+HCLPAHRGEEV  +++DG  S VF +A NRLH QKA+L
Sbjct: 256 FKSYQVNAQLAAAAKQDYTFLHCLPAHRGEEVAADIIDGSHSAVFQQAGNRLHAQKALL 314


>gi|148244567|ref|YP_001219261.1| ornithine carbamoyltransferase [Candidatus Vesicomyosocius okutanii
           HA]
 gi|146326394|dbj|BAF61537.1| ornithine carbamoyltransferase [Candidatus Vesicomyosocius okutanii
           HA]
          Length = 299

 Score =  290 bits (741), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 143/297 (48%), Positives = 200/297 (67%), Gaps = 4/297 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF +L+++S+ +L+ II+ A K+K   ++   NK L  K LAMIF+K STRTRVSFE  
Sbjct: 3   KHFINLNDLSNYDLTQIIKQAIKLKEQYKSGKINKALENKTLAMIFDKSSTRTRVSFEAG 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLS  ++QLGR E I D+A V+S  VDAI++R ++H  +   +E+++VP+I
Sbjct: 63  MTQLGGRALFLSDKDIQLGRGEPIIDSAIVISSMVDAIMIRVSSHEDIQTFSEHSSVPII 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NAL+D +HPCQ++AD+MT++E+ GS+  K  +W GDGNN+ H+ I+ A  FN+ LNIA P
Sbjct: 123 NALSDESHPCQLLADMMTYQEYNGSIANKTVAWIGDGNNMCHTYIQAAKSFNFKLNIAAP 182

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREEHVFQPF 244
              +P   ++    N    + LF D   A K    + TD W SM QE  + + E  F+ F
Sbjct: 183 KNYQPNQSFIEKYANH---IHLFTDIKTACKEVDLIVTDVWASMGQETEQIKREIAFKDF 239

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QV+  LMS A P A+FMHCLPAHRG+EV   V+D  QS+V+ EAENRLH QKA+LL+
Sbjct: 240 QVDTVLMSKAKPTAVFMHCLPAHRGKEVSANVIDSNQSLVWSEAENRLHVQKALLLY 296


>gi|284161509|ref|YP_003400132.1| ornithine carbamoyltransferase [Archaeoglobus profundus DSM 5631]
 gi|284011506|gb|ADB57459.1| ornithine carbamoyltransferase [Archaeoglobus profundus DSM 5631]
          Length = 305

 Score =  290 bits (741), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 140/300 (46%), Positives = 195/300 (65%), Gaps = 1/300 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH   +++++   L  I+++A+K+K           L  K LAMIFE PSTRTR+SFEVA
Sbjct: 2   KHLISMADLTPEELEEILKLAEKLKEERYKGRVTDYLKNKSLAMIFELPSTRTRISFEVA 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  ++L+ +++QLGR E I DTA+VLSRYV A++MR   H  +LE  +Y+TVPVI
Sbjct: 62  MTDLGGHALYLNWNDLQLGRGEPIKDTARVLSRYVHAVMMRVRKHETILEFAKYSTVPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D  HPCQ+IAD++T +E++G +K    +W GDGNN+ +SLI  +A     + + TP
Sbjct: 122 NGLSDLEHPCQVIADLLTIKEYKGDLKSVRLTWIGDGNNVCNSLILASALTGMEMVVCTP 181

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQPF 244
            G EP  E +  A   GA +    D ++AV+ A  ++TD W+SM QE + R+    F  +
Sbjct: 182 KGYEPNKEIVEKALKMGAKLTFESDPLKAVENADVIYTDVWVSMGQERERRKRLKAFTGY 241

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QV   L+  A  + + MHCLPAHRGEE+  EVL+G  S+VFD+AENRLH QKAILL   G
Sbjct: 242 QVTQKLVDSAKTNVVVMHCLPAHRGEEITEEVLEGEHSIVFDQAENRLHAQKAILLKLIG 301


>gi|118602466|ref|YP_903681.1| ornithine carbamoyltransferase [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
 gi|166973837|sp|A1AWA3|OTC_RUTMC RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|118567405|gb|ABL02210.1| ornithine carbamoyltransferase [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
          Length = 299

 Score =  290 bits (741), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 143/299 (47%), Positives = 199/299 (66%), Gaps = 4/299 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF +L ++ + +L+ II+ A  +K   ++   NK L  K LAMIF+K STRTRVSFE  
Sbjct: 3   KHFINLDDLPNHDLTQIIKQAIALKKQYKSGKINKILEHKTLAMIFDKSSTRTRVSFEAG 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLS  ++QLGR E I D+A V+S  VD I+MR ++H  +    E ++VP+I
Sbjct: 63  MTQLGGHALFLSDKDIQLGRGEPIIDSAIVISSMVDVIMMRISSHKDIHTFAENSSVPII 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NAL+D +HPCQ+++D+MT++EH GS+  K  +W GDGNN+ H+ ++ A  FN+ LNIATP
Sbjct: 123 NALSDESHPCQLLSDMMTYQEHNGSIANKTIAWIGDGNNMCHTYMQAAKSFNFKLNIATP 182

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV-FQPF 244
              +P  +++    N    + LF DA +A +    V TD W SM QE +  +  + F+ F
Sbjct: 183 KNYQPDQDFIEKYANH---IHLFTDAQKACQKVDLVVTDVWASMGQEAEQTKRKITFKDF 239

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
            VN +LMS A P A+FMHCLPAHRGEEV   V+DG QS+V+ EAENRLH QKA+LL+  
Sbjct: 240 SVNAALMSKAKPSAVFMHCLPAHRGEEVSTNVIDGSQSLVWLEAENRLHVQKALLLYLL 298


>gi|194014774|ref|ZP_03053391.1| ornithine carbamoyltransferase [Bacillus pumilus ATCC 7061]
 gi|194013800|gb|EDW23365.1| ornithine carbamoyltransferase [Bacillus pumilus ATCC 7061]
          Length = 316

 Score =  290 bits (741), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 143/302 (47%), Positives = 205/302 (67%), Gaps = 11/302 (3%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIK-NSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           Y K F  L + S ++++ +IE A+++K N  +++F+     GK LAMIFEK STRTRVSF
Sbjct: 11  YGKDFLSLKDFSINDIAYLIEKAEEMKQNPYQDLFK-----GKTLAMIFEKSSTRTRVSF 65

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E  M  LGG  +FLS +++Q+GR ETI DTA+VLS YVD I++RT  H ++ EL +YA++
Sbjct: 66  EAGMTQLGGHALFLSSNDLQIGRGETISDTAQVLSGYVDGIMIRTFEHEKVEELAQYASI 125

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVIN LTD +HPCQ +AD++T +E +G++KG   ++ GDGNN+ HSL+ G A+    + +
Sbjct: 126 PVINGLTDYSHPCQALADLLTIKEAKGTLKGIKVAYIGDGNNVAHSLMVGCAQLGCDIAV 185

Query: 183 ATPIGSEPRNEYLNWAR----NQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE 238
           A+P G EP  E  + AR      GA V +  D V AV+ A  +++D + SM QE +  + 
Sbjct: 186 ASPKGYEPLQEVTDTAREFAKQSGAEVIVTTDPVAAVQNADVIYSDVFTSMGQEAETEKR 245

Query: 239 HV-FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
              F+ +QVN +LM  A  D +F+HCLPAHRGEEV  +++DGP S VF +AENRLH QKA
Sbjct: 246 LAEFKEYQVNDALMRHAAKDYIFLHCLPAHRGEEVTADIIDGPHSKVFQQAENRLHVQKA 305

Query: 298 IL 299
           ++
Sbjct: 306 LI 307


>gi|311032896|ref|ZP_07710986.1| ornithine carbamoyltransferase [Bacillus sp. m3-13]
          Length = 324

 Score =  289 bits (740), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 149/304 (49%), Positives = 198/304 (65%), Gaps = 6/304 (1%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAM 66
           HF  L + S  ++  ++E A K+K   +    +  L GKVLAM+FEK STRTRVSFEV M
Sbjct: 20  HFLTLGSFSQEDIYFLLEDAIKLKKYQKEGIPHPFLQGKVLAMLFEKASTRTRVSFEVGM 79

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
             LGG  IFLS +++QLGR E+  DTAKVLSRYVD +++RT +H  L +   ++ VP+IN
Sbjct: 80  LQLGGHAIFLSSNDIQLGRGESPADTAKVLSRYVDGLMIRTFDHEILEDFARHSDVPIIN 139

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLNIATP 185
            LTD+ HP Q++AD++T +EH+G +KG    + GD  NN+ HSLIEGA +    ++IA P
Sbjct: 140 GLTDSHHPAQVLADLLTIKEHKGKLKGLKICYLGDANNNMAHSLIEGAVKVGMDISIACP 199

Query: 186 IGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HV 240
            G EP    L   + +    G+S+ +    V+ +K A  V TD W SM QE +++E   V
Sbjct: 200 SGFEPDLSILTAMKKETLLTGSSIHVGESPVEMIKDADVVVTDVWTSMGQEAESKERLKV 259

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F P+QVN  L   A  D +F+HCLPAHRGEEV  E++DGP SVVFDEAENRLH QKAIL 
Sbjct: 260 FAPYQVNKELCKHAKDDFIFLHCLPAHRGEEVAIEIIDGPHSVVFDEAENRLHAQKAILK 319

Query: 301 WCFG 304
              G
Sbjct: 320 ALLG 323


>gi|253702330|ref|YP_003023519.1| ornithine carbamoyltransferase [Geobacter sp. M21]
 gi|251777180|gb|ACT19761.1| ornithine carbamoyltransferase [Geobacter sp. M21]
          Length = 303

 Score =  289 bits (740), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 142/296 (47%), Positives = 193/296 (65%), Gaps = 2/296 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F  LS  S + L  I  + K++K   +N  E+  L GK LAMIFEK STRTR+SFEV 
Sbjct: 3   RDFLALSQFSKAELDAIFLLTKELKEKQKNGVEHHLLKGKSLAMIFEKSSTRTRLSFEVG 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +F+S  + Q+GR E I DTA+V++RY D +++RT     + E  +YA+VP+I
Sbjct: 63  MYQLGGHPLFISSKDSQMGRGEPIKDTARVMARYCDGVMIRTFAQETVEEFAKYASVPII 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQI+ADI T  EHRG  +G  F+W GDGNN+ +S IE AA F + L +A P
Sbjct: 123 NGLTDLHHPCQIMADIFTVIEHRGGYQGLKFAWIGDGNNMANSWIEAAAIFGFDLTLACP 182

Query: 186 IGSEPRNEYLNWARNQGAS-VALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQP 243
            G +P  + L WAR   +S + +  D  QA + A  + TD W SM QE + +  E  F  
Sbjct: 183 EGYDPNPQVLEWARKHASSKIVVTRDPKQAAQDADVLNTDVWASMGQEEEQKIREKAFAG 242

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           FQ+N  L+ +A  +A+ +HCLPAHRGEE+ ++V++GP S V+DEAENRLH QKAI+
Sbjct: 243 FQLNEELLDLARGNAMVLHCLPAHRGEEITDDVIEGPHSAVWDEAENRLHVQKAIM 298


>gi|11498854|ref|NP_070083.1| ornithine carbamoyltransferase [Archaeoglobus fulgidus DSM 4304]
 gi|3183096|sp|O29013|OTC_ARCFU RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|2649323|gb|AAB89987.1| ornithine carbamoyltransferase (argF) [Archaeoglobus fulgidus DSM
           4304]
          Length = 307

 Score =  289 bits (740), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 143/300 (47%), Positives = 189/300 (63%), Gaps = 1/300 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH   ++++    L  I+++A+K+K           L  K LAMIFE PSTRTRVSFEVA
Sbjct: 2   KHLLSMADLEKDELFEILKLAEKLKEERYKGVVTDYLKNKSLAMIFELPSTRTRVSFEVA 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  ++L   E+QLGR E I DTA+VLSRYV A++MR   HS + E   Y+TVPVI
Sbjct: 62  MTDLGGHALYLGWDELQLGRGEPIKDTARVLSRYVHAVMMRVREHSTIEEFARYSTVPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L++  HPCQ+IAD++T  E+RG  K    +W GDGNN+ +S+I  AA     + I+TP
Sbjct: 122 NGLSNLEHPCQVIADLLTIYEYRGDFKDVTLAWVGDGNNVCNSMILAAALTGMKMVISTP 181

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREEHVFQPF 244
              +P  E +  A   GA +    D  +AVK A  ++TD W SM QE  K      FQP+
Sbjct: 182 ENYDPNPEIVKKAEEMGAKLRFVRDPKEAVKEADVIYTDVWTSMGQEAEKEARLKAFQPY 241

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QV+  L+  +  D + MHCLPAHRGEE+ +EV++G  S+VFD+AENRLH QKAILL   G
Sbjct: 242 QVSDELLKFSKDDVVVMHCLPAHRGEEITDEVMEGKHSIVFDQAENRLHAQKAILLKLLG 301


>gi|283851130|ref|ZP_06368414.1| ornithine carbamoyltransferase [Desulfovibrio sp. FW1012B]
 gi|283573526|gb|EFC21502.1| ornithine carbamoyltransferase [Desulfovibrio sp. FW1012B]
          Length = 301

 Score =  289 bits (739), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 143/300 (47%), Positives = 202/300 (67%), Gaps = 4/300 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           P+HF  + + +      +++ A  +K ++     +  L GK   ++FEK STRTRVSFEV
Sbjct: 2   PQHFLTILDFTPEEAVRLLDRAAAMKAANHR---SDLLHGKTCILVFEKASTRTRVSFEV 58

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           A++HLGG  IF++ ++ QLGR E I DTA+VLSRY D +++RT  H +L EL E  ++PV
Sbjct: 59  AVRHLGGWPIFMTQNDSQLGRDEPIRDTARVLSRYADCLIVRTFGHHKLQELAESGSIPV 118

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           +NAL+D  HPCQI+AD++T  EH G + G   ++ GDGNNI HSLI  AAR+   + +A 
Sbjct: 119 VNALSDEYHPCQIMADLLTMREHSGRLDGLTVAFVGDGNNIAHSLINAAARYPIKVVVAA 178

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREEHVFQP 243
           P G EP    +  AR+ GA VA+ +D  +A +GAH ++TD W SM QE  +A+    F  
Sbjct: 179 PKGYEPDPAVVEKARSLGADVAVVNDPAEAARGAHYLYTDVWASMGQEAEQAKRAKAFAG 238

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           FQ+N +L+++A P A  +HCLPAHRGEE+ + V++GP S+V+DEAENRLH QKAIL W F
Sbjct: 239 FQINDALLALAAPGAKVLHCLPAHRGEEITDAVMEGPASIVWDEAENRLHVQKAILEWIF 298


>gi|146308361|ref|YP_001188826.1| ornithine carbamoyltransferase [Pseudomonas mendocina ymp]
 gi|145576562|gb|ABP86094.1| ornithine carbamoyltransferase [Pseudomonas mendocina ymp]
          Length = 306

 Score =  289 bits (739), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 143/295 (48%), Positives = 191/295 (64%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  + + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSMMDYTPDELVGLIRRGIELKDLRNRGVLFEPLKNRVLGMIFEKASTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E IGD A V+S  +DA+++RT  HS L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSPRDTQLGRGEPIGDAAIVMSSMLDAVMIRTFAHSNLTEFAAKSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS+ GK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFLEHRGSIAGKTVAWIGDGNNMCNSYIEAAMQFDFQLKVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH-VFQPF 244
            G EP   +L  A   G  V +  D  +AV GAH V TD W SM QE +A +   +F+P+
Sbjct: 184 AGYEPDARFLAQA---GERVQVLRDPREAVAGAHLVSTDVWASMGQEDEAAQRMALFRPY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QV   L+ +A  D LFMHCLPAHRGEE+  ++LD P+SV +D+AENRLH QKA+L
Sbjct: 241 QVTPQLLDLAAEDVLFMHCLPAHRGEEISVDLLDDPRSVAWDQAENRLHAQKALL 295


>gi|295702823|ref|YP_003595898.1| ornithine carbamoyltransferase [Bacillus megaterium DSM 319]
 gi|294800482|gb|ADF37548.1| ornithine carbamoyltransferase [Bacillus megaterium DSM 319]
          Length = 316

 Score =  289 bits (739), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 139/299 (46%), Positives = 196/299 (65%), Gaps = 5/299 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L ++SS ++  ++E A ++K   +N      L GK L +IFEK STRTRVSFE  
Sbjct: 13  KDLLTLKDLSSDDIMSLLESAIELKEKHKNGEIVTSLKGKTLGLIFEKSSTRTRVSFEAG 72

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG+ +FLS  ++Q+GR ETI DTA+VLS ++DAI++RT  HS++ EL +YA++PVI
Sbjct: 73  MMQLGGNALFLSSQDLQIGRGETIADTARVLSEFIDAIMIRTFEHSKIEELADYASIPVI 132

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD++T  EH+ S +G   ++ GDGNN+ HSL+   A+    ++I  P
Sbjct: 133 NGLTDDYHPCQALADLLTIYEHKKSFEGLKVAYVGDGNNVAHSLMIACAKMGIDISIGCP 192

Query: 186 IGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HV 240
            G EP++    +    A   GA V +  D V+AVK A  ++ D W SM QE +A++   +
Sbjct: 193 DGYEPKDFVTAYVHEIAATTGAKVTITKDPVEAVKNADAIYADVWTSMGQEEEAQQRLKI 252

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           F P+QVN  L + A  D LF+HCLPAHR EEV   ++DGP SVVF +A NR+H QKA+L
Sbjct: 253 FAPYQVNEELAAYAKSDYLFLHCLPAHREEEVTASIIDGPNSVVFQQAGNRMHVQKALL 311


>gi|220935631|ref|YP_002514530.1| ornithine carbamoyltransferase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219996941|gb|ACL73543.1| ornithine carbamoyltransferase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 300

 Score =  288 bits (738), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 144/295 (48%), Positives = 191/295 (64%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++++  L  +I  A ++K       E+ PL GK L MIFEK STRTRVSFEV 
Sbjct: 4   RHFLSLLDLTTEELRGLIARATELKRMHYEGVEHTPLKGKTLGMIFEKSSTRTRVSFEVG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLS  + QLGR E I D+A+VLSR VD +++RT  H ++     ++ VPVI
Sbjct: 64  MIQLGGHALFLSPRDTQLGRGEPIEDSARVLSRMVDGVMIRTFEHEKIERFAAHSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ++AD+ T+ EHRG + G+   + GDGNN+ +S I  A R  + L+IA P
Sbjct: 124 NGLTDLEHPCQLLADMQTWFEHRGDIAGRTVCYVGDGNNMCNSYITAAQRLGFTLHIACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQE-FKAREEHVFQPF 244
            G +P  + +  A   G    +  D  +A +GA  V TD W SM QE  +++    F  +
Sbjct: 184 EGYDPDPDLMQQA---GDCARIIRDPREAARGADLVVTDVWASMGQEDEQSQRRQAFARY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            VN +LM++A PDALFMHCLPAHR EEV  EVL+GPQSVV+DEAENRLH QKA+L
Sbjct: 241 VVNGALMALARPDALFMHCLPAHREEEVSTEVLEGPQSVVWDEAENRLHAQKALL 295


>gi|212639970|ref|YP_002316490.1| ornithine carbamoyltransferase [Anoxybacillus flavithermus WK1]
 gi|259515582|sp|B7GM02|OTC_ANOFW RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|212561450|gb|ACJ34505.1| Ornithine carbamoyltransferase [Anoxybacillus flavithermus WK1]
          Length = 314

 Score =  288 bits (738), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 145/300 (48%), Positives = 200/300 (66%), Gaps = 5/300 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K F  L++ S   +  ++ +A ++K   +N     PLSGK LAMIFEKPSTRTRVSFEV 
Sbjct: 12  KDFLTLADYSKEEIEYLLHLAVELKEKQQNGERYTPLSGKTLAMIFEKPSTRTRVSFEVG 71

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  + LS  ++Q+GR ETI DTA+VLS YVDAI++RT  H ++ EL  YAT+PVI
Sbjct: 72  MVQLGGHALHLSSRDLQIGRGETIADTARVLSEYVDAIMIRTFEHEKVEELAHYATIPVI 131

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD++T  E +G ++G   ++ GDGNN+ H+L+  AA+      +A+P
Sbjct: 132 NGLTDDDHPCQALADLLTIYEVKGKLQGLKLAYIGDGNNMAHALMLAAAKVGMHCAVASP 191

Query: 186 IGSEPRNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HV 240
            G EP+   +  A+      GA++ + +D  +A+  A  V+TD W SM QE +A E  HV
Sbjct: 192 KGYEPKEAVVKEAKQIANESGATIVVTNDPYEAIADADVVYTDVWASMGQEAEANERMHV 251

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F PFQVN +L+  A  D +F+HCLPAHRGEEV   V+DG +S +F +A NRLH QKA+L+
Sbjct: 252 FAPFQVNEALVQQAKQDFMFLHCLPAHRGEEVTEGVIDGVRSYIFQQAGNRLHAQKALLV 311


>gi|332971693|gb|EGK10641.1| ornithine carbamoyltransferase [Desmospora sp. 8437]
          Length = 325

 Score =  288 bits (738), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 143/299 (47%), Positives = 196/299 (65%), Gaps = 5/299 (1%)

Query: 11  LSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLG 70
           L + +   +  +++ A  +K + +    ++PL+GK LAMIF+KPSTRTR+SFE  M  LG
Sbjct: 27  LLDFTPREIQGLVDEALGMKQAWKEGKADRPLTGKTLAMIFDKPSTRTRISFETGMAQLG 86

Query: 71  GDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTD 130
           G  + L+  ++QLGR E++ DTA+VLS YVDA+++RT +H  + EL  +A++P+IN LTD
Sbjct: 87  GHPLHLNRGDLQLGRGESLPDTARVLSGYVDAVLIRTFSHEAVEELARHASIPIINGLTD 146

Query: 131 NTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEP 190
             HPCQ +AD++T +E RG + G   ++ GDGNN+LHSL+E AA     L  ATP G EP
Sbjct: 147 LHHPCQALADLLTLKESRGRLAGLTLAYIGDGNNMLHSLLEAAAATGIHLRAATPQGYEP 206

Query: 191 RNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQ-EFKAREEHVFQPFQ 245
               +  AR      GA +    D  +A  GA  ++TD W SM Q E K R    F  FQ
Sbjct: 207 DPAIIRRARKAATRTGADLYFTSDPREAATGADAIYTDVWASMGQEEEKERRIRDFAGFQ 266

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           V+ +LMS+A PDALFMHCLPA+RG EV  EV+DGP+S+VF +AENRLH QKA+L    G
Sbjct: 267 VDPALMSLAKPDALFMHCLPAYRGLEVSAEVIDGPRSIVFPQAENRLHAQKALLAALIG 325


>gi|300113409|ref|YP_003759984.1| ornithine carbamoyltransferase [Nitrosococcus watsonii C-113]
 gi|299539346|gb|ADJ27663.1| ornithine carbamoyltransferase [Nitrosococcus watsonii C-113]
          Length = 304

 Score =  288 bits (738), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 149/299 (49%), Positives = 195/299 (65%), Gaps = 5/299 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M  P HF  L ++ +  +  ++  A ++K         +PL  +VL M+FEK STRTRVS
Sbjct: 1   MAVP-HFLTLFDLPADEIKQLVRRAIELKALQRQGKIYEPLKNQVLGMLFEKSSTRTRVS 59

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FEV M  LGG+ +FLS  + QLGR E + DTA+VLSR V+ +++RT +HS L     Y+ 
Sbjct: 60  FEVGMIQLGGNAVFLSPRDTQLGRGEPLEDTARVLSRMVNCLMVRTFSHSMLEHFAAYSQ 119

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVINALTD+ HPCQ++ADI T+ EHRG ++G+  +W GDGNN+  S I  A +F++ L+
Sbjct: 120 VPVINALTDSYHPCQLLADIQTYFEHRGDIQGRTVAWIGDGNNMCQSYINAACQFDFQLH 179

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREEHV 240
           IATP G  P    L  AR +   V +  +  +AV+GA  + TD W SM QE  K R    
Sbjct: 180 IATPTGYGPDPAILQIARER---VQIMAEPQEAVRGADLIVTDVWTSMGQEQEKHRRLQD 236

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
              +QVN  LMS+A  DALFMHCLPAHRGEEV  EV+D  QSVV+DEAENRLH QKA+L
Sbjct: 237 LADYQVNSELMSLAKRDALFMHCLPAHRGEEVSAEVMDSSQSVVWDEAENRLHAQKALL 295


>gi|157691830|ref|YP_001486292.1| ornithine carbamoyltransferase [Bacillus pumilus SAFR-032]
 gi|157680588|gb|ABV61732.1| ornithine carbamoyltransferase [Bacillus pumilus SAFR-032]
          Length = 316

 Score =  288 bits (737), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 141/302 (46%), Positives = 205/302 (67%), Gaps = 11/302 (3%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIK-NSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           Y K F  L + S ++++ +IE A+++K N  +++F+     GK LAMIFEK STRTRVSF
Sbjct: 11  YGKDFLSLKDFSINDIAYLIEKAEEMKQNPYQDLFK-----GKTLAMIFEKSSTRTRVSF 65

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E  M  LGG  +FLS +++Q+GR ETI DTA+VLS YVD I++RT  H ++ EL +YA++
Sbjct: 66  EAGMTQLGGHALFLSSNDLQIGRGETISDTAQVLSGYVDGIMIRTFEHEKVEELAQYASI 125

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVIN LTD +HPCQ +AD++T +E +G++KG   ++ GDGNN+ HSL+ G A+    + +
Sbjct: 126 PVINGLTDYSHPCQALADLLTIKEAKGTLKGIKVAYIGDGNNVAHSLMVGCAQLGCDIAV 185

Query: 183 ATPIGSEPRNEYLN----WARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE 238
           A+P G EP  E  +    +A+  GA V +  D V AV+ A  +++D + SM QE +  + 
Sbjct: 186 ASPKGYEPLQEVTDTAHEFAKQSGAEVIVTTDPVAAVQNADVIYSDVFTSMGQEAETEKR 245

Query: 239 HV-FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
              F+ +Q+N  LM  A  D +F+HCLPAHRGEEV  +++DGP S VF +AENRLH QKA
Sbjct: 246 LAEFKEYQINDELMRHAAKDYIFLHCLPAHRGEEVTADIIDGPHSKVFQQAENRLHVQKA 305

Query: 298 IL 299
           ++
Sbjct: 306 LI 307


>gi|297618322|ref|YP_003703481.1| ornithine carbamoyltransferase [Syntrophothermus lipocalidus DSM
           12680]
 gi|297146159|gb|ADI02916.1| ornithine carbamoyltransferase [Syntrophothermus lipocalidus DSM
           12680]
          Length = 315

 Score =  288 bits (737), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 144/299 (48%), Positives = 197/299 (65%), Gaps = 5/299 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F  + + +S  +  I+E+A+K+K   +    +  L+GK L MIF+KPSTRTRVSFEV 
Sbjct: 12  RDFLAIRDYTSEEVMEILELAQKLKKMQKEGIPHPLLAGKTLGMIFQKPSTRTRVSFEVG 71

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  +FLS +++Q+GR ETI DTA  LSRY+D I++RT     + EL  +A++PVI
Sbjct: 72  IYQLGGYGLFLSPNDLQMGRGETIKDTALTLSRYLDGIMIRTFAQEEVEELAYWASIPVI 131

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQI+ DI+T  E +G++KG   ++ GDGNN+ HSL+ G A+    + +A P
Sbjct: 132 NGLTDLLHPCQIMGDILTILEKKGTLKGLKCAFIGDGNNVCHSLLVGGAKVGMNVVVACP 191

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EHV 240
            G  P++E     L  A   GA + +  D  +AV GA  ++TD W SM QE +A E E  
Sbjct: 192 PGFAPKHEIMAQALKDAEETGAKLWVVEDPAEAVDGADVIYTDVWASMGQEKEAHEKEKH 251

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           F  +QVN SL+  A PD + MHCLPA RG E+ +EV+DGP SVVFDEAENRLH QKAI+
Sbjct: 252 FARYQVNASLLGKAKPDVIVMHCLPAKRGREITDEVMDGPNSVVFDEAENRLHAQKAIM 310


>gi|148643286|ref|YP_001273799.1| ornithine carbamoyltransferase [Methanobrevibacter smithii ATCC
           35061]
 gi|222445518|ref|ZP_03608033.1| hypothetical protein METSMIALI_01158 [Methanobrevibacter smithii
           DSM 2375]
 gi|261349921|ref|ZP_05975338.1| ornithine carbamoyltransferase [Methanobrevibacter smithii DSM
           2374]
 gi|166918657|sp|A5UMK3|OTC_METS3 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|148552303|gb|ABQ87431.1| ornithine carbamoyltransferase, ArgF [Methanobrevibacter smithii
           ATCC 35061]
 gi|222435083|gb|EEE42248.1| hypothetical protein METSMIALI_01158 [Methanobrevibacter smithii
           DSM 2375]
 gi|288860704|gb|EFC93002.1| ornithine carbamoyltransferase [Methanobrevibacter smithii DSM
           2374]
          Length = 301

 Score =  288 bits (736), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 140/283 (49%), Positives = 192/283 (67%), Gaps = 5/283 (1%)

Query: 22  IIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEM 81
           ++++ +  KN  E   E KPL+GK LAMIF+K STRTRVSF+V M  LGG  +FLS SE+
Sbjct: 14  VLDILELAKNFKEGKMEEKPLAGKSLAMIFQKSSTRTRVSFDVGMYQLGGQALFLSSSEL 73

Query: 82  QLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADI 141
           Q+GR E I DTAKVLSR+VD I++R   H  ++EL +Y+ VPVI+ LT+  HPCQ +AD+
Sbjct: 74  QMGRGEPIPDTAKVLSRFVDGIMIRAIEHDDVVELAKYSDVPVISGLTNLEHPCQALADM 133

Query: 142 MTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARN- 200
           +T +EH G ++GK   + GDGNN+ +SL+  A      +++A P G EP  + +N A+  
Sbjct: 134 LTIQEHLGKLEGKKLCFVGDGNNVCNSLLLMAPLVGMDMSVACPEGYEPNEDIVNMAKKL 193

Query: 201 ---QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EHVFQPFQVNLSLMSMAHP 256
                  + +  D   A+     V+TD W+SM  E +A + +  F P+QVN +LMS+A+ 
Sbjct: 194 AEEHNKEITISSDLKVALDNVDVVYTDVWVSMGDEKEAEQRQKDFAPYQVNSNLMSLAND 253

Query: 257 DALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            A+FMHCLPA RG+EV  EV+DGPQSVVFDEAENRLH QKA+L
Sbjct: 254 GAIFMHCLPAIRGQEVSGEVIDGPQSVVFDEAENRLHAQKAVL 296


>gi|313895652|ref|ZP_07829208.1| ornithine carbamoyltransferase [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312975778|gb|EFR41237.1| ornithine carbamoyltransferase [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 309

 Score =  288 bits (736), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 146/303 (48%), Positives = 194/303 (64%), Gaps = 13/303 (4%)

Query: 11  LSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLG 70
           + ++S+ ++  I+ +A  +K   +    +  L+GK L MIFEK STRTRVSFEV M  LG
Sbjct: 10  IHDLSAGDVEEILALAADLKVRQKAGIPHPLLAGKTLGMIFEKSSTRTRVSFEVGMYQLG 69

Query: 71  GDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTD 130
           G  +FLS  ++QLGR E I DTA+VLSRY+D I++RT  H R+ EL  +A VPVINAL+D
Sbjct: 70  GQALFLSSRDLQLGRGEPIADTARVLSRYLDGIMIRTYGHERIEELARWADVPVINALSD 129

Query: 131 NTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEP 190
             HPCQ + D++T  EH+G + G   ++ GDGNN+ HSL+  AA+       ATP G EP
Sbjct: 130 LLHPCQALTDLLTIREHKGRLAGLKMAYVGDGNNMTHSLMYAAAKVGMHFAAATPAGYEP 189

Query: 191 RNEYLNWAR----NQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH-----VF 241
             + +  AR      GASV L HD  +AV+ A  V TDTW SM QE    EEH     VF
Sbjct: 190 NEKVVQNARADASETGASVTLTHDPKEAVRDADVVVTDTWASMGQE----EEHDARTAVF 245

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           +P+QVN  L++ A   A+ MHCLPA+RGEE+  +V +   +V+FDEAENRLH QKAI+  
Sbjct: 246 RPYQVNPELLAAADARAVVMHCLPAYRGEEITEDVFESFANVIFDEAENRLHVQKAIMAL 305

Query: 302 CFG 304
             G
Sbjct: 306 VMG 308


>gi|49478550|ref|YP_038194.1| ornithine carbamoyltransferase [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|56404370|sp|Q6HE32|OTC_BACHK RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|49330106|gb|AAT60752.1| ornithine carbamoyltransferase, catabolic [Bacillus thuringiensis
           serovar konkukian str. 97-27]
          Length = 316

 Score =  288 bits (736), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 138/302 (45%), Positives = 196/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTKEEIISLIEFAIHLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR ET+ DTAKVLS+Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQMGRGETVSDTAKVLSQYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEETNTFKGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A+  GA + + HD   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 VGYEPNEEIVKKALAIAKETGAEIEVLHDPELAVNEADFIYTDVWMSMGQEGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L++ A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINKELVTHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|329893653|ref|ZP_08269787.1| Ornithine carbamoyltransferase [gamma proteobacterium IMCC3088]
 gi|328923580|gb|EGG30892.1| Ornithine carbamoyltransferase [gamma proteobacterium IMCC3088]
          Length = 303

 Score =  287 bits (735), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 141/299 (47%), Positives = 197/299 (65%), Gaps = 4/299 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT  +HF  L+++SSS L  +I+ A ++K       ++       +AMIFEK STRTRVS
Sbjct: 1   MTTTRHFLRLTDLSSSELKTLIQRAIELKAMQRKGEQHALFPNATMAMIFEKASTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M   GG  +FLS ++ QLGR E I DTAKV+SR VD +++RT+ H RL    + + 
Sbjct: 61  FEAGMAQFGGHALFLSPNDTQLGRGEPIEDTAKVISRMVDIVMIRTSAHERLEVFAQNSR 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVINAL+D +HPCQ++AD+MT+ EHRG ++GK  SW GDGNN+ HS I  A  F + LN
Sbjct: 121 VPVINALSDESHPCQLLADMMTWFEHRGDMQGKTASWIGDGNNMCHSFIRAAHLFGFHLN 180

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HV 240
           IA P G +P    L+        V L  D   A +G+  + TD W SM QE +A+     
Sbjct: 181 IACPEGYDPDQALLD---EYAHCVTLTRDPANAARGSDLLATDVWASMGQEQEAKARMAA 237

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           F+ F++N  L+++A+PDA+++HCLPAHRGEE+  +++D P SV++DEAENRLH QKA++
Sbjct: 238 FEGFELNRELLNLANPDAIYLHCLPAHRGEEISADLMDDPSSVIWDEAENRLHAQKALI 296


>gi|229013340|ref|ZP_04170480.1| Ornithine carbamoyltransferase [Bacillus mycoides DSM 2048]
 gi|229134938|ref|ZP_04263745.1| Ornithine carbamoyltransferase [Bacillus cereus BDRD-ST196]
 gi|229168874|ref|ZP_04296592.1| Ornithine carbamoyltransferase [Bacillus cereus AH621]
 gi|228614604|gb|EEK71711.1| Ornithine carbamoyltransferase [Bacillus cereus AH621]
 gi|228648613|gb|EEL04641.1| Ornithine carbamoyltransferase [Bacillus cereus BDRD-ST196]
 gi|228747933|gb|EEL97798.1| Ornithine carbamoyltransferase [Bacillus mycoides DSM 2048]
          Length = 316

 Score =  287 bits (734), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 141/302 (46%), Positives = 195/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTQEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR ET+ DTAKVLS Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQIGRGETVSDTAKVLSHYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEEVHTFKGVKLAYVGDGNNVCHSLLLASAKVGMNMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A   GA + + H+   AV GA  ++TD W+SM QE +A +  +F
Sbjct: 188 VGYEPNEEIVKKALAIADETGAEIEILHNPELAVSGADFIYTDVWMSMGQEGEAEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QPFQVN  L+  A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPFQVNKELVIHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|228967167|ref|ZP_04128203.1| Ornithine carbamoyltransferase [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228792536|gb|EEM40102.1| Ornithine carbamoyltransferase [Bacillus thuringiensis serovar
           sotto str. T04001]
          Length = 316

 Score =  287 bits (734), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 139/302 (46%), Positives = 195/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTKEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR ET+ DTAKVLS+Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQMGRGETVSDTAKVLSQYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEETNTFKGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           IG EP  E     L  A+  GA + + HD   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 IGYEPNEEIVKKALAIAKETGAEIEVLHDPELAVNEADFIYTDVWMSMGQEGEEEKYSLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINNELVKHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|327398291|ref|YP_004339160.1| Ornithine carbamoyltransferase [Hippea maritima DSM 10411]
 gi|327180920|gb|AEA33101.1| Ornithine carbamoyltransferase [Hippea maritima DSM 10411]
          Length = 309

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 142/305 (46%), Positives = 204/305 (66%), Gaps = 6/305 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +H   L +++   +  +++++++IKN  ++  + KPLSG +L MIFEKPSTRTR+SFE  
Sbjct: 3   RHCLSLKDLTKQEILELLDLSQQIKNKIKSKQDYKPLSGVILGMIFEKPSTRTRLSFEAG 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           MK LGGD IFLS  ++QLGR ETI DTA+V+SRYVD +++RT  HSR+    +Y+TVPVI
Sbjct: 63  MKRLGGDAIFLSPRDIQLGRGETIEDTARVISRYVDIVMIRTFEHSRIERFAQYSTVPVI 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD  HPCQ++AD++T +E  G ++    ++ GDGNN+ +S I  AA   + L +ATP
Sbjct: 123 NALTDLLHPCQVLADLLTIKEKLGRIEDIKVAFFGDGNNMANSWIYAAAVLGFELRVATP 182

Query: 186 IGSEPR----NEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH-V 240
           +   P      E L  A   GA + L ++  +A K A  ++TD W SM QE +  ++H +
Sbjct: 183 VDFAPNGVVVKEALELATKSGARIILTNNPEEAAKDADVLYTDVWASMGQEDQKEKKHAL 242

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQ-SVVFDEAENRLHTQKAIL 299
            +P+QVN  L+  A+ D +FMHCLPAHRGEEV  EV+D  + SV+FDEAENR + Q A +
Sbjct: 243 MRPYQVNRELVKYANKDYIFMHCLPAHRGEEVEAEVIDDEKHSVIFDEAENRTYAQLATI 302

Query: 300 LWCFG 304
           +   G
Sbjct: 303 MNLIG 307


>gi|304313809|ref|YP_003848956.1| ornithine carbamoyltransferase [Methanothermobacter marburgensis
           str. Marburg]
 gi|302587268|gb|ADL57643.1| ornithine carbamoyltransferase [Methanothermobacter marburgensis
           str. Marburg]
          Length = 299

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 145/299 (48%), Positives = 189/299 (63%), Gaps = 9/299 (3%)

Query: 11  LSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLG 70
           LS     ++  ++++A   K         K L GK LAMIFEK STRTRVSFEV    LG
Sbjct: 5   LSVCDMDDVVALLDLADDYKAGE---IPGKVLEGKTLAMIFEKSSTRTRVSFEVGASQLG 61

Query: 71  GDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTD 130
              ++LS S++QLGR E I DTA+ LSRYVD I++R   HS ++EL   ++VPVIN LTD
Sbjct: 62  AQPLYLSASDLQLGRGEPIADTARTLSRYVDGIMIRAIRHSDVVELASESSVPVINGLTD 121

Query: 131 NTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEP 190
             HPCQ +AD+ T  E  G   G+L  + GDGNN+ +SL+   A     +++A P G EP
Sbjct: 122 LEHPCQALADMQTVREKLGDFSGRLV-FVGDGNNVCNSLLLITAMLGMDMDVACPPGYEP 180

Query: 191 RNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQPFQ 245
             E        AR  G+ + + HD  +AV GA  V+TD W+SM  E +  E   VF+P+Q
Sbjct: 181 DTEITGMAEKIARKSGSEIRVLHDPREAVDGADVVYTDVWVSMGYEEETEERLKVFRPYQ 240

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           VN  LM +A PDA+FMHCLPA RG+E  +EV+DGPQSVV+D+AENRLH QKAI+ W  G
Sbjct: 241 VNSELMKLASPDAIFMHCLPAVRGQETTSEVIDGPQSVVWDQAENRLHAQKAIMHWLMG 299


>gi|94987555|ref|YP_595488.1| ornithine carbamoyltransferase [Lawsonia intracellularis
           PHE/MN1-00]
 gi|94731804|emb|CAJ55167.1| Ornithine carbamoyltransferase [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 300

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 137/298 (45%), Positives = 204/298 (68%), Gaps = 3/298 (1%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAM 66
           HF  ++++  S    ++  AK++K+   N ++   + GKV A++FEK STRTRVSFEVA+
Sbjct: 4   HFITIADLGQSKAWELLLRAKEMKDHKTNPYQ--CMQGKVAALLFEKASTRTRVSFEVAV 61

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
           + LGG TIFL+ +E Q+GR E + DT +VLSRYVD I++RT    RL EL +  ++P+IN
Sbjct: 62  RQLGGTTIFLTPNETQIGREEPLKDTIRVLSRYVDCIIIRTFEQKRLYELIQLGSIPIIN 121

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI 186
           ALTD+ HPCQ++AD++T  E    +     +W GDGNN+L+S IE +  F + L IATP 
Sbjct: 122 ALTDHGHPCQVMADLLTIYEQTSDIANINITWVGDGNNVLNSWIEASMYFPFKLTIATPK 181

Query: 187 GSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQPFQ 245
           G EP  E +++A+   A +++ ++ + AVK AH ++TD W SM QE + ++    F+ F 
Sbjct: 182 GYEPNKELIDFAQKNNAKISITNNPLLAVKDAHYIYTDVWTSMGQEKECKKRIEDFKDFC 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           V+ +LM+ A P   F+HCLPAHRGEEV ++V++  +S+V+D+AENRLH QKA+L W F
Sbjct: 242 VDNTLMNQATPSVKFLHCLPAHRGEEVSDQVIESEKSLVWDQAENRLHMQKALLEWIF 299


>gi|52141366|ref|YP_085463.1| ornithine carbamoyltransferase [Bacillus cereus E33L]
 gi|56404342|sp|Q635F4|OTC_BACCZ RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|51974835|gb|AAU16385.1| ornithine carbamoyltransferase, catabolic [Bacillus cereus E33L]
          Length = 316

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 139/302 (46%), Positives = 196/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +KN+ +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTQEEIISLIEFAIYLKNNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR ET+ DTAKVLS+Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQMGRGETVSDTAKVLSQYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEEVNTFKGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           IG EP  E     L  A+  GA + + H+   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 IGYEPNEEIVKKALAIAKETGAEIEILHNPELAVNEADFIYTDVWMSMGQEGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINKELVKHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|116754282|ref|YP_843400.1| ornithine carbamoyltransferase [Methanosaeta thermophila PT]
 gi|116665733|gb|ABK14760.1| ornithine carbamoyltransferase [Methanosaeta thermophila PT]
          Length = 312

 Score =  286 bits (733), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 142/305 (46%), Positives = 198/305 (64%), Gaps = 6/305 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSEN----IFENK-PLSGKVLAMIFEKPSTRTRV 60
           +    ++++S   +  +++ A+ +K          F ++ PL+GK +AMIFEKPSTRTRV
Sbjct: 4   RSLISIADLSPEEIVALLDRAEDLKAERSGRGGCAFGDRLPLAGKSVAMIFEKPSTRTRV 63

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           S EVA   LGG  ++LS +E+QLGR ETIGDTA+VLSRYV  I  R  +H  + EL  ++
Sbjct: 64  SLEVAATELGGHPLYLSANELQLGRGETIGDTARVLSRYVHGITARVFSHRTVEELAAHS 123

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +VPVINAL+D  HP QI+AD+MT  EH G ++G   +W GDGNN+ +SLI  +A  N  +
Sbjct: 124 SVPVINALSDQEHPLQILADMMTIREHFGYLEGLRIAWIGDGNNVCNSLILASAMLNMRM 183

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-H 239
            +A+P G EP+ + L  AR  G    +  +  +A   A  + TDTWISM  E +  E   
Sbjct: 184 IVASPRGYEPKGQILERARELGGVPEITAEPSEAAHDADVLVTDTWISMGDEAEEAERLR 243

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  +Q+N  ++ +A  DA+ MHCLPAHRG+E+ +EV+DGPQSVV +EAENRLHT KA+L
Sbjct: 244 SFSGYQINQRILEIAGRDAIVMHCLPAHRGQEITDEVMDGPQSVVLEEAENRLHTSKAVL 303

Query: 300 LWCFG 304
            W  G
Sbjct: 304 EWMVG 308


>gi|206971122|ref|ZP_03232073.1| ornithine carbamoyltransferase [Bacillus cereus AH1134]
 gi|229192342|ref|ZP_04319306.1| Ornithine carbamoyltransferase [Bacillus cereus ATCC 10876]
 gi|206733894|gb|EDZ51065.1| ornithine carbamoyltransferase [Bacillus cereus AH1134]
 gi|228591122|gb|EEK48977.1| Ornithine carbamoyltransferase [Bacillus cereus ATCC 10876]
          Length = 316

 Score =  286 bits (733), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 137/302 (45%), Positives = 196/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + + +     L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTKEEIISLIEFAIYLKKNKQELL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR E++ DTAKVLS+Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQMGRGESVSDTAKVLSQYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEETNTFKGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A+  GA + + HD   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 VGYEPNEEIVKKALAIAKETGAEIEVLHDPELAVNEADFIYTDVWMSMGQEGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINNELVKHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|312793755|ref|YP_004026678.1| ornithine carbamoyltransferase [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312180895|gb|ADQ41065.1| ornithine carbamoyltransferase [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 308

 Score =  286 bits (732), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 141/308 (45%), Positives = 208/308 (67%), Gaps = 8/308 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L+++S  ++  ++E+A ++K  ++  F    L  K L +IF K STRTRVSFEV 
Sbjct: 2   RHFLHLNDLSKEDILYLVELASRLKKEAKRGFYFPYLKNKALGLIFTKASTRTRVSFEVG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG +++L  +++QLGR ETI DTAKVLSRY+D IV+RT     + E  +Y+++PVI
Sbjct: 62  IHQLGGYSLYLGKNDLQLGRGETIEDTAKVLSRYLDLIVIRTYEQKEVEEFAKYSSIPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HP QIIAD  T  E +G +     ++ GDGNN+  +L+ GAA+    + +ATP
Sbjct: 122 NGLTDDYHPTQIIADFQTIFEEKGRLSSLKIAYVGDGNNVAATLLVGAAKLGLDIAVATP 181

Query: 186 IGSEPRNEYLNWARNQG----ASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV- 240
            G E + E +++A ++     ++V   +   +AVK A  V+TDTW+SM QE + +E+ + 
Sbjct: 182 PGYEIKKEVVDFALDEAKKSKSNVIFTYSPKEAVKDADVVYTDTWVSMGQE-EEKEKRIR 240

Query: 241 -FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ +QV+ SLM +A  DA+F+HCLPA+RG EV +EV+DGPQS VFDEAENRLH  KAI+
Sbjct: 241 DFERYQVDTSLMRLAKDDAIFLHCLPAYRGFEVTSEVIDGPQSRVFDEAENRLHAHKAIM 300

Query: 300 LW-CFGII 306
           ++ C G I
Sbjct: 301 IFVCLGKI 308


>gi|262279368|ref|ZP_06057153.1| ornithine carbamoyltransferase [Acinetobacter calcoaceticus
           RUH2202]
 gi|262259719|gb|EEY78452.1| ornithine carbamoyltransferase [Acinetobacter calcoaceticus
           RUH2202]
          Length = 304

 Score =  286 bits (732), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 143/295 (48%), Positives = 190/295 (64%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++S+  L+ I+E A ++K    +    +P  GKVL MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLRDLSTLELNRILERASELKKMQHDNKVFQPFVGKVLGMIFEKSSTRTRISFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +   GG  IFLS  + QLGR E I D+A+V+S  +D +++RT  H  +     Y+ VPVI
Sbjct: 64  INQFGGSAIFLSPRDTQLGRGEPIEDSARVISSMLDIVMIRTFGHDIVERFASYSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ++AD+ T+ EHRGS+KGK  +W GDGNN+ +S IE A    + L IA+P
Sbjct: 124 NGLTDDHHPCQLLADLQTYNEHRGSIKGKTVAWIGDGNNMCNSYIEAAHMMGFKLKIASP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQPF 244
            G EP+ E+L      G  V +F +A  A   A  + TD W SM QE + +  E  F  F
Sbjct: 184 KGYEPKPEFL---AEFGHCVEVFDNAEDAAVNADLIVTDVWASMGQEEEQKLRERAFAAF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QVN  LM +AHPD LFMHCLPAHRGEE+   +LD   +VV+DEAENRLH QKA++
Sbjct: 241 QVNEKLMGLAHPDCLFMHCLPAHRGEEISETMLDHKNAVVWDEAENRLHAQKALM 295


>gi|75759254|ref|ZP_00739354.1| Ornithine carbamoyltransferase [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|218899291|ref|YP_002447702.1| ornithine carbamoyltransferase [Bacillus cereus G9842]
 gi|228902640|ref|ZP_04066791.1| Ornithine carbamoyltransferase [Bacillus thuringiensis IBL 4222]
 gi|74493260|gb|EAO56376.1| Ornithine carbamoyltransferase [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|218541235|gb|ACK93629.1| ornithine carbamoyltransferase [Bacillus cereus G9842]
 gi|228857081|gb|EEN01590.1| Ornithine carbamoyltransferase [Bacillus thuringiensis IBL 4222]
          Length = 316

 Score =  286 bits (732), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 138/302 (45%), Positives = 195/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTKEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR ET+ DTAKVLS+Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQMGRGETVSDTAKVLSQYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEETNTFKGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A+  GA + + HD   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 VGYEPNEEIVKKALAIAKETGAEIEVLHDPELAVNEADFIYTDVWMSMGQEGEEEKYSLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINNELVKHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|312876846|ref|ZP_07736823.1| ornithine carbamoyltransferase [Caldicellulosiruptor lactoaceticus
           6A]
 gi|311796361|gb|EFR12713.1| ornithine carbamoyltransferase [Caldicellulosiruptor lactoaceticus
           6A]
          Length = 308

 Score =  286 bits (732), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 141/308 (45%), Positives = 207/308 (67%), Gaps = 8/308 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L+++S  ++  ++E+A ++K  ++  F    L  K L +IF K STRTRVSFEV 
Sbjct: 2   RHFLHLNDLSKEDILYLVELASRLKKEAKRGFYFPYLKNKALGLIFTKASTRTRVSFEVG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG +++L  +++QLGR ETI DTAKVLSRY+D IV+RT     + E  +Y+++PVI
Sbjct: 62  IHQLGGYSLYLGKNDLQLGRGETIEDTAKVLSRYLDLIVIRTYEQKEVEEFAKYSSIPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HP QIIAD  T  E +G +     ++ GDGNN+  +L+ GAA+    + +ATP
Sbjct: 122 NGLTDDYHPTQIIADFQTIFEEKGRLSSLKIAYVGDGNNVAATLLVGAAKLGLDIAVATP 181

Query: 186 IGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV- 240
            G E + E +++    A+   ++V   +   +AVK A  V+TDTW+SM QE + +E+ + 
Sbjct: 182 PGYEIKKEVVDFALEEAKKSKSNVIFTYSPKEAVKDADVVYTDTWVSMGQE-EEKEKRIR 240

Query: 241 -FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ +QV+ SLM +A  DA+F+HCLPA+RG EV +EV+DGPQS VFDEAENRLH  KAI+
Sbjct: 241 DFERYQVDTSLMRLAKDDAIFLHCLPAYRGFEVTSEVIDGPQSRVFDEAENRLHAHKAIM 300

Query: 300 LW-CFGII 306
           ++ C G I
Sbjct: 301 IFVCLGKI 308


>gi|228922879|ref|ZP_04086177.1| Ornithine carbamoyltransferase [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228836934|gb|EEM82277.1| Ornithine carbamoyltransferase [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 316

 Score =  286 bits (732), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 138/302 (45%), Positives = 195/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTQEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR ET+ DTAKVLS+Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQMGRGETVSDTAKVLSQYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEETNTFKGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A+  GA + + HD   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 VGYEPNEEIVKKALAIAKETGAEIEVLHDPELAVNEADFIYTDVWMSMGQEGEKEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINDELVKHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|229577095|ref|YP_001085009.2| ornithine carbamoyltransferase [Acinetobacter baumannii ATCC 17978]
 gi|239501616|ref|ZP_04660926.1| ornithine carbamoyltransferase [Acinetobacter baumannii AB900]
 gi|260554738|ref|ZP_05826959.1| ornithine carbamoyltransferase [Acinetobacter baumannii ATCC 19606]
 gi|226739231|sp|A3M663|OTC_ACIBT RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|193077572|gb|ABO12407.2| ornithine carbamoyltransferase [Acinetobacter baumannii ATCC 17978]
 gi|260411280|gb|EEX04577.1| ornithine carbamoyltransferase [Acinetobacter baumannii ATCC 19606]
          Length = 306

 Score =  286 bits (732), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 143/295 (48%), Positives = 191/295 (64%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++S+  L+ I+E A ++K   ++    +P  GKVL MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLRDLSTLELNRILERASELKKMQQSNKVYQPFVGKVLGMIFEKSSTRTRISFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +   GG  IFLS  + QLGR E I D+A+V+S  +D +++RT  H  +     Y+ VPVI
Sbjct: 64  INQFGGSAIFLSPRDTQLGRGEPIEDSARVISSMLDIVMIRTFGHDIVERFASYSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ++AD+ T+ EHRGS++GK  +W GDGNN+ +S IE A    + L IA+P
Sbjct: 124 NGLTDDHHPCQLLADLQTYIEHRGSIEGKTVAWIGDGNNMCNSYIEAAHMMGFKLKIASP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQPF 244
            G EP+ E+L      G  V LF +A  A   A  + TD W SM QE + +  E  F  F
Sbjct: 184 KGYEPKPEFL---AEFGHCVELFDNAEDAAVNADLIVTDVWASMGQEEEQKLREKAFADF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QVN  LM +AHPD LFMHCLPAHRGEE+   +LD   +VV+DEAENRLH QKA++
Sbjct: 241 QVNEKLMGLAHPDCLFMHCLPAHRGEEISETMLDHKNAVVWDEAENRLHAQKALM 295


>gi|116747513|ref|YP_844200.1| ornithine carbamoyltransferase [Syntrophobacter fumaroxidans MPOB]
 gi|116696577|gb|ABK15765.1| ornithine carbamoyltransferase [Syntrophobacter fumaroxidans MPOB]
          Length = 312

 Score =  286 bits (732), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 137/300 (45%), Positives = 192/300 (64%), Gaps = 2/300 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +    + ++S+  +  +I  A+ +K         + L  KV+A+IF KPSTRTRVSFE A
Sbjct: 3   RDLLSIRDLSADEIVALISRAETMKRELAEGNLRQSLRNKVVALIFVKPSTRTRVSFEAA 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG +IF+S  + Q+ R E + DTA+VL+RYVDAIV+RT     + EL  YA++PVI
Sbjct: 63  IYRLGGHSIFMSARDTQISRQEPLADTARVLARYVDAIVIRTFAQEDVTELARYASIPVI 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD THPCQ++ D++T +E RG+++G   +W GDGNN+ HS I  AAR  + +++A P
Sbjct: 123 NGLTDRTHPCQVLGDLLTIKEKRGTLEGLHVAWIGDGNNVAHSWINAAARLGFTVSLACP 182

Query: 186 IGSEPRNEYLNWARNQG-ASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH-VFQP 243
               P  E L+WA  QG   V +     +AV  A  ++TD W SM QE +A     +F+P
Sbjct: 183 SQYLPDREILDWADTQGKGKVIMAASPKEAVASADAIYTDVWASMGQEEEADARRSIFRP 242

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           FQVN  L+S A   A+ +HCLPAHRGEE+ N V++GP S +FD+AENRLH Q A+L W  
Sbjct: 243 FQVNEELLSAAPAHAIVLHCLPAHRGEEITNAVMEGPHSAIFDQAENRLHIQMALLDWLL 302


>gi|332978218|gb|EGK14949.1| ornithine carbamoyltransferase [Psychrobacter sp. 1501(2011)]
          Length = 306

 Score =  286 bits (732), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 139/298 (46%), Positives = 194/298 (65%), Gaps = 10/298 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++S + L  +I+ A +++         +P  G+ L MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLLDLSPTELDALIKRASELRKMQHAGEVYQPFVGRTLGMIFEKSSTRTRISFETG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M   GG  IFLS  + QLGR E I D+A+V+S  VD I++RT  H ++ +  EY++VP+I
Sbjct: 64  MGQFGGHAIFLSPKDTQLGRGEPIEDSARVISSMVDIIMIRTFEHEKVEKFAEYSSVPII 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+ HPCQ++AD+ TF EHRGS+K K+ +W GDGNN+  S +  A +F + L +A P
Sbjct: 124 NALTDDFHPCQLLADMQTFYEHRGSIKDKIVTWVGDGNNMCSSFMMAAHQFGFELRVAAP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQE----FKAREEHVF 241
            G EP  + +   ++    V+L  D   A K AH + TD W SM QE     +AR    F
Sbjct: 184 YGFEPNPDLMEKFKH---CVSLVEDVQDAAKDAHLIVTDVWASMGQESEQNTRARR---F 237

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            P+QV  S++  A P+ LFMHCLPAHRGEE+ +++LD P+SVV+DEAENRLH QKA++
Sbjct: 238 APYQVTPSMLDKADPEVLFMHCLPAHRGEEISHDLLDDPRSVVWDEAENRLHAQKALM 295


>gi|148652590|ref|YP_001279683.1| ornithine carbamoyltransferase [Psychrobacter sp. PRwf-1]
 gi|189036337|sp|A5WDJ2|OTC_PSYWF RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|148571674|gb|ABQ93733.1| ornithine carbamoyltransferase [Psychrobacter sp. PRwf-1]
          Length = 306

 Score =  286 bits (732), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 139/298 (46%), Positives = 194/298 (65%), Gaps = 10/298 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++S + L  +I+ A +++         +P  G+ L MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLLDLSPAELEALIKRASELRKMQHAGEVYQPFVGRTLGMIFEKSSTRTRISFETG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M   GG  IFLS  + QLGR E I D+A+V+S  VD I++RT  H ++ +  +Y++VP+I
Sbjct: 64  MGQFGGHAIFLSPKDTQLGRGEPIEDSARVISSMVDIIMIRTFEHEKVEKFAQYSSVPII 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+ HPCQ++AD+ TF EHRGS+K K+ +W GDGNN+  S +  A +F + L +A P
Sbjct: 124 NALTDDFHPCQLLADMQTFYEHRGSIKDKIVTWVGDGNNMCSSFMAAANQFGFELRVAAP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQE----FKAREEHVF 241
            G EP  E +   ++    V+L  D   A K AH + TD W SM QE     +AR    F
Sbjct: 184 YGFEPNPELMEKFKH---CVSLVDDVQDAAKDAHLIVTDVWASMGQESEQNTRARR---F 237

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            P+QV  S++  A P+ LFMHCLPAHRGEE+ +++LD P+SVV+DEAENRLH QKA++
Sbjct: 238 APYQVTPSMLDKADPEVLFMHCLPAHRGEEISHDMLDDPRSVVWDEAENRLHAQKALM 295


>gi|317152964|ref|YP_004121012.1| ornithine carbamoyltransferase [Desulfovibrio aespoeensis Aspo-2]
 gi|316943215|gb|ADU62266.1| ornithine carbamoyltransferase [Desulfovibrio aespoeensis Aspo-2]
          Length = 300

 Score =  286 bits (732), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 141/300 (47%), Positives = 192/300 (64%), Gaps = 4/300 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           PK+F  + ++       ++  AK++K+          L+GK L +IFEK STRTRVSFEV
Sbjct: 2   PKNFLTILDMPRDEARQVLLRAKEMKDGK---VRTDLLAGKTLLLIFEKASTRTRVSFEV 58

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            ++ LGGD +F++  + QLGR+E + DTA+VLSRY D +++RT    +L  L +Y T+PV
Sbjct: 59  GVRQLGGDPVFITSRDSQLGRSEPLKDTARVLSRYADGLIVRTFGQEKLETLVKYGTIPV 118

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALTD  HPCQI++D++T  E   S+     +W GDGNN+ HS I  AA F + L++A 
Sbjct: 119 INALTDEYHPCQIMSDVLTMYERTPSLDEIKVAWIGDGNNMAHSFINAAATFGFALSLAC 178

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQ-EFKAREEHVFQP 243
           P G  P    L+ AR+ GA + L  D  +AV GAH V TD W SM Q E + + E  F  
Sbjct: 179 PAGYLPDQGILDKARSLGADITLTDDPARAVAGAHYVNTDVWASMGQEEEQKKREAAFAG 238

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           + V+  LM+ A P A FMHCLPAHRGEEV   V +GP S+V+D+AENRLH QKAI+ W +
Sbjct: 239 YAVDDVLMAKAAPGACFMHCLPAHRGEEVSEAVFEGPASIVWDQAENRLHMQKAIIEWIY 298


>gi|229157714|ref|ZP_04285789.1| Ornithine carbamoyltransferase [Bacillus cereus ATCC 4342]
 gi|228625671|gb|EEK82423.1| Ornithine carbamoyltransferase [Bacillus cereus ATCC 4342]
          Length = 316

 Score =  286 bits (732), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 137/302 (45%), Positives = 196/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +KN+ +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTKEEIISLIEFAIYLKNNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR ET+ DTAKVLS+Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQMGRGETVSDTAKVLSQYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E + + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEEKNTFKGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPR----NEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP      + L  A   GA + + H+   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 VGYEPNEGIVKKALTIAEQTGAEIEILHNPELAVSEADFIYTDVWMSMGQEGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINNELVKHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|288931109|ref|YP_003435169.1| ornithine carbamoyltransferase [Ferroglobus placidus DSM 10642]
 gi|288893357|gb|ADC64894.1| ornithine carbamoyltransferase [Ferroglobus placidus DSM 10642]
          Length = 305

 Score =  286 bits (731), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 137/300 (45%), Positives = 195/300 (65%), Gaps = 2/300 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH   ++++    +  I+++A K+K         + L  K L MIFE PSTRTRVSFEVA
Sbjct: 2   KHVLSITDLKKEEIIEILDLADKLKEERRKGILKEYLKNKTLGMIFELPSTRTRVSFEVA 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M   GG  I+++ +++QLGR ETI DTA+ LSRYV A++MR   H  L+E  ++++VPVI
Sbjct: 62  MNDCGGYAIYMNWNDLQLGRGETIADTARTLSRYVHAVMMRVRRHETLVEFAKFSSVPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L++  HPCQI+AD+ T  E +GS+  K+ +W GDGNN+ +SL+  +A   + + +A P
Sbjct: 122 NGLSNLEHPCQILADLQTIREKKGSLNVKV-AWVGDGNNVCNSLLLASAIIGFEMKLAIP 180

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQ-EFKAREEHVFQPF 244
            G +P +E L  A   G    +  D  +AV+GA  ++TD W SM Q E + R   +F+P+
Sbjct: 181 EGFDPPDEILKKAEELGGRFEILRDPKEAVRGADVIYTDVWASMGQEEERERRLKIFRPY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QVN+ L+  A  D + MHCLPAHRGEE+ +EV+D   SVVFD+AENRLH QKA+LL   G
Sbjct: 241 QVNMELVGEAKEDVIVMHCLPAHRGEEITDEVIDSEYSVVFDQAENRLHAQKALLLKLIG 300


>gi|312622239|ref|YP_004023852.1| ornithine carbamoyltransferase [Caldicellulosiruptor kronotskyensis
           2002]
 gi|312202706|gb|ADQ46033.1| ornithine carbamoyltransferase [Caldicellulosiruptor kronotskyensis
           2002]
          Length = 308

 Score =  286 bits (731), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 141/308 (45%), Positives = 208/308 (67%), Gaps = 8/308 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L+++S  ++  ++E+A K+K  ++  F    L  K L +IF K STRTRVSFEV 
Sbjct: 2   RHFLHLNDLSKEDILYLVELASKLKKEAKRGFYFPYLKNKALGLIFTKASTRTRVSFEVG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG +++L  +++QLGR ETI DTAKVLSRY+D IV+RT     + E  +Y+++PVI
Sbjct: 62  IHQLGGYSLYLGKNDLQLGRGETIEDTAKVLSRYLDLIVIRTYEQKEVEEFAKYSSIPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HP QIIAD  T  E +G +     ++ GDGNN+  +L+ GAA+    + +ATP
Sbjct: 122 NGLTDDYHPTQIIADFQTIFEEKGRLSNLKIAYVGDGNNVAATLLVGAAKLGLDIAVATP 181

Query: 186 IGSEPRNEYLNWARNQG----ASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV- 240
            G E + E +++A ++     +++   +   +AVK A  V+TDTW+SM QE + +E+ + 
Sbjct: 182 PGYEIKKEVVDFALDEAKKSKSNIIFTYSPKEAVKDADVVYTDTWVSMGQE-EEKEKRIR 240

Query: 241 -FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ +QV+ SLM +A  DA+F+HCLPA+RG EV +EV+DGPQS VFDEAENRLH  KAI+
Sbjct: 241 DFEGYQVDSSLMKLAKDDAIFLHCLPAYRGFEVTSEVIDGPQSRVFDEAENRLHAHKAIM 300

Query: 300 LW-CFGII 306
           ++ C G I
Sbjct: 301 IFVCVGKI 308


>gi|325122528|gb|ADY82051.1| ornithine carbamoyltransferase [Acinetobacter calcoaceticus PHEA-2]
          Length = 306

 Score =  286 bits (731), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 143/295 (48%), Positives = 191/295 (64%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++S+  L+ I+E A ++K    +    +P  GKVL MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLRDLSTLELNRILERASELKKMQHDNKVYQPFVGKVLGMIFEKSSTRTRISFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +   GG  IFLS  + QLGR E I D+A+V+S  +D +++RT  H  +     Y+ VPVI
Sbjct: 64  INQFGGSAIFLSPRDTQLGRGEPIEDSARVISSMLDIVMIRTFGHDIVERFASYSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ++AD+ T+ EHRGS++GK  +W GDGNN+ +S IE A    + L IA+P
Sbjct: 124 NGLTDDHHPCQLLADLQTYIEHRGSIEGKTVAWIGDGNNMCNSYIEAAHMMGFKLKIASP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQPF 244
            G EP+ E+L      G  V L+ +A  A   A  + TD W SM QE + +  E  F  F
Sbjct: 184 KGYEPKPEFL---AEFGHCVELYDNAEDAAVNADLIVTDVWASMGQEEEQKLREKAFADF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QVN  LMS+AHPD LFMHCLPAHRGEE+   +LD   +VV+DEAENRLH QKA++
Sbjct: 241 QVNEKLMSLAHPDCLFMHCLPAHRGEEISETMLDYKNAVVWDEAENRLHAQKALV 295


>gi|152997392|ref|YP_001342227.1| ornithine carbamoyltransferase [Marinomonas sp. MWYL1]
 gi|150838316|gb|ABR72292.1| ornithine carbamoyltransferase [Marinomonas sp. MWYL1]
          Length = 301

 Score =  286 bits (731), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 144/301 (47%), Positives = 196/301 (65%), Gaps = 6/301 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           P+HF  L ++SS  L  ++  A ++K         +PL  +VLAMIFEK STRTRVSFE 
Sbjct: 3   PRHFLTLKDLSSDELKQLLLRASELKKIHHEGTLFQPLKNRVLAMIFEKSSTRTRVSFEA 62

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M   GG  +FLS  + QLGR E + D+A+V+S  VDA+++RT +H  +    +Y++VPV
Sbjct: 63  GMAQFGGHALFLSSRDTQLGRGEPVEDSARVISSMVDAVMIRTFDHKTVETFAKYSSVPV 122

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALTD+ HPCQ++AD+ T++EHRGS++GK   W GDGNN+ +S I  AA  ++ L +A 
Sbjct: 123 INALTDDYHPCQLLADMQTYQEHRGSIEGKKVVWVGDGNNMCNSYINAAAMLDFQLVVAC 182

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQP 243
           P+G EP  + +         V + H+A +A  GA  + TD + SM QE +  +    F  
Sbjct: 183 PVGYEPNADLV---AEHADRVTVLHNAHEAATGADLIVTDVFASMGQEDEQEQRLKDFDG 239

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL--LW 301
           FQVN  LM+ A+ DALFMHCLPAHRGEEV  +V+D P  VV+DEAENRLH QKA+L  L 
Sbjct: 240 FQVNAELMAKANNDALFMHCLPAHRGEEVSADVIDHPDCVVWDEAENRLHAQKALLEFLL 299

Query: 302 C 302
           C
Sbjct: 300 C 300


>gi|169795676|ref|YP_001713469.1| ornithine carbamoyltransferase [Acinetobacter baumannii AYE]
 gi|213158379|ref|YP_002319677.1| ornithine carbamoyltransferase [Acinetobacter baumannii AB0057]
 gi|215483162|ref|YP_002325369.1| ornithine carbamoyltransferase [Acinetobacter baumannii AB307-0294]
 gi|301346288|ref|ZP_07227029.1| ornithine carbamoyltransferase [Acinetobacter baumannii AB056]
 gi|301512085|ref|ZP_07237322.1| ornithine carbamoyltransferase [Acinetobacter baumannii AB058]
 gi|301595685|ref|ZP_07240693.1| ornithine carbamoyltransferase [Acinetobacter baumannii AB059]
 gi|332852494|ref|ZP_08434233.1| ornithine carbamoyltransferase [Acinetobacter baumannii 6013150]
 gi|332871303|ref|ZP_08439852.1| ornithine carbamoyltransferase [Acinetobacter baumannii 6013113]
 gi|226739190|sp|B0V6G5|OTC_ACIBY RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|169148603|emb|CAM86469.1| ornithine carbamoyltransferase [Acinetobacter baumannii AYE]
 gi|213057539|gb|ACJ42441.1| ornithine carbamoyltransferase [Acinetobacter baumannii AB0057]
 gi|213989035|gb|ACJ59334.1| ornithine carbamoyltransferase [Acinetobacter baumannii AB307-0294]
 gi|332729196|gb|EGJ60539.1| ornithine carbamoyltransferase [Acinetobacter baumannii 6013150]
 gi|332731587|gb|EGJ62873.1| ornithine carbamoyltransferase [Acinetobacter baumannii 6013113]
          Length = 306

 Score =  286 bits (731), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 143/295 (48%), Positives = 191/295 (64%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++S+  L+ I+E A ++K   ++    +P  GKVL MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLRDLSTLELNRILERASELKKMQQSNKVYQPFVGKVLGMIFEKSSTRTRISFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +   GG  IFLS  + QLGR E I D+A+V+S  +D +++RT  H  +     Y+ VPVI
Sbjct: 64  INQFGGSAIFLSPRDTQLGRGEPIEDSARVISSMLDIVMIRTFGHDIVERFASYSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ++AD+ T+ EHRGS++GK  +W GDGNN+ +S IE A    + L IA+P
Sbjct: 124 NGLTDDHHPCQLLADLQTYIEHRGSIEGKTVAWIGDGNNMCNSYIEAAHMMGFKLKIASP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQPF 244
            G EP+ E+L      G  V LF +A  A   A  + TD W SM QE + +  E  F  F
Sbjct: 184 KGYEPKPEFL---AEFGHCVELFDNAEDAAVNADLIVTDVWASMGQEEEQKLREKAFANF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QVN  LM +AHPD LFMHCLPAHRGEE+   +LD   +VV+DEAENRLH QKA++
Sbjct: 241 QVNEKLMGLAHPDCLFMHCLPAHRGEEISETMLDHKNAVVWDEAENRLHAQKALM 295


>gi|172056612|ref|YP_001813072.1| ornithine carbamoyltransferase [Exiguobacterium sibiricum 255-15]
 gi|171989133|gb|ACB60055.1| ornithine carbamoyltransferase [Exiguobacterium sibiricum 255-15]
          Length = 312

 Score =  286 bits (731), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 135/306 (44%), Positives = 201/306 (65%), Gaps = 7/306 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH   L  +++  L+ ++E+AK +K S     +   L+GK +A++FEK STRTR+SFEV 
Sbjct: 8   KHLLTLEELTAEGLTDLLELAKDVKASPATYAQT--LAGKKVALLFEKASTRTRISFEVG 65

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  + L+GS+MQ+GR E++ DT +V+SRYVDA+++RT  H  +  L  + T+P+I
Sbjct: 66  VVELGGYPVVLNGSDMQIGRGESLSDTIQVMSRYVDALMIRTFAHETVETLAAHGTIPII 125

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ++AD++T EEH G  KGK+ ++ GDGNN+ HSL+ G A     + I +P
Sbjct: 126 NGLTDLHHPCQVLADLLTIEEHFGQRKGKILAYIGDGNNMTHSLLLGGALSGMTVRICSP 185

Query: 186 IGSEPRNEYLNWAR----NQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HV 240
               P    ++ A+      G  +  + D VQAV GA  +++D + SM QE ++      
Sbjct: 186 AAYAPDQTIIDQAKMLAQQSGGQIEQYTDPVQAVAGADVIYSDVFASMGQEEESEARLKA 245

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+ +QVN +L+S A  D +F+HCLPAHRGEEV  EV+DG  S+VFD+AENRLH QKA+++
Sbjct: 246 FEGYQVNQTLLSSAATDVIFLHCLPAHRGEEVTAEVIDGSHSLVFDQAENRLHAQKALMI 305

Query: 301 WCFGII 306
              G++
Sbjct: 306 ELIGVM 311


>gi|296504621|ref|YP_003666321.1| ornithine carbamoyltransferase [Bacillus thuringiensis BMB171]
 gi|296325673|gb|ADH08601.1| ornithine carbamoyltransferase [Bacillus thuringiensis BMB171]
          Length = 316

 Score =  285 bits (730), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 138/302 (45%), Positives = 194/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTKEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR ET+ DTAKVLS+Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQMGRGETVSDTAKVLSQYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEETNTFKGIKLAYVGDGNNVCHSLVLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A+  GA + + HD   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 VGYEPNEEIVKKALAIAKETGAEIEVLHDPELAVNEADFIYTDVWMSMGQEGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L   A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINNELAKHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|226954092|ref|ZP_03824556.1| ornithine carbamoyltransferase [Acinetobacter sp. ATCC 27244]
 gi|226835133|gb|EEH67516.1| ornithine carbamoyltransferase [Acinetobacter sp. ATCC 27244]
          Length = 310

 Score =  285 bits (730), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 141/295 (47%), Positives = 192/295 (65%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++SS  L  I++ A+++K    +    +P +GKVL MIFEK STRTR+SFE  
Sbjct: 8   RHFLTLRDLSSLELQRILDRAQELKRMQHSNTLYQPFAGKVLGMIFEKSSTRTRISFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +   GG  IFLS  + QLGR E I D+A+V+S  +D +++RT  H  +     Y+ VPVI
Sbjct: 68  ICQFGGSAIFLSPRDTQLGRGEPIEDSARVISSMLDIVMIRTFGHDIVERFASYSKVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ++AD+ TF+EHRGS++GK  +W GDGNN+ +S +E A    + L IA+P
Sbjct: 128 NGLTDDHHPCQLLADLQTFQEHRGSIEGKTVAWIGDGNNMCNSYVEAAHMMGFKLKIASP 187

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQPF 244
            G EP+ E+L    +    V +F+ A  A   A  + TD W SM QE + +  E  F  F
Sbjct: 188 EGYEPKPEFLAEFAD---CVEVFNKAEDAAVNADLIVTDVWASMGQEEEQKLREKAFADF 244

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QVN  LM +AHPD LFMHCLPAHRGEE+   +LD   +VV+DEAENRLH QKA++
Sbjct: 245 QVNEQLMDLAHPDCLFMHCLPAHRGEEISENMLDHKNAVVWDEAENRLHAQKALM 299


>gi|229071635|ref|ZP_04204853.1| Ornithine carbamoyltransferase [Bacillus cereus F65185]
 gi|228711571|gb|EEL63528.1| Ornithine carbamoyltransferase [Bacillus cereus F65185]
          Length = 316

 Score =  285 bits (730), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 137/302 (45%), Positives = 196/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTKEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR E++ DTAKVLS+Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQMGRGESVSDTAKVLSQYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEETNTFKGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A+  GA + + HD+  AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 VGYEPNEEIVKKALAIAKETGAEIEVLHDSELAVNEADFIYTDVWMSMGQEGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINNELVKHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|228960397|ref|ZP_04122049.1| Ornithine carbamoyltransferase [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228799258|gb|EEM46223.1| Ornithine carbamoyltransferase [Bacillus thuringiensis serovar
           pakistani str. T13001]
          Length = 316

 Score =  285 bits (730), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 138/302 (45%), Positives = 194/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTKEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR ET+ DTAKVLS+Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQMGRGETVSDTAKVLSQYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEETNTFKGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A+  GA + + HD   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 VGYEPNEEIVKKALAIAKETGAEIEVLHDPELAVNEADFIYTDVWMSMGQEGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L   A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINNELAKHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|78484877|ref|YP_390802.1| ornithine carbamoyltransferase [Thiomicrospira crunogena XCL-2]
 gi|123555875|sp|Q31I95|OTC_THICR RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|78363163|gb|ABB41128.1| ornithine carbamoyltransferase [Thiomicrospira crunogena XCL-2]
          Length = 302

 Score =  285 bits (730), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 148/303 (48%), Positives = 196/303 (64%), Gaps = 10/303 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVA---KKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           KHF  L + S + L  ++  A   KKI+ S E IFE  PL  K LAMIFEK STRTR+SF
Sbjct: 4   KHFLTLQDFSPAELKQLMLRAIELKKIQKSGE-IFE--PLKNKTLAMIFEKSSTRTRISF 60

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E+ M  LGG  +FLS  + QLGR E I DTAKV+S   D I++RT  H  + ++ E++ V
Sbjct: 61  EIGMSQLGGHALFLSPRDTQLGRGEPIEDTAKVISSMADGIMIRTFGHEVVEKMAEHSQV 120

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVINALTD+ HPCQ++AD+ T+ EHRGS++GK   W GDGNN+ HS I  A ++ + L I
Sbjct: 121 PVINALTDDYHPCQLLADMQTYYEHRGSIEGKTVLWVGDGNNMCHSYINAAKQYGFKLRI 180

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EHVF 241
           + P   +P    +    NQ   V +  + + A +    + TD W SM QE + ++ E  F
Sbjct: 181 SAPEDYDPNPRIVE--ANQ-EYVEMIRNPMDAAENVDLIVTDVWASMGQEEEQKKREKAF 237

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           + +QVN ++M  A+PDALFMHCLPAHRGEEV  EV+D   SVV+DEAENRLH QKA+L +
Sbjct: 238 KDYQVNTAMMQQANPDALFMHCLPAHRGEEVSAEVMDAEDSVVWDEAENRLHAQKALLEY 297

Query: 302 CFG 304
              
Sbjct: 298 LMA 300


>gi|90022086|ref|YP_527913.1| ornithine carbamoyltransferase [Saccharophagus degradans 2-40]
 gi|89951686|gb|ABD81701.1| ornithine carbamoyltransferase [Saccharophagus degradans 2-40]
          Length = 303

 Score =  285 bits (729), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 153/305 (50%), Positives = 195/305 (63%), Gaps = 5/305 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT P+HF  L ++S+  L  +I+ A  +K   +    ++P   +VL MIFEK STRTRVS
Sbjct: 1   MTKPRHFLTLEDLSAKELEEVIQRAIDLKAQHKAGTTDEPFKNQVLGMIFEKSSTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  IFLS  + QLGR E I D+A+VLSR VD +++RT  HS +    EY+ 
Sbjct: 61  FEAGMAQLGGSAIFLSSRDTQLGRGEPIEDSARVLSRMVDIVMIRTFEHSIVERFAEYSR 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPV+NALTD+ HPCQ++ADI TF EHRGS KGK  +W GDGNN+ HS I  A   ++ L 
Sbjct: 121 VPVMNALTDDYHPCQLLADIQTFVEHRGSPKGKTVAWVGDGNNMCHSYINAAKLCDFKLQ 180

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREEHV 240
           IA P G +P  + +  A N    V +     +AVK A  V TD W SM QE  K +    
Sbjct: 181 IACPEGFDPAPQLI--AENSD-RVTVTRIPEEAVKNADWVATDVWASMGQEDEKKKRLAA 237

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQ-SVVFDEAENRLHTQKAIL 299
           F  ++VN  LMS A  DA+FMHCLPAHRGEEV  E+L+    SVV+DEAENRLH QKA++
Sbjct: 238 FAGYEVNHKLMSHAKKDAIFMHCLPAHRGEEVSAELLEDENISVVWDEAENRLHAQKALM 297

Query: 300 LWCFG 304
           L+  G
Sbjct: 298 LFLMG 302


>gi|294650301|ref|ZP_06727669.1| ornithine carbamoyltransferase [Acinetobacter haemolyticus ATCC
           19194]
 gi|292823831|gb|EFF82666.1| ornithine carbamoyltransferase [Acinetobacter haemolyticus ATCC
           19194]
          Length = 306

 Score =  285 bits (729), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 141/295 (47%), Positives = 192/295 (65%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++SS  L  I++ A+++K    +    +P +GKVL MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLRDLSSLELQRILDRAQELKRMQHSNTLYQPFAGKVLGMIFEKSSTRTRISFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +   GG  IFLS  + QLGR E I D+A+V+S  +D +++RT  H  +     Y+ VPVI
Sbjct: 64  ICQFGGSAIFLSPRDTQLGRGEPIEDSARVISSMLDIVMIRTFGHDIVERFASYSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ++AD+ TF+EHRGS++GK  +W GDGNN+ +S +E A    + L IA+P
Sbjct: 124 NGLTDDHHPCQLLADLQTFQEHRGSIEGKTVAWIGDGNNMCNSYVEAAHMMGFKLKIASP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQPF 244
            G EP+ E+L    +    V +F+ A  A   A  + TD W SM QE + +  E  F  F
Sbjct: 184 EGYEPKPEFLAEFAD---CVEVFNKAEDAAVNADLIVTDVWASMGQEEEQKLREKAFADF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QVN  LM +AHPD LFMHCLPAHRGEE+   +LD   +VV+DEAENRLH QKA++
Sbjct: 241 QVNEQLMDLAHPDCLFMHCLPAHRGEEISENMLDHKNAVVWDEAENRLHAQKALM 295


>gi|228935451|ref|ZP_04098269.1| Ornithine carbamoyltransferase [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228824203|gb|EEM70017.1| Ornithine carbamoyltransferase [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
          Length = 316

 Score =  285 bits (729), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 138/302 (45%), Positives = 194/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTKEEIISLIEFAIHLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR ET+ DTAKVLS+Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQMGRGETVSDTAKVLSQYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEETNTFKGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A   GA + + HD   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 VGYEPNEEIVKKALAIAEETGAEIEVLHDPELAVNEADFIYTDVWMSMGQEGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINNELVKHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|229061802|ref|ZP_04199135.1| Ornithine carbamoyltransferase [Bacillus cereus AH603]
 gi|228717548|gb|EEL69212.1| Ornithine carbamoyltransferase [Bacillus cereus AH603]
          Length = 316

 Score =  285 bits (729), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 141/302 (46%), Positives = 194/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTQEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR ET+ DTAKVLS Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQIGRGETVSDTAKVLSHYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEEVHTFKGIKLAYVGDGNNVCHSLLLASAKVGMNMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           IG EP  E     L  A   GA + + H+   AV GA  ++TD W+SM QE +  +  +F
Sbjct: 188 IGYEPNEEIVKKALAIADETGAEIEILHNPELAVSGADFIYTDVWMSMGQEGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QPFQVN  L+  A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPFQVNKELVINAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|319649994|ref|ZP_08004143.1| ornithine carbamoyltransferase [Bacillus sp. 2_A_57_CT2]
 gi|317398175|gb|EFV78864.1| ornithine carbamoyltransferase [Bacillus sp. 2_A_57_CT2]
          Length = 318

 Score =  285 bits (729), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 143/299 (47%), Positives = 193/299 (64%), Gaps = 5/299 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K F  L++ SS  +  ++E AK++K +     E   L GK+L MIFEK STRTRVSFE  
Sbjct: 16  KDFLTLADFSSEEIKGLLEKAKQLKEAHLQGAETPSLKGKILGMIFEKSSTRTRVSFEAG 75

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  ++L+  ++QLGR E+I DTAKVLS+YVDAI++RT +H+++ EL  +A +PVI
Sbjct: 76  MLQLGGHALYLNSQDLQLGRGESIADTAKVLSQYVDAIMIRTFSHAKIQELAHHADIPVI 135

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ +AD++T EE  G +KG+   + GDGNN+ HSL+  +A+    + IA P
Sbjct: 136 NGLTDLYHPCQALADLLTIEEKNGELKGQNLVYVGDGNNVAHSLMIASAKMGVNITIACP 195

Query: 186 IGSEPRNEYLN----WARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HV 240
           IG EP N  L     +A   G+ V +  +  +AV  A  ++TD W SM QE +  +    
Sbjct: 196 IGYEPDNFVLQQSQEFAEQSGSKVKITSNPEEAVANADAIYTDVWTSMGQEDENEQRLKD 255

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           F  +QVN  L+  A  D +F+HCLPAHRGEEV  EV+DG  S VF +A NRLH QKAIL
Sbjct: 256 FADYQVNEYLVQKAKKDYVFLHCLPAHRGEEVTAEVIDGNNSAVFQQAGNRLHVQKAIL 314


>gi|222529531|ref|YP_002573413.1| ornithine carbamoyltransferase [Caldicellulosiruptor bescii DSM
           6725]
 gi|222456378|gb|ACM60640.1| ornithine carbamoyltransferase [Caldicellulosiruptor bescii DSM
           6725]
          Length = 308

 Score =  285 bits (729), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 142/308 (46%), Positives = 207/308 (67%), Gaps = 8/308 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L+++S  ++  +IE+A K+K  ++  F    L  K L +IF K STRTRVSFEV 
Sbjct: 2   RHFLHLNDLSKEDILYLIELASKLKKEAKRGFYFPYLKNKALGLIFTKASTRTRVSFEVG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG +++L  +++QLGR ETI DTAKVLSRY+D IV+RT     +    +Y+++PVI
Sbjct: 62  IHQLGGYSLYLGKNDLQLGRGETIEDTAKVLSRYLDLIVIRTYEQKEVEAFAKYSSIPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HP QIIAD  T  E +G +     ++ GDGNN+  +L+ GAA+    + +ATP
Sbjct: 122 NGLTDDYHPTQIIADFQTIFEEKGRLSNLKIAYVGDGNNVAATLLVGAAKLGIDIAVATP 181

Query: 186 IGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV- 240
            G E + E +++    A+N  ++V   +   +AVK A  V+TDTW+SM QE + +E+ + 
Sbjct: 182 PGYEIKKEVVDFALDEAKNSKSNVIFTYSPKEAVKDADVVYTDTWVSMGQE-EEKEKRIR 240

Query: 241 -FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ +QV+ +LM +A  DA+F+HCLPA+RG EV +EV+DGPQS VFDEAENRLH  KAI+
Sbjct: 241 DFEGYQVDSTLMKLAKDDAIFLHCLPAYRGFEVTSEVIDGPQSRVFDEAENRLHAHKAIM 300

Query: 300 LW-CFGII 306
           ++ C G I
Sbjct: 301 IFVCVGKI 308


>gi|229152330|ref|ZP_04280523.1| Ornithine carbamoyltransferase [Bacillus cereus m1550]
 gi|228631292|gb|EEK87928.1| Ornithine carbamoyltransferase [Bacillus cereus m1550]
          Length = 316

 Score =  285 bits (729), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 137/302 (45%), Positives = 195/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTKEEIISLIEFAIYLKKTKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR ET+ DTAKVLS+Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQMGRGETVSDTAKVLSQYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEETNTFKGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A+  GA + + HD   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 VGYEPNEEIVKKALAIAKETGAEIEVLHDPELAVNEADFIYTDVWMSMGQEGEEEKYSLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  +++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINNELVKHAKQTYRFLHCLPAHREEEVTGKIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|299769696|ref|YP_003731722.1| ornithine carbamoyltransferase [Acinetobacter sp. DR1]
 gi|298699784|gb|ADI90349.1| ornithine carbamoyltransferase [Acinetobacter sp. DR1]
          Length = 305

 Score =  285 bits (728), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 142/295 (48%), Positives = 190/295 (64%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++S+  L+ I+E A ++K    +    +P  GKVL MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLRDLSTLELNRILERASELKKMQHDNKVYQPFVGKVLGMIFEKSSTRTRISFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +   GG  IFLS  + QLGR E I D+A+V+S  +D +++RT  H  +     Y+ VPVI
Sbjct: 64  INQFGGSAIFLSPRDTQLGRGEPIEDSARVISSMLDIVMIRTFGHDIVERFASYSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ++AD+ T+ EHRGS+KGK  +W GDGNN+ +S IE A    + L IA+P
Sbjct: 124 NGLTDDHHPCQLLADLQTYNEHRGSIKGKTVAWIGDGNNMCNSYIEAAHMMGFKLKIASP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQPF 244
            G EP+ E+L      G  V +F +A  A   A  + TD W SM QE + +  E  F  F
Sbjct: 184 KGYEPKPEFL---AEFGHCVEVFDNAEDAAVNADLIVTDVWASMGQEEEQKLRERAFAAF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QVN  LM +AHP+ LFMHCLPAHRGEE+   +LD   +VV+DEAENRLH QKA++
Sbjct: 241 QVNEKLMGLAHPECLFMHCLPAHRGEEISETMLDHKNAVVWDEAENRLHAQKALV 295


>gi|15679443|ref|NP_276560.1| ornithine carbamoyltransferase [Methanothermobacter
           thermautotrophicus str. Delta H]
 gi|3183095|sp|O27495|OTC_METTH RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|2622559|gb|AAB85921.1| ornithine carbamoyltransferase [Methanothermobacter
           thermautotrophicus str. Delta H]
          Length = 301

 Score =  285 bits (728), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 142/298 (47%), Positives = 191/298 (64%), Gaps = 6/298 (2%)

Query: 14  ISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDT 73
           +S  ++  ++++     +  E     K L GK LAMIFEK STRTRVSFEV    +G   
Sbjct: 5   LSVCDMDNVVDLLDLADDYKEGKIREKILRGKTLAMIFEKSSTRTRVSFEVGAFQMGAQP 64

Query: 74  IFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTH 133
           ++LS S++QLGR E I DTA+ LSRYVD I++R  +HS ++EL   A+VPVIN LTD  H
Sbjct: 65  LYLSASDLQLGRGEPIADTARTLSRYVDGIMIRAISHSDVVELAGEASVPVINGLTDLEH 124

Query: 134 PCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEP--- 190
           PCQ +AD+ T  E  G   G+L  + GDGNN+ HSL+   A     +++A P G EP   
Sbjct: 125 PCQALADMQTIREKLGGFDGRLV-FVGDGNNVCHSLLLITATLGMDMDVACPPGYEPDPG 183

Query: 191 -RNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQPFQVNL 248
            R      A   G+ + + HD  +AV+GA  V+TD W+SM  E +A +   VF+P+QVN+
Sbjct: 184 IREMAGKIADETGSRIRVIHDPSEAVRGADVVYTDVWVSMGYEDEAEDRLEVFRPYQVNM 243

Query: 249 SLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGII 306
            LM +A P+A+FMHCLPA RG+E   EV+DGP SVV+D+AENRLH QKAI+ W  G I
Sbjct: 244 ELMELAAPEAIFMHCLPAVRGQETTAEVIDGPHSVVWDQAENRLHAQKAIMHWLMGDI 301


>gi|260551682|ref|ZP_05825756.1| ornithine carbamoyltransferase [Acinetobacter sp. RUH2624]
 gi|260405425|gb|EEW98919.1| ornithine carbamoyltransferase [Acinetobacter sp. RUH2624]
          Length = 306

 Score =  285 bits (728), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 142/295 (48%), Positives = 192/295 (65%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++S+  L  +++ A ++K   ++    +P  GKVL MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLRDLSTLELHRVLQRASELKKMQQSNKVYQPFVGKVLGMIFEKSSTRTRISFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +   GG  IFLS  + QLGR E I D+A+V+S  +D +++RT  H  +     Y+ VPVI
Sbjct: 64  INQFGGSAIFLSPRDTQLGRGEPIEDSARVISSMLDIVMIRTFGHDIVERFASYSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ++AD+ T+ EHRGS++GK  +W GDGNN+ +S IE A    + L IA+P
Sbjct: 124 NGLTDDHHPCQLLADLQTYIEHRGSIEGKTVAWIGDGNNMCNSYIEAAHLMGFKLKIASP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQPF 244
            G EP+ E+L      G  V LF +A  A   A  + TD W SM QE + +  ++ F  F
Sbjct: 184 KGFEPKPEFL---AEFGHCVELFDNAEDAAVNADLIVTDVWASMGQEEEQKLRKNAFAAF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QVN  LMS+AHPD LFMHCLPAHRGEE+   +LD   SVV+DEAENRLH QKA++
Sbjct: 241 QVNEKLMSLAHPDCLFMHCLPAHRGEEISETMLDHKNSVVWDEAENRLHAQKALM 295


>gi|30022212|ref|NP_833843.1| ornithine carbamoyltransferase [Bacillus cereus ATCC 14579]
 gi|229129409|ref|ZP_04258380.1| Ornithine carbamoyltransferase [Bacillus cereus BDRD-Cer4]
 gi|32699429|sp|Q818W3|OTC_BACCR RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|29897769|gb|AAP11044.1| Ornithine carbamoyltransferase [Bacillus cereus ATCC 14579]
 gi|228654014|gb|EEL09881.1| Ornithine carbamoyltransferase [Bacillus cereus BDRD-Cer4]
          Length = 316

 Score =  285 bits (728), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 137/302 (45%), Positives = 195/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTKEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR ET+ DTAKVLS+Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQMGRGETVSDTAKVLSQYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEETNTFKGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A+  GA + + HD   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 VGYEPNEEIVKKALAIAKETGAEIEVLHDPELAVNEADFIYTDVWMSMGQEGEEEKYSLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  +++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINNELVKHAKQTYRFLHCLPAHREEEVTGKIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|218289855|ref|ZP_03494045.1| ornithine carbamoyltransferase [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218239995|gb|EED07181.1| ornithine carbamoyltransferase [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 355

 Score =  285 bits (728), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 138/298 (46%), Positives = 199/298 (66%), Gaps = 8/298 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAM 66
           HF+DLS     +L  ++ +A+ +K + ++ F +  L+GK L MIF+K STRTR+SFEV M
Sbjct: 47  HFSDLSG---DDLRNLVHLAELLKEAQKSRFTHTLLAGKTLGMIFDKSSTRTRISFEVGM 103

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
             LGG  +FL G+ +Q GR E I DTA+V+SRY+D +++RT     + E  +YA +PVIN
Sbjct: 104 LQLGGHALFLPGNMLQTGRGEPISDTARVMSRYLDGVMIRTFRQQDVEEFAKYADIPVIN 163

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI 186
            LTD  HPCQ++AD +T  EH+G ++G   ++ GDGNN+ HS ++ A +    + +ATP 
Sbjct: 164 GLTDEFHPCQLLADALTILEHKGRLEGITVAFIGDGNNLAHSWLQLAPKLGMDIRVATPP 223

Query: 187 GSEPRNEYLNWAR----NQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVF 241
           G +P    +  A+     QG  V +  D  +A++GA  V+TDTW+SM  E +A E    F
Sbjct: 224 GYQPMQWVVEEAKLHAVQQGTEVLVTTDPERAIEGADVVYTDTWVSMGDEEEAEERLKHF 283

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + +QVN  L ++A PD +FMHCLPAHRGEEV  +V+DGP S++FD+AENRLH QKA+L
Sbjct: 284 EGYQVNEKLCALAKPDYVFMHCLPAHRGEEVSPDVIDGPHSIIFDQAENRLHAQKAVL 341


>gi|152976536|ref|YP_001376053.1| ornithine carbamoyltransferase [Bacillus cereus subsp. cytotoxis
           NVH 391-98]
 gi|152025288|gb|ABS23058.1| ornithine carbamoyltransferase [Bacillus cytotoxicus NVH 391-98]
          Length = 316

 Score =  285 bits (728), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 141/302 (46%), Positives = 192/302 (63%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH   L  ++   +  +I+ A  +K +    F    L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KHVLTLEELTQEEIISVIKFAIYLKKNKHEPF----LKGKILGLIFDKQSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG +MQLGR E+I DTAKVLS+Y+D I++RT +H+ + EL + A +PVI
Sbjct: 68  MMQLGGHGMFLSGKDMQLGRGESIADTAKVLSKYIDGIMIRTFSHADVEELAKKANIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEEVRTFKGIKLAYIGDGNNVCHSLLVASAKVGMDMAVATP 187

Query: 186 IGSEPR----NEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
            G EP      + L  A   GA +  FH    AV  A  V+TD W+SM QE    ++ +F
Sbjct: 188 RGYEPNGRMIQKALEIAEETGAKLEFFHAPQLAVAEADFVYTDVWMSMGQEGAQEKKVIF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QPFQ+N  L+  A     F+HCLPAHRGEEV +E++DG  S+VF +AENRLH QKA+L+ 
Sbjct: 248 QPFQINCELVQYAKKTYRFLHCLPAHRGEEVTSEIIDGMHSIVFTQAENRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 IF 309


>gi|228954414|ref|ZP_04116440.1| Ornithine carbamoyltransferase [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|229180410|ref|ZP_04307753.1| Ornithine carbamoyltransferase [Bacillus cereus 172560W]
 gi|228603157|gb|EEK60635.1| Ornithine carbamoyltransferase [Bacillus cereus 172560W]
 gi|228805346|gb|EEM51939.1| Ornithine carbamoyltransferase [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
          Length = 316

 Score =  285 bits (728), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 137/302 (45%), Positives = 195/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTKEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR E++ DTAKVLS+Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQMGRGESVSDTAKVLSQYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEETNTFKGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A+  GA + + HD   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 VGYEPNEEIVKKALAIAKETGAEIEVLHDPELAVNEADFIYTDVWMSMGQEGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINNELVKHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|218233764|ref|YP_002368932.1| ornithine carbamoyltransferase [Bacillus cereus B4264]
 gi|218161721|gb|ACK61713.1| ornithine carbamoyltransferase [Bacillus cereus B4264]
          Length = 316

 Score =  285 bits (728), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 137/302 (45%), Positives = 195/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTKEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR E++ DTAKVLS+Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQMGRGESVSDTAKVLSQYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEETNTFKGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A+  GA + + HD   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 VGYEPNEEIVKKALAIAKETGAEIEVLHDPELAVNEADFIYTDVWMSMGQEGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINNELVKHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|320528888|ref|ZP_08029980.1| ornithine carbamoyltransferase [Selenomonas artemidis F0399]
 gi|320138518|gb|EFW30408.1| ornithine carbamoyltransferase [Selenomonas artemidis F0399]
          Length = 310

 Score =  285 bits (728), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 147/313 (46%), Positives = 195/313 (62%), Gaps = 13/313 (4%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           MM        + ++S+ ++  I+ +A  +K   +    +  L+GK L MIFEK STRTRV
Sbjct: 1   MMKSGMDLISIHDLSAGDVEEILALAADLKVRQKAGIPHPLLAGKTLGMIFEKSSTRTRV 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFEV M  LGG  +FLS  ++QLGR E I DTA+VLSRY+D I++RT  H R+ EL  +A
Sbjct: 61  SFEVGMYQLGGRALFLSSRDLQLGRGEPIADTARVLSRYLDGIMIRTYGHERIEELARWA 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
            VPVINAL+D  HPCQ + D++T  EH+G + G   ++ GDGNN+ HSL+  AA+     
Sbjct: 121 DVPVINALSDLLHPCQALTDLLTIREHKGRLAGLKMAYVGDGNNMTHSLMYAAAKVGMHF 180

Query: 181 NIATPIGSEPRNEYLNWAR----NQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR 236
             ATP G EP  + +  AR      GASV L HD  +AV+ A  V TDTW SM QE    
Sbjct: 181 AAATPAGYEPNEKVVQNARADASETGASVTLTHDPKEAVRDADVVVTDTWASMGQE---- 236

Query: 237 EEH-----VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENR 291
           EEH     VF+P+QVN  L++ A   A+ MHCLPA+R EE+  +V +   +V+FDEAENR
Sbjct: 237 EEHDARTAVFRPYQVNPELLAAADARAVVMHCLPAYRNEEITADVFESFANVIFDEAENR 296

Query: 292 LHTQKAILLWCFG 304
           LH QKAI+    G
Sbjct: 297 LHVQKAIMALVMG 309


>gi|258511211|ref|YP_003184645.1| ornithine carbamoyltransferase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257477937|gb|ACV58256.1| ornithine carbamoyltransferase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 355

 Score =  285 bits (728), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 138/298 (46%), Positives = 199/298 (66%), Gaps = 8/298 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAM 66
           HF+DLS     +L  ++ +A+ +K + ++ F +  L+GK L MIF+K STRTR+SFEV M
Sbjct: 47  HFSDLSG---DDLRNLVHLAELLKEAQKSRFTHTLLAGKTLGMIFDKSSTRTRISFEVGM 103

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
             LGG  +FL G+ +Q GR E I DTA+V+SRY+D +++RT     + E  +YA +PVIN
Sbjct: 104 LQLGGHALFLPGNMLQTGRGEPISDTARVMSRYLDGVMIRTFRQQDVEEFAKYADIPVIN 163

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI 186
            LTD  HPCQ++AD +T  EH+G ++G   ++ GDGNN+ HS ++ A +    + +ATP 
Sbjct: 164 GLTDEFHPCQLLADALTILEHKGRLEGITVAFIGDGNNLAHSWLQLAPKLGMNIRVATPP 223

Query: 187 GSEPRNEYLNWAR----NQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVF 241
           G +P    +  A+     QG  V +  D  +A++GA  V+TDTW+SM  E +A E    F
Sbjct: 224 GYQPMQWVVEEAKLHAVQQGTEVLVTTDPERAIEGADVVYTDTWVSMGDEEEAEERLKHF 283

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + +QVN  L ++A PD +FMHCLPAHRGEEV  +V+DGP S++FD+AENRLH QKA+L
Sbjct: 284 EGYQVNEKLCALAKPDYVFMHCLPAHRGEEVSPDVIDGPHSIIFDQAENRLHAQKAVL 341


>gi|124485142|ref|YP_001029758.1| ornithine carbamoyltransferase [Methanocorpusculum labreanum Z]
 gi|189036329|sp|A2SQ85|OTC_METLZ RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|124362683|gb|ABN06491.1| ornithine carbamoyltransferase [Methanocorpusculum labreanum Z]
          Length = 305

 Score =  285 bits (728), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 135/296 (45%), Positives = 195/296 (65%), Gaps = 1/296 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K F  ++++S+     I+ +A ++K        +  L+GK LAMIFEK STRTR+SF+V 
Sbjct: 3   KDFLSITDLSAEEYEDILTLAARLKRQRYAGVPHPLLAGKTLAMIFEKASTRTRMSFDVG 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  ++L+  + QLGR ET+ DTA+V+SRYV   +MRT  H  + E  +YA++PVI
Sbjct: 63  MYDLGGYALYLNAKDTQLGRGETVADTARVMSRYVHGAIMRTYKHETITEFAKYASIPVI 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NAL+D  HPCQI+AD +T +E  G + G   +W GDGNN+ +SLI  + +    + + TP
Sbjct: 123 NALSDKEHPCQIMADSLTLKEKFGELDGLKIAWIGDGNNVCNSLIMASVQTGMEIAVGTP 182

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQE-FKAREEHVFQPF 244
            G EP    + +A+  G  V ++ D V+AV  AH ++TDTWISM +E  K  +   F  +
Sbjct: 183 KGYEPDPAAVKFAKENGGKVTIYDDPVRAVSDAHAIYTDTWISMGEEDIKETKLKDFVGY 242

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           Q++ +L++ A  DAL +HCLPAHRGEE+ +EV+D  QS V+D+AENRLH QKAIL+
Sbjct: 243 QLDTALLNKAADDALVLHCLPAHRGEEITDEVIDSMQSGVWDQAENRLHAQKAILV 298


>gi|121534678|ref|ZP_01666499.1| ornithine carbamoyltransferase [Thermosinus carboxydivorans Nor1]
 gi|121306698|gb|EAX47619.1| ornithine carbamoyltransferase [Thermosinus carboxydivorans Nor1]
          Length = 308

 Score =  285 bits (728), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 141/304 (46%), Positives = 196/304 (64%), Gaps = 5/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    + ++S + ++ I ++AK +K+  +   E+  L GK LAMIF+K STRTRVSFEV 
Sbjct: 4   KDLLSVHDLSQAEINRIFDLAKTLKSKQQQGEEHHLLKGKTLAMIFQKASTRTRVSFEVG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FL+ +++Q+GR E + DTA+VLSRYVD I++RT  H  ++EL  YATVPVI
Sbjct: 64  MWQLGGKALFLNANDLQIGRGEPVKDTARVLSRYVDGIMIRTFAHDEVVELARYATVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ + DI T  E +G ++G+  ++ GDGNN+ ++L+   A+    + +ATP
Sbjct: 124 NGLTDLYHPCQALTDIFTVWEFKGDLQGRKLAYIGDGNNMANALLHACAKVGMHMTVATP 183

Query: 186 IGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREEHV 240
            G EP    L  A +     G+ + +  D   A   A  ++TD W SM QE  +A     
Sbjct: 184 PGYEPPAAVLAEAADDALVTGSRLEIVSDPFAAAYDADVLYTDVWASMGQEKEQAARRAA 243

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F  +QVN  L+ +A PDA+ MHCLPAHRGEE+ +EV++G QSVVFD+AENRLH QKAIL 
Sbjct: 244 FAGYQVNGELLKVAKPDAIVMHCLPAHRGEEITDEVMEGSQSVVFDQAENRLHVQKAILA 303

Query: 301 WCFG 304
              G
Sbjct: 304 LLMG 307


>gi|262372672|ref|ZP_06065951.1| ornithine carbamoyltransferase [Acinetobacter junii SH205]
 gi|262312697|gb|EEY93782.1| ornithine carbamoyltransferase [Acinetobacter junii SH205]
          Length = 306

 Score =  284 bits (727), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 143/295 (48%), Positives = 191/295 (64%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++SS  L  I++ A ++K    +    +P  GKVL MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLRDLSSLELQRILDRAHELKRMQHSNTVFQPFVGKVLGMIFEKSSTRTRISFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +   GG+ IFLS  + QLGR E I D+A+V+S  +D +++RT  H  +     Y+TVPVI
Sbjct: 64  ICQFGGNAIFLSPRDTQLGRGEPIEDSARVISSMLDIVMIRTFGHDIVERFASYSTVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ++AD+ T+EEHRGS+KG+  +W GDGNN+ +S IE A    + L IA+P
Sbjct: 124 NGLTDDHHPCQLLADLQTYEEHRGSIKGRTVAWIGDGNNMCNSYIEAAHMMGFKLKIASP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQPF 244
            G EP+ E+L    +    V +F+ A  A   A  + TD W SM QE + +  E  F  F
Sbjct: 184 EGYEPKPEFLAEFAD---CVEVFNKAEDAAVNADLIVTDVWASMGQEEEQKLREKAFADF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QVN  LM +AHPD LFMHCLPAHRGEE+   +LD   SVV+ EAENRLH QKA++
Sbjct: 241 QVNEKLMDLAHPDCLFMHCLPAHRGEEISENMLDHKNSVVWSEAENRLHAQKALM 295


>gi|313672705|ref|YP_004050816.1| ornithine carbamoyltransferase [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312939461|gb|ADR18653.1| ornithine carbamoyltransferase [Calditerrivibrio nitroreducens DSM
           19672]
          Length = 312

 Score =  284 bits (727), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 146/303 (48%), Positives = 200/303 (66%), Gaps = 11/303 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K F  L +  S  L  ++++A K+K      F    L  K +A+IFEK STRTRVSFEV 
Sbjct: 3   KDFLTLRDYDSDTLKKLVQLAIKMKKERLT-FGRDILKNKTVALIFEKSSTRTRVSFEVG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  +GG  +FLS +++QLGR ETI DTA+ LSRYVD I++RT  HS++ +L +Y++VPVI
Sbjct: 62  VYDMGGYPLFLSKNDIQLGRGETIEDTARTLSRYVDMIMIRTFEHSKVEKLAKYSSVPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ++ADIMT  E  G+   KL ++ GDGNN+ HSL+ G ++F    +IATP
Sbjct: 122 NGLTDDFHPCQVMADIMTVYEKFGTYDLKL-AYVGDGNNMAHSLMIGCSKFGIDFSIATP 180

Query: 186 IGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE--- 238
            G EP+ E LN+    AR  G ++   +D  +AV+GA  ++TD W SM QE  A  E   
Sbjct: 181 KGYEPKFEVLNYAMDVARKNGKTIHFNNDPYEAVRGADIIYTDVWTSMGQE--AENEIRL 238

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             FQ +QV++ L+        FMHCLPAHRGEEV ++V++   S+VFDEAENRLH QKAI
Sbjct: 239 KAFQGYQVDMELLKATGKKTYFMHCLPAHRGEEVSDDVIESEFSIVFDEAENRLHAQKAI 298

Query: 299 LLW 301
           + +
Sbjct: 299 MAY 301


>gi|169633324|ref|YP_001707060.1| ornithine carbamoyltransferase [Acinetobacter baumannii SDF]
 gi|169152116|emb|CAP01015.1| ornithine carbamoyltransferase [Acinetobacter baumannii]
          Length = 306

 Score =  284 bits (727), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 142/295 (48%), Positives = 191/295 (64%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++S+  L+ I+E A ++K   ++    +P  GKVL MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLRDLSTLELNRILERASELKKMQQSNKVYQPFVGKVLGMIFEKSSTRTRISFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +   GG  IFLS  + QLGR E I D+A+V+S  +D +++RT  H  +     Y+ VPVI
Sbjct: 64  INQFGGSAIFLSPRDTQLGRGEPIEDSARVISSMLDIVMIRTFGHDIVERFASYSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ++AD+ T+ E+RGS++GK  +W GDGNN+ +S IE A    + L IA+P
Sbjct: 124 NGLTDDHHPCQLLADLQTYIEYRGSIEGKTVAWIGDGNNMCNSYIEAAHMMGFKLKIASP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQPF 244
            G EP+ E+L      G  V LF +A  A   A  + TD W SM QE + +  E  F  F
Sbjct: 184 KGYEPKPEFL---AEFGHCVELFDNAEDAAVNADLIVTDVWASMGQEEEQKLREKAFADF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QVN  LM +AHPD LFMHCLPAHRGEE+   +LD   +VV+DEAENRLH QKA++
Sbjct: 241 QVNEKLMGLAHPDCLFMHCLPAHRGEEISETMLDHKNAVVWDEAENRLHAQKALM 295


>gi|229081387|ref|ZP_04213890.1| Ornithine carbamoyltransferase [Bacillus cereus Rock4-2]
 gi|228702009|gb|EEL54492.1| Ornithine carbamoyltransferase [Bacillus cereus Rock4-2]
          Length = 316

 Score =  284 bits (727), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 137/302 (45%), Positives = 195/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTKEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR E++ DTAKVLS+Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQMGRGESVSDTAKVLSQYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEEINTFKGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A+  GA + + HD   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 VGYEPNEEIVKKALAIAKETGAEIEVLHDPELAVNEADFIYTDVWMSMGQEGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINNELVKHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|88812675|ref|ZP_01127922.1| ornithine carbamoyltransferase [Nitrococcus mobilis Nb-231]
 gi|88790091|gb|EAR21211.1| ornithine carbamoyltransferase [Nitrococcus mobilis Nb-231]
          Length = 303

 Score =  284 bits (727), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 139/297 (46%), Positives = 190/297 (63%), Gaps = 8/297 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           P+HF  L++ ++  L  +I    ++K    +   ++PL  +VL+MIFEK STRTRVSFE 
Sbjct: 3   PRHFLTLTDCTAEELHALIRRGIELKRMRRDGLVHEPLKNRVLSMIFEKASTRTRVSFEA 62

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG  +FLS  + QLGR ETI DTA+V+S  VDAI++RT  H  L    EY+ VP+
Sbjct: 63  GMVQLGGHAMFLSPRDTQLGRGETIEDTARVISSMVDAIMIRTFGHETLTRFAEYSRVPI 122

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN L+D  HPCQ++AD+ T+ EHR  ++G+   W GDGNN+  S +  A   ++ L +  
Sbjct: 123 INGLSDEFHPCQLLADMQTYWEHRDDIRGRTVVWVGDGNNMCRSYVNAARMLDFQLRVCC 182

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV--FQ 242
           P G  P  ++L   R     +    +  +A++GAH V TD W SM QE + RE+ +    
Sbjct: 183 PPGYAPGPQWLADPR-----IEFIPEPSEALRGAHLVVTDVWASMGQE-REREQRLRDLA 236

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           P+++   LM +A P ALFMHCLPAHRGEEV  EV+DG QSVV+DEAENRLH QKA+L
Sbjct: 237 PYRITDGLMELADPQALFMHCLPAHRGEEVEAEVIDGAQSVVWDEAENRLHAQKALL 293


>gi|229174807|ref|ZP_04302329.1| Ornithine carbamoyltransferase [Bacillus cereus MM3]
 gi|228608670|gb|EEK65970.1| Ornithine carbamoyltransferase [Bacillus cereus MM3]
          Length = 316

 Score =  284 bits (727), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 137/302 (45%), Positives = 194/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTQEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR E++ DTAKVLS Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQIGRGESVSDTAKVLSHYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEETNTFKGIKLAYVGDGNNVCHSLLLASAKVGMNMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A   GA + + H+A  AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 VGYEPNEEIVKKALTIAEETGAEIEILHNAELAVSKADFIYTDVWMSMGQEGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINTELVMHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|154685559|ref|YP_001420720.1| ornithine carbamoyltransferase [Bacillus amyloliquefaciens FZB42]
 gi|154351410|gb|ABS73489.1| ArgF [Bacillus amyloliquefaciens FZB42]
          Length = 323

 Score =  284 bits (727), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 147/302 (48%), Positives = 204/302 (67%), Gaps = 11/302 (3%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSS-ENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           Y K F  L ++S S+++ ++  A  +K    + IF+     GK LAMIFEK STRTRVSF
Sbjct: 14  YGKDFLSLKDVSPSDINALLTEASLLKQHPIQPIFQ-----GKTLAMIFEKSSTRTRVSF 68

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E  M  LGG  +FLS S++QLGR ET+ DTAKVLS +VDAI++RT  H ++ EL E+A +
Sbjct: 69  EAGMAQLGGTGLFLSSSDLQLGRGETVADTAKVLSGFVDAIMIRTFEHEKVEELAEHADI 128

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVIN LTD  HPCQ +AD++T +E +G +KG   ++ GDGNN+ HSL+ G A+    + I
Sbjct: 129 PVINGLTDRYHPCQALADLLTIQEIKGKLKGVKAAYIGDGNNVAHSLMIGCAKMGCDIAI 188

Query: 183 ATPIGSEPRNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE 238
           A+P G E   E +N A+      GA + L  +  +AV+ A  +++D + SM QE + ++ 
Sbjct: 189 ASPKGYEVEEEAVNAAKEAAAVSGAKITLTENPQEAVRDADVIYSDVFTSMGQEEETQQR 248

Query: 239 -HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
            +VF P+QVN SL+S+A PD  F+HCLPAHR EEV +E++DGP S VF +AENRLH QKA
Sbjct: 249 LNVFAPYQVNASLVSLAKPDYTFLHCLPAHREEEVTSEIIDGPNSAVFQQAENRLHAQKA 308

Query: 298 IL 299
           +L
Sbjct: 309 LL 310


>gi|327481725|gb|AEA85035.1| ornithine carbamoyltransferase [Pseudomonas stutzeri DSM 4166]
          Length = 306

 Score =  284 bits (726), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 139/295 (47%), Positives = 194/295 (65%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L + +   L+ ++    ++K+  +     +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSLMDCTPQELNSLVRRGIELKDLRKRGVLFEPLKNRVLGMIFEKASTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I D+A V+SR +DA+++RT  HS L +    ++VPVI
Sbjct: 64  MIQLGGQAIFLSPRDTQLGRGEPISDSAIVMSRMLDAVMIRTFAHSTLTDFAANSSVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ T+ EHRGS+ GK  +W GDGNN+ ++ IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLMADMQTYHEHRGSIAGKTVAWIGDGNNMCNTYIEAAIQFDFRLKVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP  E L  A   G  V +  D  +A  GA+ + TD W SM QE + A     F+P+
Sbjct: 184 EGYEPDAELLARA---GERVQVLRDPREAAAGANLISTDVWASMGQEDEVAARLATFRPY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QVN +L+  A  D LFMHCLPAHRGEE+ +++LD P+SV +D+AENRLH QKA+L
Sbjct: 241 QVNRALLDCAAADVLFMHCLPAHRGEEISHDLLDDPRSVAWDQAENRLHVQKALL 295


>gi|222054222|ref|YP_002536584.1| ornithine carbamoyltransferase [Geobacter sp. FRC-32]
 gi|221563511|gb|ACM19483.1| ornithine carbamoyltransferase [Geobacter sp. FRC-32]
          Length = 303

 Score =  284 bits (726), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 142/301 (47%), Positives = 192/301 (63%), Gaps = 2/301 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K F  LS  S S L  I  + +++K   +   E+  L GK LAMIFEK STRTRVSFEV 
Sbjct: 3   KDFLALSQFSKSELDAIFTLTRELKQKQKRGEEHHLLKGKTLAMIFEKSSTRTRVSFEVG 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +F+S  + Q+GR E I DTA+V++RY D +++RT     + E   Y++VP+I
Sbjct: 63  MYQLGGHPLFISTKDSQMGRGEPIKDTARVMARYCDGVMIRTYGQEIVEEFARYSSVPII 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQI+AD+ T  EHRGS +G   +W GDGNN+ ++ IE AA F + L +A P
Sbjct: 123 NGLTDLHHPCQIMADLFTVIEHRGSYEGLKIAWVGDGNNMANTWIEAAAIFGFDLTLACP 182

Query: 186 IGSEPRNEYLNWA-RNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHVFQP 243
            G EP    + WA  N  +S+ L  D  +AVK A  V TD W SM QE +  + E  F  
Sbjct: 183 KGYEPDAAAMQWALANATSSIVLTDDPQEAVKDADVVNTDVWASMGQEAEQNKREKDFAG 242

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +Q+N +L+ +A  + + +HCLPAHRGEE+ ++V++GP S V+DEAENRLH QKAI+    
Sbjct: 243 YQLNEALLDLAKGNCMVLHCLPAHRGEEITDDVIEGPHSAVWDEAENRLHVQKAIMATLM 302

Query: 304 G 304
           G
Sbjct: 303 G 303


>gi|118479327|ref|YP_896478.1| ornithine carbamoyltransferase [Bacillus thuringiensis str. Al
           Hakam]
 gi|118418552|gb|ABK86971.1| ornithine carbamoyltransferase [Bacillus thuringiensis str. Al
           Hakam]
          Length = 316

 Score =  284 bits (726), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 137/302 (45%), Positives = 194/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTQEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR ET+ DTAKVLS Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQIGRGETVSDTAKVLSHYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E + + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEEKNTFKGIKVAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A   GA + + H+   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 VGYEPNEEIIKKALTIAEETGAKIEILHNPELAVNEADFIYTDVWMSMGQEGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINKELVMHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|297183468|gb|ADI19599.1| ornithine carbamoyltransferase [uncultured SAR11 cluster bacterium
           HF0770_37D02]
          Length = 304

 Score =  284 bits (726), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 137/303 (45%), Positives = 201/303 (66%), Gaps = 2/303 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           ++F +LS+I    L  II+ AK  K     I  + PL+GK L MIFEKPSTRTR+SFE+A
Sbjct: 2   RNFINLSDIDKQELRKIIDHAKSQKQKGSTIKTDVPLAGKTLIMIFEKPSTRTRLSFELA 61

Query: 66  MKHLGGDTIFLSGSEMQLGRA-ETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           MK LGGD + L+  E   G   E+I DTAK+LS+Y D ++MRT  H   LE +++  +P+
Sbjct: 62  MKKLGGDVLVLNPKESHYGSGDESIHDTAKILSQYGDVVMMRTNKHEHFLEFSKHLEIPI 121

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LT+ +HP QI+A ++++EE RGS+  K  +W GDGNN+++SLIE A +F++ L IA 
Sbjct: 122 INGLTNLSHPVQIMATVLSYEELRGSIANKKIAWLGDGNNVVYSLIEAAVQFDFQLAIAC 181

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQP 243
           P   EP  + + WA+++ A++ +  +  +A K A  V TD WISM       +++ + +P
Sbjct: 182 PKKLEPNKKIIKWAKDKKANILITKNPKEAAKDASAVITDKWISMGDSVNKKKKKKLLKP 241

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +QVN  +M +A  DA+FMHCLPA R EEV + V+DG QS V+ EA NR+H QK+I+ +C 
Sbjct: 242 YQVNEKIMKLAKSDAIFMHCLPAKRNEEVTDSVMDGEQSAVWLEALNRMHVQKSIIQFCL 301

Query: 304 GII 306
            ++
Sbjct: 302 NLL 304


>gi|324328035|gb|ADY23295.1| ornithine carbamoyltransferase [Bacillus thuringiensis serovar
           finitimus YBT-020]
          Length = 316

 Score =  284 bits (726), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 136/302 (45%), Positives = 194/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTQEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR ET+ DTAKVLS+Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQMGRGETVSDTAKVLSQYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEEINTFKGIKLAYVGDGNNVCHSLLLASAKVGMYMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A   GA + + H+   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 VGYEPNEEIVKKALTIAEETGAKIEILHNPELAVNEADFIYTDVWMSMGQEGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DGP+S+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINTELVKHAKQTYRFLHCLPAHREEEVTGEIIDGPKSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|228941291|ref|ZP_04103844.1| Ornithine carbamoyltransferase [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228974223|ref|ZP_04134793.1| Ornithine carbamoyltransferase [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228980814|ref|ZP_04141119.1| Ornithine carbamoyltransferase [Bacillus thuringiensis Bt407]
 gi|228778983|gb|EEM27245.1| Ornithine carbamoyltransferase [Bacillus thuringiensis Bt407]
 gi|228785563|gb|EEM33572.1| Ornithine carbamoyltransferase [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228818450|gb|EEM64522.1| Ornithine carbamoyltransferase [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|326941909|gb|AEA17805.1| ornithine carbamoyltransferase [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 316

 Score =  284 bits (726), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 138/302 (45%), Positives = 194/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +I+ A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTKEEIISLIDFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR ET+ DTAKVLS+Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQMGRGETVSDTAKVLSQYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEEINTFKGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           IG EP  E     L  A   GA + + HD   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 IGYEPNEEIVKKALAIAEETGAEIEVLHDPELAVNEADFIYTDVWMSMGQEGEEEKYSLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINNELVKHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|184158423|ref|YP_001846762.1| ornithine carbamoyltransferase [Acinetobacter baumannii ACICU]
 gi|332873915|ref|ZP_08441855.1| ornithine carbamoyltransferase [Acinetobacter baumannii 6014059]
 gi|183210017|gb|ACC57415.1| Ornithine carbamoyltransferase [Acinetobacter baumannii ACICU]
 gi|322508749|gb|ADX04203.1| argF [Acinetobacter baumannii 1656-2]
 gi|323518352|gb|ADX92733.1| ornithine carbamoyltransferase [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332737901|gb|EGJ68788.1| ornithine carbamoyltransferase [Acinetobacter baumannii 6014059]
          Length = 306

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 142/295 (48%), Positives = 190/295 (64%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++S+  L+ I+E A ++K   ++    +P  GKVL MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLRDLSTLELNRILERASELKKMQQSNKVYQPFVGKVLGMIFEKSSTRTRISFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +   GG  IFLS  + QLGR E I D+A+V+S  +D +++RT  H  +     Y+ VPVI
Sbjct: 64  INQFGGSAIFLSPRDTQLGRGEPIEDSARVISSMLDIVMIRTFGHDIVERFASYSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ++AD+ T+ EHRGS++GK  +W GDGNN+ +S IE A    + L IA+P
Sbjct: 124 NGLTDDHHPCQLLADLQTYIEHRGSIEGKTVAWIGDGNNMCNSYIEAAHMMGFKLKIASP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQPF 244
              EP+ E+L      G  V LF +A  A   A  + TD W SM QE + +  E  F  F
Sbjct: 184 KSYEPKPEFL---AEFGHCVELFDNAEDAAVNADLIVTDVWASMGQEEEQKLREKAFADF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QVN  LM +AHPD LFMHCLPAHRGEE+   +LD   +VV+DEAENRLH QKA++
Sbjct: 241 QVNEKLMGLAHPDCLFMHCLPAHRGEEISETMLDHKNAVVWDEAENRLHAQKALM 295


>gi|229111603|ref|ZP_04241154.1| Ornithine carbamoyltransferase [Bacillus cereus Rock1-15]
 gi|228671985|gb|EEL27278.1| Ornithine carbamoyltransferase [Bacillus cereus Rock1-15]
          Length = 316

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 137/302 (45%), Positives = 194/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTKEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR ET+ DTAKVLS+Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQMGRGETVSDTAKVLSQYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEETNTFKGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A+  GA + + H+   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 VGYEPNEEIVKKALAIAKETGAEIEVLHNPELAVNEADFIYTDVWMSMGQEGEEEKYSLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L   A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINNELAKHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|317487366|ref|ZP_07946157.1| ornithine carbamoyltransferase [Bilophila wadsworthia 3_1_6]
 gi|316921389|gb|EFV42684.1| ornithine carbamoyltransferase [Bilophila wadsworthia 3_1_6]
          Length = 300

 Score =  283 bits (724), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 145/300 (48%), Positives = 197/300 (65%), Gaps = 4/300 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           PKHF  + ++  S    II  AK++K ++   +    + GKV A+IFEK STRTRVSF+V
Sbjct: 2   PKHFMRIRDLGHSGAWEIIRRAKEMKETN---YRGHCMDGKVAALIFEKASTRTRVSFDV 58

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           A++ LGG TIF++ +E QLGR+E + DTA+VLSRYVD +++RT    +L EL EY ++PV
Sbjct: 59  AVRQLGGTTIFMTPAESQLGRSEPLRDTARVLSRYVDCLIVRTFGQEKLDELAEYGSLPV 118

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           +NALTD  HPCQ++AD++T  E          +W GDGNN+ +S IE A  F + LN+A 
Sbjct: 119 VNALTDQGHPCQLMADLLTIYERTPDFSKVTVTWVGDGNNMANSWIEAAMYFPFQLNMAI 178

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN-QEFKAREEHVFQP 243
             G EP  + L  A   GA + L HD   AV GA+ ++ D W SM  +E + + E  F+ 
Sbjct: 179 APGYEPDQQLLALALQSGAKIFLTHDPKLAVDGANYIYADVWASMGQEEEQKKREEAFKG 238

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           F V+  LMS+A P   F+HCLPAHRGEEV +EV++   S+V+DEAENRLH QKAIL W F
Sbjct: 239 FCVDSELMSLAAPGVKFLHCLPAHRGEEVTDEVMESEASIVWDEAENRLHAQKAILEWVF 298


>gi|196047207|ref|ZP_03114423.1| ornithine carbamoyltransferase [Bacillus cereus 03BB108]
 gi|225866114|ref|YP_002751492.1| ornithine carbamoyltransferase [Bacillus cereus 03BB102]
 gi|229186375|ref|ZP_04313540.1| Ornithine carbamoyltransferase [Bacillus cereus BGSC 6E1]
 gi|254772714|sp|C1ER02|OTC_BACC3 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|196021956|gb|EDX60647.1| ornithine carbamoyltransferase [Bacillus cereus 03BB108]
 gi|225787629|gb|ACO27846.1| ornithine carbamoyltransferase [Bacillus cereus 03BB102]
 gi|228597169|gb|EEK54824.1| Ornithine carbamoyltransferase [Bacillus cereus BGSC 6E1]
          Length = 316

 Score =  283 bits (724), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 137/302 (45%), Positives = 194/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTQEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FL+G EMQ+GR ET+ DTAKVLS Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLNGKEMQMGRGETVSDTAKVLSHYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEETNTFKGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           IG EP  E     L  A+  GA + + H+   AV     ++TD W+SM QE +  +  VF
Sbjct: 188 IGYEPNEEIVKKALAIAKETGAEIEILHNPELAVNEVDFIYTDVWMSMGQEGEEEKYTVF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L++ A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINKELVTHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|288941638|ref|YP_003443878.1| ornithine carbamoyltransferase [Allochromatium vinosum DSM 180]
 gi|288897010|gb|ADC62846.1| ornithine carbamoyltransferase [Allochromatium vinosum DSM 180]
          Length = 306

 Score =  283 bits (724), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 144/298 (48%), Positives = 188/298 (63%), Gaps = 4/298 (1%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           T  +HF  L ++S      +I  A ++K       + KPL+G+ LAMIFEK STRTRVSF
Sbjct: 6   TDCRHFLSLLDLSLDEARALIARATELKRMRAAGQDFKPLAGRTLAMIFEKSSTRTRVSF 65

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E  M  LGG  +FLS  + QLGR E I D+A+V+SR VDA+++RT     +     ++ V
Sbjct: 66  EAGMVQLGGHALFLSPRDTQLGRGEPIEDSARVISRMVDAVMIRTFEQKTVEVFAAHSRV 125

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVIN LTD  HPCQ++AD+ TF EHRG ++GK   W GDGNN+ HS +E A  F++ L +
Sbjct: 126 PVINGLTDRCHPCQMLADLQTFHEHRGDIQGKRVVWIGDGNNMCHSFMEAAQLFDFELRV 185

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQ-EFKAREEHVF 241
           A P G EP  + L      G    +  D  +A +GAH + TD W SM Q E + R +  F
Sbjct: 186 ACPEGFEPDADLLAAC---GDRCTILRDPREAAEGAHLIATDVWASMGQEEEQERRQAAF 242

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             +QV  ++M  A  D LFMHCLPAHRGEEV   V+DGP+SVV+DEAENRLH QKA+L
Sbjct: 243 ASYQVTDAIMDQASNDVLFMHCLPAHRGEEVAASVIDGPRSVVWDEAENRLHAQKALL 300


>gi|296113081|ref|YP_003627019.1| ornithine carbamoyltransferase [Moraxella catarrhalis RH4]
 gi|295920775|gb|ADG61126.1| ornithine carbamoyltransferase [Moraxella catarrhalis RH4]
 gi|326560457|gb|EGE10839.1| ornithine carbamoyltransferase [Moraxella catarrhalis 7169]
 gi|326561660|gb|EGE11997.1| ornithine carbamoyltransferase [Moraxella catarrhalis 103P14B1]
 gi|326564211|gb|EGE14447.1| ornithine carbamoyltransferase [Moraxella catarrhalis 12P80B1]
 gi|326565810|gb|EGE15972.1| ornithine carbamoyltransferase [Moraxella catarrhalis BC1]
 gi|326570463|gb|EGE20503.1| ornithine carbamoyltransferase [Moraxella catarrhalis BC8]
 gi|326571147|gb|EGE21171.1| ornithine carbamoyltransferase [Moraxella catarrhalis BC7]
 gi|326573439|gb|EGE23407.1| ornithine carbamoyltransferase [Moraxella catarrhalis 101P30B1]
 gi|326575664|gb|EGE25587.1| ornithine carbamoyltransferase [Moraxella catarrhalis CO72]
 gi|326577129|gb|EGE27023.1| ornithine carbamoyltransferase [Moraxella catarrhalis O35E]
          Length = 307

 Score =  283 bits (724), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 141/298 (47%), Positives = 191/298 (64%), Gaps = 10/298 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF +L +++ + L  II  A K++   +     +P  G+ L MIFEK STRTR+SFE  
Sbjct: 4   RHFRNLLDMTPAELEAIISRASKLRQMQQCGEIYRPFVGRTLGMIFEKSSTRTRISFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M   GG  IFLS  + QLGR E I D+AKV+S  VD I++RT  H +L    ++++VPVI
Sbjct: 64  MGQFGGHAIFLSPKDTQLGRGEPIEDSAKVISSMVDIIMIRTFEHDKLDLFCKHSSVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+ HPCQ++AD+ TF EHRGS+KGK  +W GDGNN+  S I  A +F + L +  P
Sbjct: 124 NALTDDFHPCQLLADMQTFHEHRGSIKGKTVTWVGDGNNMCASYILAAHQFGFQLRVTAP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQE----FKAREEHVF 241
            G EP  + +         V    D  +A KGAH + TD W SM QE     +AR    F
Sbjct: 184 YGFEPNPKLIE---EYSHCVTYVEDPQEAAKGAHLITTDVWASMGQESEQMTRARR---F 237

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            P+QV+ +++  A PD LFMHCLPAHRGEE+  ++L+ P+SVV+DEAENRLH QKA++
Sbjct: 238 APYQVSPAMLDKADPDVLFMHCLPAHRGEEISFDLLNDPRSVVWDEAENRLHAQKALM 295


>gi|326559523|gb|EGE09939.1| ornithine carbamoyltransferase [Moraxella catarrhalis 46P47B1]
          Length = 307

 Score =  283 bits (724), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 141/298 (47%), Positives = 191/298 (64%), Gaps = 10/298 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF +L +++ + L  II  A K++   +     +P  G+ L MIFEK STRTR+SFE  
Sbjct: 4   RHFRNLLDMTPAELEAIISRASKLRQMQQCGEIYRPFVGRTLGMIFEKSSTRTRISFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M   GG  IFLS  + QLGR E I D+AKV+S  VD I++RT  H +L    ++++VPVI
Sbjct: 64  MGQFGGHAIFLSPKDTQLGRGEPIEDSAKVISSMVDIIMIRTFEHDKLDLFCKHSSVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+ HPCQ++AD+ TF EHRGS+KGK  +W GDGNN+  S I  A +F + L +  P
Sbjct: 124 NALTDDFHPCQLLADMQTFHEHRGSIKGKTVTWVGDGNNMCASYILAAHQFGFQLRVTAP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQE----FKAREEHVF 241
            G EP  + +         V    D  +A KGAH + TD W SM QE     +AR    F
Sbjct: 184 YGFEPNPKLIE---EYSHCVTYVEDPQEAAKGAHLITTDVWASMGQESEQMTRARR---F 237

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            P+QV+ +++  A PD LFMHCLPAHRGEE+  ++L+ P+SVV+DEAENRLH QKA++
Sbjct: 238 APYQVSPAMLDKADPDVLFMHCLPAHRGEEISFDLLNDPRSVVWDEAENRLHAQKALM 295


>gi|255324645|ref|ZP_05365762.1| ornithine carbamoyltransferase [Corynebacterium tuberculostearicum
           SK141]
 gi|255298551|gb|EET77851.1| ornithine carbamoyltransferase [Corynebacterium tuberculostearicum
           SK141]
          Length = 306

 Score =  283 bits (724), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 143/303 (47%), Positives = 204/303 (67%), Gaps = 8/303 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRVSFEV 64
           +HF    ++S    + ++++A+++K   ++ F  +PL G K +A++F+K STRTR+SFE 
Sbjct: 4   RHFLADDDLSPQEQATVLDLAERLK---KDPFAERPLEGPKTVAVLFDKTSTRTRLSFET 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           A+ ++GG  I +  S  Q+G+ E+  DTA VLSRYV+AIV RT +H  LL++ E ATVP+
Sbjct: 61  AVANMGGKGITVDTSTTQMGKGESYQDTAAVLSRYVEAIVWRTFDHDNLLQMAETATVPL 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLNIA 183
           +NAL+D+ HPCQI+AD++T  E+ G +KGK   + GDG NN+ +S + G A     ++I 
Sbjct: 121 VNALSDDLHPCQILADLLTCRENLGDLKGKKAVYLGDGDNNMANSYMIGFATAGMDVSII 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV-FQ 242
            P G +PR E+++ AR +G       D V  V GA  V TDTW SM QE   R+    F 
Sbjct: 181 APEGFQPRQEFVDRARKRGNIT--ITDDVDEVAGADVVITDTWTSMGQENDGRDRRTPFL 238

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           P+QV+ ++MS AH DA+F+HCLPA+RG EV  EV+DGPQS VFDEAENRLH QKA+L+W 
Sbjct: 239 PYQVDSTIMSKAHKDAIFLHCLPAYRGNEVTAEVIDGPQSRVFDEAENRLHAQKALLVWL 298

Query: 303 FGI 305
             I
Sbjct: 299 LEI 301


>gi|323490997|ref|ZP_08096191.1| ornithine carbamoyltransferase (argf) [Planococcus donghaensis
           MPA1U2]
 gi|323395353|gb|EGA88205.1| ornithine carbamoyltransferase (argf) [Planococcus donghaensis
           MPA1U2]
          Length = 317

 Score =  283 bits (724), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 145/304 (47%), Positives = 203/304 (66%), Gaps = 11/304 (3%)

Query: 8   FADLSNISSSNLSCIIEVAKKIKNSSENIFENKPL-SGKVLAMIFEKPSTRTRVSFEVAM 66
           F  L + S++ L  ++ +A ++K   EN  +N PL  GKVL MIFEK STRTRVSFE  M
Sbjct: 16  FLSLKDYSTTELMDLLNLAIELKKP-EN--KNLPLLKGKVLGMIFEKSSTRTRVSFEAGM 72

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
             LGG  +FLS  + QLGR ETI DT +VLS Y+D +++RT + S + EL +++++PVIN
Sbjct: 73  LQLGGHAMFLSSQDTQLGRGETIADTGRVLSGYLDGLMIRTYHQSTVQELADFSSIPVIN 132

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI 186
            LTD+ HPCQ++AD+MT  EH G++KGK  ++ GDGNN+ +SL+ GAA+    ++IA+P 
Sbjct: 133 GLTDDYHPCQVMADLMTMLEHFGTLKGKKMAYIGDGNNMANSLMIGAAKVGMDISIASPA 192

Query: 187 GSEPRNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA--REEHV 240
              P    +  A+      G+++ +     +AV G+  V+TD W SM QE +   R EH 
Sbjct: 193 AYAPTPAMVALAKEIAHYTGSTIEITDSPEKAVTGSDAVYTDVWASMGQEQETIERLEH- 251

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           FQ FQVN  L+  A+PD +FMHCLPAHR EEV   +L+GPQSV+F ++ENRLH QKA+L+
Sbjct: 252 FQGFQVNEELIKYANPDFIFMHCLPAHREEEVTTAILEGPQSVIFQQSENRLHAQKAVLV 311

Query: 301 WCFG 304
              G
Sbjct: 312 ALMG 315


>gi|206976249|ref|ZP_03237157.1| ornithine carbamoyltransferase [Bacillus cereus H3081.97]
 gi|217961622|ref|YP_002340192.1| ornithine carbamoyltransferase [Bacillus cereus AH187]
 gi|222097578|ref|YP_002531635.1| ornithine carbamoyltransferase [Bacillus cereus Q1]
 gi|229140864|ref|ZP_04269409.1| Ornithine carbamoyltransferase [Bacillus cereus BDRD-ST26]
 gi|254772715|sp|B7HNP5|OTC_BACC7 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|254772716|sp|B9IXC5|OTC_BACCQ RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|206745445|gb|EDZ56844.1| ornithine carbamoyltransferase [Bacillus cereus H3081.97]
 gi|217066417|gb|ACJ80667.1| ornithine carbamoyltransferase [Bacillus cereus AH187]
 gi|221241636|gb|ACM14346.1| ornithine carbamoyltransferase [Bacillus cereus Q1]
 gi|228642654|gb|EEK98940.1| Ornithine carbamoyltransferase [Bacillus cereus BDRD-ST26]
          Length = 316

 Score =  283 bits (724), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 137/302 (45%), Positives = 195/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTKEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR ET+ DTAKVLS+Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQMGRGETVSDTAKVLSQYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEETNTFKGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           IG EP  E     L  A+  GA + + H+   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 IGYEPNEEIVKKALAIAKETGAEIEILHNPELAVNEADFIYTDVWMSMGQEGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DGP+S+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINNELVKHAKQTYRFLHCLPAHREEEVTGEIIDGPKSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|293609260|ref|ZP_06691562.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827712|gb|EFF86075.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 306

 Score =  283 bits (724), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 142/295 (48%), Positives = 190/295 (64%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++S+  L+ I+E A ++K    +    +P  GKVL MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLRDLSTLELNRILERASELKKMQHDNKVYQPFVGKVLGMIFEKSSTRTRISFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +   GG  IFLS  + QLGR E I D+A+V+S  +D +++RT  H  +     Y+ VPVI
Sbjct: 64  INQFGGSAIFLSPRDTQLGRGEPIEDSARVISSMLDIVMIRTFGHDIVERFASYSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ++AD+ T+ EHR S++GK  +W GDGNN+ +S IE A    + L IA+P
Sbjct: 124 NGLTDDHHPCQLLADLQTYIEHRDSIEGKTVAWIGDGNNMCNSYIEAAHMMGFKLKIASP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQPF 244
            G EP+ E+L      G  V L+ +A  A   A  + TD W SM QE + +  E  F  F
Sbjct: 184 KGYEPKPEFL---AEFGHCVELYDNAEDAAVNADLIVTDVWASMGQEEEQKLREKAFADF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QVN  LMS+AHPD LFMHCLPAHRGEE+   +LD   +VV+DEAENRLH QKA++
Sbjct: 241 QVNEKLMSLAHPDCLFMHCLPAHRGEEISETMLDYKNAVVWDEAENRLHAQKALV 295


>gi|121997523|ref|YP_001002310.1| ornithine carbamoyltransferase [Halorhodospira halophila SL1]
 gi|254772727|sp|A1WUZ6|OTC_HALHL RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|121588928|gb|ABM61508.1| ornithine carbamoyltransferase [Halorhodospira halophila SL1]
          Length = 300

 Score =  282 bits (722), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 144/295 (48%), Positives = 185/295 (62%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L + S   +  ++  A ++++       ++PL G+VL M+FEK STRTRVSFE  
Sbjct: 2   RHFLTLRDCSVDEIHQLLRRATELRDMHRAGHLHQPLQGRVLGMVFEKSSTRTRVSFEAG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLS  + QLGR E + DTA+V+SR VDA+++RT  H  L     ++  PVI
Sbjct: 62  MAQLGGHALFLSPRDTQLGRGEPVEDTARVVSRMVDAVMIRTFGHDMLERFAGHSAAPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D  HPCQ++AD+ TF EHRG +  +  +W GDGNN+ HS IE A    + L+IA P
Sbjct: 122 NGLSDLCHPCQLLADLQTFTEHRGPITDRRVAWIGDGNNMCHSWIEAAGLLGFDLHIAAP 181

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREEHVFQPF 244
            G  P  + L      G  V +F DA  A +GA  V TD W SM QE  +A  E  F+ F
Sbjct: 182 PGYRPEADILALG---GDRVQVFDDAYAAAEGADLVTTDVWASMGQESEQAAREEAFRGF 238

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            V  SLM  A   ALFMHCLPAHRGEEV   VL+GPQSVV+DEAENRLH QKA+L
Sbjct: 239 CVTESLMECAGEQALFMHCLPAHRGEEVEAAVLEGPQSVVWDEAENRLHAQKALL 293


>gi|229146705|ref|ZP_04275071.1| Ornithine carbamoyltransferase [Bacillus cereus BDRD-ST24]
 gi|228636725|gb|EEK93189.1| Ornithine carbamoyltransferase [Bacillus cereus BDRD-ST24]
          Length = 316

 Score =  282 bits (722), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 136/302 (45%), Positives = 195/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTKEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR ET+ DTAKVLS+Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQMGRGETVSDTAKVLSQYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEETNTFKGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A+  GA + + H+   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 VGYEPNEEIVKKALAIAKETGAEIEVLHNPELAVNEADFIYTDVWMSMGQEGEEEKYSLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  +++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINNELVKHAKQTYRFLHCLPAHREEEVTGKIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|229047822|ref|ZP_04193402.1| Ornithine carbamoyltransferase [Bacillus cereus AH676]
 gi|228723614|gb|EEL74979.1| Ornithine carbamoyltransferase [Bacillus cereus AH676]
          Length = 316

 Score =  282 bits (722), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 137/302 (45%), Positives = 193/302 (63%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTKEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR ET+ DTAKVLS+Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQMGRGETVSDTAKVLSQYLDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEETNTFKGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A+  GA + + HD   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 VGYEPNEEIVKKALAIAKETGAEIEVLHDPELAVNEADFIYTDVWMSMGQEGEEEKYSLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L   A     F+HCLPAHR EEV  E++DGP S+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINNELAKHAKQTYRFLHCLPAHREEEVTGEIIDGPHSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|229577459|ref|YP_001173486.2| ornithine carbamoyltransferase [Pseudomonas stutzeri A1501]
          Length = 306

 Score =  282 bits (722), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 138/295 (46%), Positives = 193/295 (65%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L + +   L+ ++    ++K+  +     +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSLMDCTPQELNSLVRRGIELKDLRKRGVLFEPLKNRVLGMIFEKASTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I D+A V+SR +DA+++RT  HS L +    ++VPVI
Sbjct: 64  MIQLGGQAIFLSPRDTQLGRGEPISDSAIVMSRMLDAVMIRTFAHSTLTDFAANSSVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ T+ EHRGS+ GK  +W GDGNN+ ++ IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLMADMQTYHEHRGSIAGKTVAWIGDGNNMCNTYIEAAIQFDFRLKVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP  E L  A   G  V +  D  +A  GA+ + TD W SM QE + A     F+P+
Sbjct: 184 EGYEPDAELLARA---GERVQVLRDPREAAAGANLISTDVWASMGQEDEVAARLATFRPY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QVN +L+  A  D LFMHCLPAHRGEE+ +++LD P+S  +D+AENRLH QKA+L
Sbjct: 241 QVNRALLDCAAADVLFMHCLPAHRGEEISHDLLDDPRSAAWDQAENRLHVQKALL 295


>gi|51244289|ref|YP_064173.1| ornithine carbamoyltransferase [Desulfotalea psychrophila LSv54]
 gi|56404356|sp|Q6AR58|OTC_DESPS RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|50875326|emb|CAG35166.1| probable ornithine carbamoyltransferase [Desulfotalea psychrophila
           LSv54]
          Length = 303

 Score =  282 bits (722), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 142/302 (47%), Positives = 194/302 (64%), Gaps = 2/302 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           P H + L + +   ++ +I  A ++K        ++ L+GK +A+IFEKPSTRTRVSFE 
Sbjct: 2   PDHLSSLGDFTGEEIASLIARAIELKEERSRGIRHQQLAGKSVALIFEKPSTRTRVSFES 61

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           AM  LGG  +FLSG + QL R+E + D A+V+SRYVD IV+RT     + EL +YATVPV
Sbjct: 62  AMYGLGGQVLFLSGRDTQLSRSEPLKDMARVMSRYVDGIVVRTFGQEVVNELAQYATVPV 121

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALTD  HPCQI++DIMT  E +G+++     W GDGNN+ +S I+ AA+  + L +A 
Sbjct: 122 INALTDLHHPCQILSDIMTVIEKKGAIQDLKIVWVGDGNNMANSWIQAAAKLGFELILAC 181

Query: 185 PIGSEPRNEYLNWARNQGAS-VALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQ 242
           P G +P  E L  A+ +GA  + L  D   AV GA  +  D + SM QE +  E   +F 
Sbjct: 182 PEGYDPDAEILAAAQAEGAKPITLLRDPQTAVLGADVINVDVFASMGQESEQDERLKIFA 241

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            +QVN  +M+ A  DA+ +HCLPAHRGEE+  +VL+GPQ V FDEAEN++H  KAIL   
Sbjct: 242 SYQVNAEMMAKAADDAIVLHCLPAHRGEEITEDVLEGPQCVAFDEAENKMHMHKAILERF 301

Query: 303 FG 304
            G
Sbjct: 302 LG 303


>gi|108805675|ref|YP_645612.1| ornithine carbamoyltransferase [Rubrobacter xylanophilus DSM 9941]
 gi|108766918|gb|ABG05800.1| ornithine carbamoyltransferase [Rubrobacter xylanophilus DSM 9941]
          Length = 317

 Score =  282 bits (722), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 145/295 (49%), Positives = 188/295 (63%), Gaps = 1/295 (0%)

Query: 11  LSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLG 70
           L+  S   +  I++ A KIK   +     +PL G+ LAM+F+KPS RTRVSFEV M  LG
Sbjct: 23  LAEFSPQEVRLILDEAVKIKGLQKARIPYRPLRGRTLAMVFQKPSNRTRVSFEVGMYQLG 82

Query: 71  GDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTD 130
           G  + LS  E+Q+G+ E+  DT KVL+RY+DAI++RT +H+ L EL   A VPVIN LTD
Sbjct: 83  GHALSLSPQEIQMGKRESPSDTGKVLTRYIDAIMVRTFDHAELEELAAAAEVPVINGLTD 142

Query: 131 NTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEP 190
             HPCQ +AD++T  E  G V+G   ++ GDGNN+ HSL  G A     L+IA P G  P
Sbjct: 143 THHPCQALADLLTVREQFGRVEGTKIAYVGDGNNVAHSLAIGCALTGARLSIAHPEGHGP 202

Query: 191 RNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV-FQPFQVNLS 249
             + +  +   G    L  D  +AV GA  V+TD W SM QE +A E    F P+QV+  
Sbjct: 203 DGKVVRLSAELGEPPKLTQDPEEAVAGAQVVYTDVWASMGQEAEAEERRKRFAPYQVDER 262

Query: 250 LMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           LMS+A  DA+F+HCLPAHRGEEV   V+DGP+S VFD+AENRLH QKA+L    G
Sbjct: 263 LMSLAADDAIFLHCLPAHRGEEVAASVIDGPRSRVFDQAENRLHAQKALLYLLLG 317


>gi|311740488|ref|ZP_07714315.1| ornithine carbamoyltransferase [Corynebacterium pseudogenitalium
           ATCC 33035]
 gi|311304008|gb|EFQ80084.1| ornithine carbamoyltransferase [Corynebacterium pseudogenitalium
           ATCC 33035]
          Length = 306

 Score =  282 bits (722), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 143/303 (47%), Positives = 204/303 (67%), Gaps = 8/303 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRVSFEV 64
           +HF    ++S    + ++++A+++K   ++ F  +PL G K +A++F+K STRTR SFE 
Sbjct: 4   RHFLADDDLSPQEQATVLDLAERLK---KDPFAERPLEGPKTVAVLFDKTSTRTRFSFET 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           A+ ++GG  I +  S  Q+G+ E+  DTA VLSRYV+AIV RT +H  LL++ E ATVP+
Sbjct: 61  AVANMGGKGITVDTSTTQMGKGESYQDTAAVLSRYVEAIVWRTFDHDNLLQMAETATVPL 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLNIA 183
           +NAL+D+ HPCQI+AD++T  E+ G + GK   + GDG NN+ +S + G A     ++I 
Sbjct: 121 VNALSDDLHPCQILADLLTCRENLGELTGKKAVYLGDGDNNMANSYMIGFATAGMDVSII 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV-FQ 242
            P G +PR E+++ AR +G       D V  V+GA  V TDTWISM QE   R+    F 
Sbjct: 181 APEGFQPRQEFVDRARKRGNIT--ITDDVDEVEGADVVITDTWISMGQENDGRDRRTPFL 238

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           P+QV+ ++MS AH DA+F+HCLPA+RG EV  EV+DGPQS VFDEAENRLH QKA+L+W 
Sbjct: 239 PYQVDSTIMSKAHKDAIFLHCLPAYRGNEVTAEVIDGPQSRVFDEAENRLHAQKALLVWL 298

Query: 303 FGI 305
             I
Sbjct: 299 LEI 301


>gi|167044951|gb|ABZ09616.1| putative aspartate/ornithine carbamoyltransferase, carbamoyl-P
           binding domain protein [uncultured marine crenarchaeote
           HF4000_APKG8G2]
          Length = 304

 Score =  282 bits (722), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 150/305 (49%), Positives = 194/305 (63%), Gaps = 1/305 (0%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M    K    +  ISS     +I+ + K+K  ++ + E   L  K LAM+FEKPSTRTRV
Sbjct: 1   MKLKTKDLLTVDEISSKEFLELIDFSIKLKKENKTVKEKPLLKNKTLAMLFEKPSTRTRV 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFE+ M  LGG T+ LS +EMQ  R E++ DTAK LSRYVDAIV R   HS + +L ++A
Sbjct: 61  SFEIGMLQLGGHTVNLSLNEMQHSRGESVEDTAKTLSRYVDAIVARVYEHSFIEKLAKHA 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVIN L+++ HPCQ +AD+MT +EH+   K    +W GDGNN+ +SLI G ++    +
Sbjct: 121 TVPVINGLSNSYHPCQTLADLMTIKEHKKKFKDLKIAWIGDGNNVCNSLIFGCSKTQTQI 180

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            IATP G EP  E +  + ++   V L  D   AVK A  V TDT+ S++     R E  
Sbjct: 181 VIATPKGFEPNPEVVKKS-SKYTVVDLTTDPKSAVKDADIVMTDTFTSIHMSDPKRTEKF 239

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
              FQVN SLM  A  DA+FMHCLPA R +EV + V+DGPQSVV+DEAENRLHTQKA+LL
Sbjct: 240 LPSFQVNDSLMEKAKNDAIFMHCLPAKREQEVTSSVIDGPQSVVWDEAENRLHTQKALLL 299

Query: 301 WCFGI 305
               I
Sbjct: 300 SLLSI 304


>gi|228987323|ref|ZP_04147443.1| Ornithine carbamoyltransferase [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228772295|gb|EEM20741.1| Ornithine carbamoyltransferase [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
          Length = 316

 Score =  282 bits (722), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 137/302 (45%), Positives = 194/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +KN+ +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTKEEIISLIEFAIYLKNNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR ET+ DTAKVLS+Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQMGRGETVSDTAKVLSQYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEETNTFKGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           IG EP  E     L  A   GA + + H+   +V  A  ++TD W+SM QE +  +  +F
Sbjct: 188 IGYEPNEEIVKKALAIAEETGAKIEILHNPEVSVSEADFIYTDVWMSMGQEGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DG QS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINKELVKHAKQTYRFLHCLPAHREEEVTGEIIDGSQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|47568189|ref|ZP_00238893.1| ornithine carbamoyltransferase [Bacillus cereus G9241]
 gi|47555179|gb|EAL13526.1| ornithine carbamoyltransferase [Bacillus cereus G9241]
          Length = 316

 Score =  282 bits (722), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 137/302 (45%), Positives = 194/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +KN+ +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTQEEIISLIEFAIYLKNNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR ET+ DTAKVLS+Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQMGRGETVSDTAKVLSQYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E + + KG   ++ GDGNN+ HSL+  +A+    + +A P
Sbjct: 128 NGLTDDHHPCQALADLMTIYEEKNTFKGIKLAYVGDGNNVCHSLLLASAKVGMHMTVAMP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           IG EP  E     L  A   GA + + H+   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 IGYEPNEEIVKKALAIAEQTGAEIEILHNPELAVNEADFIYTDVWMSMGQEGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DG QS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINNELVKHAKQTYRFLHCLPAHREEEVTGEIIDGSQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|229093191|ref|ZP_04224309.1| Ornithine carbamoyltransferase [Bacillus cereus Rock3-42]
 gi|228690165|gb|EEL43959.1| Ornithine carbamoyltransferase [Bacillus cereus Rock3-42]
          Length = 316

 Score =  282 bits (722), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 136/302 (45%), Positives = 194/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +KN+ +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTQEEIISLIEFAIYLKNNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FL+G EMQ+GR ET+ DTAKVLS Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLNGKEMQMGRGETVSDTAKVLSHYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEETNTFKGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           IG EP  E     L  A+  GA + + H+   AV     ++ D W+SM QE +  +  +F
Sbjct: 188 IGYEPNEEIVKKALAIAKETGAEIEILHNPELAVNEVDFIYADVWMSMGQEGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L++ A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINKELVTHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|228947849|ref|ZP_04110136.1| Ornithine carbamoyltransferase [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|254721730|ref|ZP_05183519.1| ornithine carbamoyltransferase [Bacillus anthracis str. A1055]
 gi|228811836|gb|EEM58170.1| Ornithine carbamoyltransferase [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
          Length = 316

 Score =  282 bits (722), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 136/302 (45%), Positives = 194/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTQEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FL+G EMQ+GR ET+ DTAKVLS Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLNGKEMQMGRGETVSDTAKVLSHYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEETNTFKGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A+  GA + + H+   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 VGYEPNEEIVKKALAIAKETGAEIEILHNPELAVNEADFIYTDVWMSMGQEGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINKELVKHAKQTYHFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|196038864|ref|ZP_03106172.1| ornithine carbamoyltransferase [Bacillus cereus NVH0597-99]
 gi|196030587|gb|EDX69186.1| ornithine carbamoyltransferase [Bacillus cereus NVH0597-99]
          Length = 316

 Score =  282 bits (722), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 136/302 (45%), Positives = 194/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTQEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FL+G EMQ+GR ET+ DTAKVLS Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLNGKEMQMGRGETVSDTAKVLSHYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEETNTFKGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           IG EP  E     L  A+  GA + + H+   AV     ++TD W+SM QE +  +  +F
Sbjct: 188 IGYEPNEEIVKKALAIAKETGAEIEILHNPELAVNEVDFIYTDVWMSMGQEGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L++ A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINKELVTHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|229104735|ref|ZP_04235396.1| Ornithine carbamoyltransferase [Bacillus cereus Rock3-28]
 gi|228678608|gb|EEL32824.1| Ornithine carbamoyltransferase [Bacillus cereus Rock3-28]
          Length = 316

 Score =  282 bits (721), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 136/302 (45%), Positives = 195/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTKEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR ET+ DTAKVLS Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQIGRGETVSDTAKVLSHYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEEVNTFKGIKLAYVGDGNNVCHSLLLASAKVGMNMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A+  GA + + H+   AV+ A  ++TD W+SM Q+ +  +  +F
Sbjct: 188 VGYEPNEEIVKKALAIAKETGAEIEILHNPELAVQEADFIYTDVWMSMGQDGEVEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINKELVMHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|87119428|ref|ZP_01075325.1| ornithine carbamoyltransferase [Marinomonas sp. MED121]
 gi|86164904|gb|EAQ66172.1| ornithine carbamoyltransferase [Marinomonas sp. MED121]
          Length = 301

 Score =  282 bits (721), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 141/301 (46%), Positives = 194/301 (64%), Gaps = 6/301 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           P+HF  L++++S  L  ++  A ++K    +  + +PL  +V+AMIFEK STRTRVSFE 
Sbjct: 3   PRHFLTLTDLTSDELKQVLTRATELKKLHRDGTQYQPLKNRVMAMIFEKSSTRTRVSFEA 62

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M   GG  +FLS  + QLGR E I D+A+V+S  VDA+++RT  H ++    ++++VPV
Sbjct: 63  GMAQFGGHALFLSPRDTQLGRGEPIEDSARVISSMVDAVMIRTFEHEKIALFAKHSSVPV 122

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALTD+ HPCQ++AD+ T++EHRGS++GK   W GDGNN+ HS +  A   ++ L +A 
Sbjct: 123 INALTDDFHPCQLLADMQTYQEHRGSIQGKKVVWIGDGNNMCHSYMNAAHLLDFQLVVAC 182

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQP 243
           P G EP  E           + +  D   A   A  + TD + SM QE +       F  
Sbjct: 183 PKGYEPNAE---LTAKYADRITITQDVQVAATDADLIVTDVFASMGQEDEQDTRLKDFDG 239

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL--LW 301
           FQVN +LM++A+ DALFMHCLPAHRGEEV  EV+D P SVV+DEAENRLH QKA+L  L 
Sbjct: 240 FQVNEALMALANEDALFMHCLPAHRGEEVTAEVIDAPDSVVWDEAENRLHAQKALLEFLL 299

Query: 302 C 302
           C
Sbjct: 300 C 300


>gi|163941872|ref|YP_001646756.1| ornithine carbamoyltransferase [Bacillus weihenstephanensis KBAB4]
 gi|163864069|gb|ABY45128.1| ornithine carbamoyltransferase [Bacillus weihenstephanensis KBAB4]
          Length = 316

 Score =  282 bits (721), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 136/302 (45%), Positives = 194/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + + +     L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTQEEIISLIEFAIYLKKNKQELL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR E++ DTAKVLS Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQIGRGESVSDTAKVLSHYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEEVKTFKGIKLAYVGDGNNVCHSLLLASAKVGMNMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A   GA + + H+   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 VGYEPNEEIVKKALAIAEETGAEIEILHNPELAVSEADFIYTDVWMSMGQEGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINKELVMHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|94499421|ref|ZP_01305958.1| ornithine carbamoyltransferase [Oceanobacter sp. RED65]
 gi|94428175|gb|EAT13148.1| ornithine carbamoyltransferase [Oceanobacter sp. RED65]
          Length = 307

 Score =  282 bits (721), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 146/298 (48%), Positives = 199/298 (66%), Gaps = 8/298 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIK--NSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           P+H   L +++ + L  I   A ++K  + +  I+E  PL  KVL MIFEK STRTRVSF
Sbjct: 9   PRHLLTLLDLTPAELQHITSRATELKRMHRAGEIYE--PLKNKVLGMIFEKSSTRTRVSF 66

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E  +  LGG  IFLS  + QLGR E I D+AKVLSR  D I++RT  H  +   +  + V
Sbjct: 67  EAGIAQLGGSAIFLSPRDTQLGRGEPIEDSAKVLSRMCDIIMIRTFGHDIVENFSANSRV 126

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVINALTD+ HPCQ++AD+ T++EHRGS+KGK   W GDGNN+ HS I  A +F++ L +
Sbjct: 127 PVINALTDDFHPCQLLADMQTYQEHRGSIKGKTVVWVGDGNNMCHSYINAAKQFDFNLVV 186

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN-QEFKAREEHVF 241
             P G EP  E +   +++   V +  D  +A KGAH + TD W SM  +E +   E VF
Sbjct: 187 NCPEGFEPMAELMEANKDR---VKIIRDTKEAAKGAHLLVTDVWASMGQEEEQKEREKVF 243

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + +QV+ ++M +A  DALFMHCLPAHRGEE+ +++LD P+SVV+DEAENRLH QKA++
Sbjct: 244 KSYQVSPAVMDLADKDALFMHCLPAHRGEEISHDMLDDPRSVVWDEAENRLHAQKALM 301


>gi|226943522|ref|YP_002798595.1| ornithine carbamoyltransferase [Azotobacter vinelandii DJ]
 gi|226718449|gb|ACO77620.1| Ornithine carbamoyltransferase [Azotobacter vinelandii DJ]
          Length = 308

 Score =  282 bits (721), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 139/300 (46%), Positives = 197/300 (65%), Gaps = 4/300 (1%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           MM   +HF  L + +   L+ +I    ++K+        +PL  +VL MIFEK STRTR+
Sbjct: 1   MMMSARHFLSLMDCTPQELANLIRRGIELKDLRNGGALFEPLKNRVLGMIFEKASTRTRL 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFE  M  LGG  IFLS  + QL R E + DTA V+SR +DA+++RT +HS L    E +
Sbjct: 61  SFEAGMIQLGGQAIFLSPRDSQLNRGEPVSDTAIVMSRMLDAVMIRTFSHSTLRIFAENS 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
            +P+IN L+D+ HPCQ++AD+ TF E RGS++GK  +W GDGNN+ ++ IE A +F++ L
Sbjct: 121 RIPIINGLSDDLHPCQLLADMQTFHEQRGSIRGKTVAWIGDGNNMCNTYIEAAHQFDFQL 180

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            IA P G +P+ E++  A ++   V +  D  +AV GAH V TD W SM QE +  +   
Sbjct: 181 RIACPEGFDPQPEFIAIAPDR---VQIVRDPREAVAGAHLVSTDVWTSMGQETEEEDRLA 237

Query: 241 -FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+P+QV   L+ ++  D LFMHCLPAHRGEE+  ++LD P+SVV+D+AENRLH QKA+L
Sbjct: 238 RFKPYQVTGELLDLSADDVLFMHCLPAHRGEEISLDLLDDPRSVVWDQAENRLHAQKALL 297


>gi|229098600|ref|ZP_04229540.1| Ornithine carbamoyltransferase [Bacillus cereus Rock3-29]
 gi|229117626|ref|ZP_04246997.1| Ornithine carbamoyltransferase [Bacillus cereus Rock1-3]
 gi|228665805|gb|EEL21276.1| Ornithine carbamoyltransferase [Bacillus cereus Rock1-3]
 gi|228684679|gb|EEL38617.1| Ornithine carbamoyltransferase [Bacillus cereus Rock3-29]
          Length = 316

 Score =  281 bits (720), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 136/302 (45%), Positives = 195/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTKEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR ET+ DTAKVLS Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQIGRGETVSDTAKVLSHYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEEVNTFKGIKLAYVGDGNNVCHSLLLASAKVGMNMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A+  GA + + H+   AV+ A  ++TD W+SM Q+ +  +  +F
Sbjct: 188 VGYEPNEEIVKKALAIAKETGAEIEILHNPELAVQEADFIYTDVWMSMGQDGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINKELVMHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|167045396|gb|ABZ10051.1| putative aspartate/ornithine carbamoyltransferase, carbamoyl-P
           binding domain protein [uncultured marine crenarchaeote
           HF4000_APKG10F15]
          Length = 304

 Score =  281 bits (720), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 150/305 (49%), Positives = 194/305 (63%), Gaps = 1/305 (0%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M    K    +  ISS     +I+ + K+K  ++ + E   L  K LAM+FEKPSTRTRV
Sbjct: 1   MKLKTKDLLTVDEISSKEFLELIDFSIKLKKENKTVKEKPLLKNKTLAMLFEKPSTRTRV 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFE+ M  LGG T+ LS +EMQ  R E++ DTAK LSRYVDAIV R   HS + +L ++A
Sbjct: 61  SFEIGMLQLGGHTVNLSLNEMQHSRGESVEDTAKTLSRYVDAIVARVYEHSFIEKLAKHA 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVIN L+++ HPCQ +AD+MT +EH+   K    +W GDGNN+ +SLI G ++    +
Sbjct: 121 TVPVINGLSNSYHPCQTLADLMTIKEHKKKFKDLKIAWIGDGNNVCNSLIFGCSKTQTQI 180

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            IATP G EP  E +  + ++   V L  D   AVK A  V TDT+ S++     R E  
Sbjct: 181 VIATPKGFEPNPEVVKKS-SKYTVVDLTTDPKSAVKDADIVMTDTFTSIHMSDLKRTEKF 239

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
              FQVN SLM  A  DA+FMHCLPA R +EV + V+DGPQSVV+DEAENRLHTQKA+LL
Sbjct: 240 LPSFQVNDSLMEKAKNDAIFMHCLPAKREQEVTSSVIDGPQSVVWDEAENRLHTQKALLL 299

Query: 301 WCFGI 305
               I
Sbjct: 300 SLLSI 304


>gi|163789769|ref|ZP_02184206.1| ornithine carbamoyltransferase [Carnobacterium sp. AT7]
 gi|159874991|gb|EDP69058.1| ornithine carbamoyltransferase [Carnobacterium sp. AT7]
          Length = 317

 Score =  281 bits (720), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 148/307 (48%), Positives = 192/307 (62%), Gaps = 6/307 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
           Y K+   +++++   ++ +IE A  +K  ++    +  L GK L MIFEK STRTRVSFE
Sbjct: 9   YQKNILQVADLTEKEVTLLIEEAIVMKEQTKAGIPHLYLQGKTLGMIFEKSSTRTRVSFE 68

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M  LGG  +FLS  ++QLGR E+I DTAKVLSRYVD +++RT  H  + E  E +TVP
Sbjct: 69  VGMTQLGGHALFLSSKDIQLGRGESIADTAKVLSRYVDGLMIRTFGHEIIEEFAENSTVP 128

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNIL-HSLIEGAARFNYLLNI 182
           +IN LT+  HP Q++AD MT  E +G++KG   ++ GDGNN + HSL+EGAA     + I
Sbjct: 129 IINGLTNEHHPMQVLADFMTIYEKKGALKGLNLAYIGDGNNNMPHSLMEGAAIMGMNMTI 188

Query: 183 ATPIGSEPRNEYLN----WARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE 238
           A+P G EP           A   GAS+   +D V+AV  A  V TD W SM  E +  E 
Sbjct: 189 ASPKGYEPLEVIFKKVKIKAEQTGASIQFTYDPVEAVTNADIVVTDVWTSMGMEAEETER 248

Query: 239 HV-FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
              F P+QVN  L   A  D +F+HCLPAHRGEEV  EV+DG  SVVFDEAENRLH QKA
Sbjct: 249 TTHFLPYQVNAELTHHAKEDFIFLHCLPAHRGEEVTAEVIDGIHSVVFDEAENRLHAQKA 308

Query: 298 ILLWCFG 304
           +L    G
Sbjct: 309 VLKKLMG 315


>gi|126178949|ref|YP_001046914.1| ornithine carbamoyltransferase [Methanoculleus marisnigri JR1]
 gi|189036332|sp|A3CU82|OTC_METMJ RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|125861743|gb|ABN56932.1| ornithine carbamoyltransferase [Methanoculleus marisnigri JR1]
          Length = 309

 Score =  281 bits (720), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 134/296 (45%), Positives = 193/296 (65%), Gaps = 1/296 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K F  + +I    L  I+  A ++K        ++ L GK L MIFEK STRTRVSFEV 
Sbjct: 3   KDFLSILDIGEYELESIVADAVRLKRLKSAGTAHEFLRGKSLGMIFEKASTRTRVSFEVG 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FL+  +MQLGR E I DTA+VL+RYVDA+++R  +H+ + E   YA VPV+
Sbjct: 63  MSDLGGHALFLNPQDMQLGRGEEIRDTARVLARYVDAVMIRAYSHAAIEEFARYANVPVV 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D  HPCQ++ADIMT  E  G + G   +W GDGNN+ +S +  +A     + +A+P
Sbjct: 123 NGLSDRLHPCQVLADIMTLSERFGDLHGLKLAWVGDGNNVCNSWLLSSALTGMEIAVASP 182

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREEHVFQPF 244
               PR+E ++ AR  G  V +  D  +AV+ A  ++TD W+SM +++ +A      + +
Sbjct: 183 PRYRPRDEIVDQARAAGGKVTVVTDPDEAVRDADVLYTDIWVSMGDEQERAERLQALKGY 242

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
            ++  L++ A PDAL MHCLPAHRGEE+ +EV++GPQS+V+D+AENRLH QKA+L+
Sbjct: 243 TIDSRLLAQASPDALVMHCLPAHRGEEITDEVMEGPQSIVWDQAENRLHAQKALLV 298


>gi|225016572|ref|ZP_03705764.1| hypothetical protein CLOSTMETH_00479 [Clostridium methylpentosum
           DSM 5476]
 gi|224950681|gb|EEG31890.1| hypothetical protein CLOSTMETH_00479 [Clostridium methylpentosum
           DSM 5476]
          Length = 301

 Score =  281 bits (720), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 137/301 (45%), Positives = 194/301 (64%), Gaps = 3/301 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH   L ++S   ++ ++++A K+K  +++  E+  L GK L MIF+K STRTRVSFE  
Sbjct: 2   KHLLKLLDLSKEEITELLDLADKLKFENKHGIEHHLLKGKTLGMIFQKSSTRTRVSFETG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLS +++Q+GR E + DTA+VLSRY+D I++RT     + +L EY ++P+I
Sbjct: 62  MVQLGGYPLFLSSNDLQIGRGEPVQDTARVLSRYLDGIMIRTFAQQEVEDLAEYGSIPII 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ++AD+ T  EH+GS  G    + GDGNN+ +SLI G  +    + +A P
Sbjct: 122 NGLTDFCHPCQVLADLQTIREHKGSFDGLKMCYIGDGNNMANSLIVGGLKVGMQVAVACP 181

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH-VFQP- 243
            G EP  + L +A+ QG    L  D  QA + A  +FTD W SM QE +A +   VF+  
Sbjct: 182 KGYEPDEQVLAFAKEQGG-FTLTEDPKQAAQDADVLFTDVWASMGQEGEAEKRRAVFEGI 240

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +Q+N  L++ AHPDA+  HCLPAHRGEE+  EV +     +FDEAENRLH QKA+L+   
Sbjct: 241 YQINDELLAAAHPDAMVQHCLPAHRGEEITAEVFEAHAQEIFDEAENRLHAQKAVLVKLL 300

Query: 304 G 304
           G
Sbjct: 301 G 301


>gi|92114252|ref|YP_574180.1| ornithine carbamoyltransferase [Chromohalobacter salexigens DSM
           3043]
 gi|122419725|sp|Q1QVM7|OTC_CHRSD RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|91797342|gb|ABE59481.1| ornithine carbamoyltransferase [Chromohalobacter salexigens DSM
           3043]
          Length = 305

 Score =  281 bits (720), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 147/296 (49%), Positives = 190/296 (64%), Gaps = 5/296 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFEN-KPLSGKVLAMIFEKPSTRTRVSFEV 64
           +HF  L +++   LS +I+ A  IKN  +       P S + LAM FEK STRTRVSFE 
Sbjct: 4   RHFLTLLDLTPEELSHLIQRAITIKNRLKAQGPTYTPFSNRTLAMFFEKSSTRTRVSFET 63

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           AM H GG  +FLS  + QLGR E IGDTA+VL+  VD +++RT +H+ L E    + VPV
Sbjct: 64  AMAHFGGHALFLSPRDTQLGRGEPIGDTARVLAEMVDIVMIRTFSHAGLEEYAAASAVPV 123

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALTD+ HPCQ++AD+MT+ E RGSVKGK   W GDGNN+ HS I  A +F++ L +  
Sbjct: 124 INALTDDYHPCQLLADVMTWTECRGSVKGKTAVWIGDGNNMCHSWINAARQFDFRLRVCC 183

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQ-EFKAREEHVFQP 243
           P G EP  + +  A   G  V + HD  QAV+GA  V TD W SM Q E +AR E  F  
Sbjct: 184 PPGYEPDADIVAAA---GERVEILHDPRQAVQGADLVTTDVWASMGQEEEQARRERDFAG 240

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           FQV   L+  A  + LF+HCLPAHRGEE+   +LD P++ V+ EA NRLH QKA++
Sbjct: 241 FQVTEKLLDHAADNVLFLHCLPAHRGEEISTTLLDDPRAAVWQEAGNRLHAQKALI 296


>gi|197119998|ref|YP_002140425.1| ornithine carbamoyltransferase [Geobacter bemidjiensis Bem]
 gi|197089358|gb|ACH40629.1| ornithine carbamoyltransferase [Geobacter bemidjiensis Bem]
          Length = 303

 Score =  281 bits (719), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 138/296 (46%), Positives = 191/296 (64%), Gaps = 2/296 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F  LS  S + L  I  + K++K   +   E+  L GK LAMIFEK STRTR+SFE+ 
Sbjct: 3   RDFLALSQFSKAELDAIFLLTKELKEKQKKGVEHHLLKGKSLAMIFEKSSTRTRLSFEIG 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +F+S  + Q+GR E I DTA+V++RY D +++RT     + E  +YA+VP+I
Sbjct: 63  MYQLGGHPLFISSKDSQMGRGEPIKDTARVMARYCDGVMIRTFAQETVEEFAKYASVPII 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQI+ADI T  EHRG  +G  F+W GDGNN+ +S IE AA F + L +A P
Sbjct: 123 NGLTDLHHPCQIMADIFTVIEHRGGYQGLKFAWIGDGNNMANSWIEAAAIFGFDLTLACP 182

Query: 186 IGSEPRNEYLNWARNQGAS-VALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQP 243
            G +P  + L WA+   +S + +  D   A + A  + TD W SM QE + +  E  F  
Sbjct: 183 EGYDPNPQVLEWAQKHASSKIVVTRDPKVAAQDADVLNTDVWASMGQEEEQKIREKAFAG 242

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           FQ+N  L+ +A  +A+ +HCLPAHRGEE+ ++V++GP S V+DEAENRLH QKAI+
Sbjct: 243 FQLNEELLDLAKGNAMVLHCLPAHRGEEITDDVIEGPHSAVWDEAENRLHVQKAIM 298


>gi|229198259|ref|ZP_04324966.1| Ornithine carbamoyltransferase [Bacillus cereus m1293]
 gi|228585138|gb|EEK43249.1| Ornithine carbamoyltransferase [Bacillus cereus m1293]
          Length = 316

 Score =  281 bits (719), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 137/302 (45%), Positives = 194/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTKEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR ET+ DTAKVLS+Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQMGRGETVSDTAKVLSQYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEETNTFKGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           IG EP  E     L  A+  GA + + H+   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 IGYEPNEEIVKKALAIAKETGAEIEILHNPELAVNEADFIYTDVWMSMGQEGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DG QS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINNELVKHAKQTYRFLHCLPAHREEEVTGEIIDGSQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|228909962|ref|ZP_04073783.1| Ornithine carbamoyltransferase [Bacillus thuringiensis IBL 200]
 gi|228849797|gb|EEM94630.1| Ornithine carbamoyltransferase [Bacillus thuringiensis IBL 200]
          Length = 316

 Score =  281 bits (719), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 136/302 (45%), Positives = 193/302 (63%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTKEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR E++ DTAKVLS+Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQMGRGESVSDTAKVLSQYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+   A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEETNTFKGIKLAYVGDGNNVCHSLLLAIAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A+  GA + + HD   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 VGYEPNEEIVKKALAIAKETGAEIEVLHDPELAVNEADFIYTDVWMSMGQEGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DGP S+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINNELVKHAKQTYRFLHCLPAHREEEVTGEIIDGPHSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|229075836|ref|ZP_04208812.1| Ornithine carbamoyltransferase [Bacillus cereus Rock4-18]
 gi|228707151|gb|EEL59348.1| Ornithine carbamoyltransferase [Bacillus cereus Rock4-18]
          Length = 316

 Score =  281 bits (719), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 135/302 (44%), Positives = 195/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTKEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR ET+ DTAKVLS Y+D I++RT +H+ + EL + +++PV+
Sbjct: 68  MVQLGGHGMFLSGKEMQIGRGETVSDTAKVLSHYIDGIMIRTFSHADVEELAKESSIPVV 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEEVNTFKGIKLAYVGDGNNVCHSLLLASAKVGMNMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A+  GA + + H+   AV+ A  ++TD W+SM Q+ +  +  +F
Sbjct: 188 VGYEPNEEIVKKALAIAKETGAEIEILHNPELAVQEADFIYTDVWMSMGQDGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINKELVMHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|146297227|ref|YP_001180998.1| ornithine carbamoyltransferase [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|189036317|sp|A4XLM2|OTC_CALS8 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|145410803|gb|ABP67807.1| ornithine carbamoyltransferase [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 308

 Score =  281 bits (719), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 140/308 (45%), Positives = 208/308 (67%), Gaps = 8/308 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L+ ++   +  ++++A ++K+  +  F    L  K L +IF K STRTRVSFEV 
Sbjct: 2   RHFLSLNELTKDEILYLVDLACRLKSEVKRGFFFPYLKHKALGLIFTKASTRTRVSFEVG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG +++LS +++QLGR ETI DTAKVLSRY+D IV+RT   S + E  +Y+++PVI
Sbjct: 62  INQLGGYSLYLSKNDLQLGRGETIEDTAKVLSRYLDLIVIRTYAQSEVEEFAKYSSIPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HP QIIAD  T  E +G +K    ++ GDGNN+  +L+ GA++    + +ATP
Sbjct: 122 NGLTDDYHPTQIIADFQTIFEEKGRLKDLKIAYIGDGNNVAATLLVGASKLGLDIAVATP 181

Query: 186 IGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV- 240
            G E + E +++A+++    G+++    +  +AVK A  V+TDTW+SM QE + +E+ + 
Sbjct: 182 KGYEIKKEVVDFAKDEAKRSGSNLIFTDNPKEAVKDADVVYTDTWVSMGQE-EEKEKRIK 240

Query: 241 -FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ +QV   LM +A  DA+F+HCLPA+RG EV  EV+DGPQS VFDEAENRLH  KAI+
Sbjct: 241 DFEGYQVTQELMKLAKEDAIFLHCLPAYRGFEVTPEVIDGPQSKVFDEAENRLHAHKAIM 300

Query: 300 LW-CFGII 306
           ++ C G I
Sbjct: 301 VFVCLGRI 308


>gi|229163068|ref|ZP_04291024.1| Ornithine carbamoyltransferase [Bacillus cereus R309803]
 gi|228620474|gb|EEK77344.1| Ornithine carbamoyltransferase [Bacillus cereus R309803]
          Length = 316

 Score =  281 bits (719), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 136/302 (45%), Positives = 194/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTQEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR E++ DTAKVLS Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQIGRGESVSDTAKVLSHYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEEVKTFKGVKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A   GA + + H+   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 VGYEPNEEIVKKALMIAEETGAKIEILHNPELAVHEADFIYTDVWMSMGQEGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L++ A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINKELVTHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|189426198|ref|YP_001953375.1| ornithine carbamoyltransferase [Geobacter lovleyi SZ]
 gi|189422457|gb|ACD96855.1| ornithine carbamoyltransferase [Geobacter lovleyi SZ]
          Length = 303

 Score =  281 bits (719), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 136/296 (45%), Positives = 192/296 (64%), Gaps = 2/296 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L + +   L  ++ +A  +K   +N  E+  L GK LAMIFEK STRTR+SFEV 
Sbjct: 3   RHFLALHDFTRQELDAMLALAADLKQKQKNGVEHHLLKGKTLAMIFEKASTRTRISFEVG 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  +F+S +  Q+GR E I D+A+V++RY D +++RT     + E   Y+ VPVI
Sbjct: 63  IYQLGGHGLFISSANSQMGRGEPIKDSARVMARYCDGVMIRTFGQEIVDEFARYSDVPVI 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQI+AD+ T  E +G  +G  F+W GDGNN+ ++ IE AA F + L +A P
Sbjct: 123 NGLTDLFHPCQIMADLQTVIEQKGGYQGLKFAWVGDGNNMANTWIEAAAIFGFDLALACP 182

Query: 186 IGSEPRNEYLNWARNQG-ASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EHVFQP 243
            G EP      WA+ QG A++++  D  +AV+ A  + TD W SM QE + ++ E  FQ 
Sbjct: 183 QGYEPDRHVWEWAQKQGTATISITEDPEEAVRDADVINTDVWASMGQESEQKQREFAFQG 242

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + VN  L++ A PD++ +HCLPAHRGEE+   V++G  SVV+DEAENRLH QKAI+
Sbjct: 243 YCVNDELLAAARPDSIVLHCLPAHRGEEISESVIEGKHSVVWDEAENRLHIQKAIM 298


>gi|167045194|gb|ABZ09854.1| putative aspartate/ornithine carbamoyltransferase, Asp/Orn binding
           domain protein [uncultured marine crenarchaeote
           HF4000_APKG8O8]
          Length = 270

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 181/269 (67%), Gaps = 2/269 (0%)

Query: 38  ENKPL-SGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVL 96
           + KPL   K +AMIFEKPSTRTRVSFE+ M  LGG T+ LS  +MQ  R E++GDTAK L
Sbjct: 3   KGKPLLENKTIAMIFEKPSTRTRVSFEIGMLQLGGHTVNLSLDQMQHSRGESVGDTAKTL 62

Query: 97  SRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLF 156
           SRYVDAIV R   HS + +L +YAT+PVIN L+++ HPCQ +AD+MT +EH+   KG   
Sbjct: 63  SRYVDAIVARVYEHSFIEDLAKYATIPVINGLSNSYHPCQTLADMMTIKEHKKKFKGLKI 122

Query: 157 SWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVK 216
           +W GDGNN+ +SLI G ++    + IATP G EP +E +  A ++   V L  D   A+K
Sbjct: 123 AWIGDGNNVCNSLILGCSKTQTEIAIATPKGFEPNSEVVKKA-SKSTVVELTADPKSAIK 181

Query: 217 GAHCVFTDTWISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEV 276
            A  V TDT+ S++     + E     FQVN SLM  A  DA+FMHCLPA R +EV  EV
Sbjct: 182 DADIVMTDTFTSIHTSDPKQAEKFLPSFQVNESLMKQAKNDAIFMHCLPAKRDQEVTTEV 241

Query: 277 LDGPQSVVFDEAENRLHTQKAILLWCFGI 305
           +DGPQSVV+DEAENRLHTQKA+L     I
Sbjct: 242 IDGPQSVVWDEAENRLHTQKALLASLLSI 270


>gi|312135339|ref|YP_004002677.1| ornithine carbamoyltransferase [Caldicellulosiruptor owensensis OL]
 gi|311775390|gb|ADQ04877.1| ornithine carbamoyltransferase [Caldicellulosiruptor owensensis OL]
          Length = 308

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 135/304 (44%), Positives = 207/304 (68%), Gaps = 7/304 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L+++S  ++  ++E+A ++K  ++  F    L  K L +IF K STRTRVSFEV 
Sbjct: 2   RHFLHLNDLSKEDILYLVELASRLKKEAKKGFYFPYLKNKALGLIFTKASTRTRVSFEVG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG +++L  +++QLGR ETI DTAKVLSRY+D IV+RT     + E  +Y+++PVI
Sbjct: 62  IHQLGGYSLYLGKNDLQLGRGETIEDTAKVLSRYLDLIVIRTYEQKEVEEFAKYSSIPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HP QIIAD  T  E +G +     ++ GDGNN+  +L+ GA++    + +ATP
Sbjct: 122 NGLTDDYHPTQIIADFQTIFEEKGRLSNLKIAYVGDGNNVAATLLVGASKLGLDIAVATP 181

Query: 186 IGSEPRNEYLNWARNQG----ASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV- 240
            G E + E +++A ++     ++V   +   +AVK A  V+TDTW+SM QE + +E+ + 
Sbjct: 182 AGYEIKKEVVDFALDEAKKSKSNVIFTNSPKEAVKDADVVYTDTWVSMGQE-EEKEKRIR 240

Query: 241 -FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ +QV+ SL+ +A  DA+F+HCLPA+RG EV +EV+DGPQS VF+EAENRLH+ KAI+
Sbjct: 241 DFEGYQVDSSLLRLAKDDAIFLHCLPAYRGFEVTSEVIDGPQSRVFEEAENRLHSHKAIM 300

Query: 300 LWCF 303
           ++ +
Sbjct: 301 IFVY 304


>gi|302871663|ref|YP_003840299.1| ornithine carbamoyltransferase [Caldicellulosiruptor obsidiansis
           OB47]
 gi|302574522|gb|ADL42313.1| ornithine carbamoyltransferase [Caldicellulosiruptor obsidiansis
           OB47]
          Length = 308

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 137/303 (45%), Positives = 205/303 (67%), Gaps = 7/303 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L+++S  ++  ++E+A ++K  ++  F    L  K L +IF K STRTRVSFEV 
Sbjct: 2   RHFLHLNDLSKEDILYLVELASRLKKEAKKGFYFPYLKNKALGLIFTKASTRTRVSFEVG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG +++L  +++QLGR ETI DTAKVLSRY+D IV+RT     + E  +Y+++PVI
Sbjct: 62  IHQLGGYSLYLGKNDLQLGRGETIEDTAKVLSRYLDLIVIRTYEQKEVEEFAKYSSIPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HP QIIAD  T  E +G +     ++ GDGNN+  +L+ GAA+    + IATP
Sbjct: 122 NGLTDDYHPTQIIADFQTIFEEKGRLSNLKIAYVGDGNNVAATLLVGAAKLGLDIAIATP 181

Query: 186 IGSEPRNEYLNWARNQG----ASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV- 240
            G E + E +++A ++     ++V    +  +AVK A  V+TDTW+SM QE + +E+ + 
Sbjct: 182 PGYEIKKEVVDFALDEAKKNKSNVIFTENPKEAVKDADVVYTDTWVSMGQE-EEKEKRIR 240

Query: 241 -FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ +QV+ SL+ +A  DA+F+HCLPA+RG EV ++V+DGPQS VFDEAENRLH  KAI+
Sbjct: 241 DFEGYQVDSSLLRLAKDDAIFLHCLPAYRGFEVTSDVIDGPQSRVFDEAENRLHAHKAIM 300

Query: 300 LWC 302
           ++ 
Sbjct: 301 IFV 303


>gi|42783245|ref|NP_980492.1| ornithine carbamoyltransferase [Bacillus cereus ATCC 10987]
 gi|56404384|sp|Q731G7|OTC_BACC1 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|42739173|gb|AAS43100.1| ornithine carbamoyltransferase [Bacillus cereus ATCC 10987]
          Length = 316

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 136/302 (45%), Positives = 194/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTKEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR ET+ DTAKVLS+Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQMGRGETVSDTAKVLSQYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEEINTFKGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           IG EP  +     L  A   GA + + H+   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 IGYEPNEKIVKKALAIAEETGAEIEILHNPELAVSEADFIYTDVWMSMGQEGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DGP+S+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINKELVKHAKQTYRFLHCLPAHREEEVTGEIIDGPKSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|156743016|ref|YP_001433145.1| ornithine carbamoyltransferase [Roseiflexus castenholzii DSM 13941]
 gi|156234344|gb|ABU59127.1| ornithine carbamoyltransferase [Roseiflexus castenholzii DSM 13941]
          Length = 313

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 141/311 (45%), Positives = 195/311 (62%), Gaps = 11/311 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK------PLSGKVLAMIFEKPSTRTR 59
           +HF   ++++ + +  +++ A+ +K    N    +      PL GK LA++FEKPS RTR
Sbjct: 3   RHFLSAADLTRAEVEALLDRAQTLKAEWRNGGHPRDANGALPLQGKTLALVFEKPSLRTR 62

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           V+FE  M  LGG   +LS +++ +G  E++ D A+ LSR+V AI  R   H+ +  L  Y
Sbjct: 63  VAFEAGMTQLGGHGSYLSANDIDMGGRESVPDVARNLSRWVQAIAARVFRHATVETLARY 122

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ATVPVINAL+D  HPCQ +AD++T  EH G ++G   ++ GDGNN+ HSL+   A     
Sbjct: 123 ATVPVINALSDREHPCQALADMLTLHEHYGRLEGLTLAYVGDGNNVAHSLMLLGATLGVN 182

Query: 180 LNIATPIGSEPRNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK- 234
           + I  P+   P  E L  A      +G SV +    V+AV GA  V+TD W SM QE + 
Sbjct: 183 VRIGCPLDYRPDPEILALAERRAIERGVSVEVTPSPVEAVLGADAVYTDVWTSMGQEHEA 242

Query: 235 AREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHT 294
           AR   VFQP+QVN +LM+ A   ALFMHCLPAHRGEEV  +V+DGPQSVVF++AENRLH 
Sbjct: 243 ARRRPVFQPYQVNAALMTHARSGALFMHCLPAHRGEEVTPDVIDGPQSVVFEQAENRLHV 302

Query: 295 QKAILLWCFGI 305
           QKA++L   G+
Sbjct: 303 QKALILTLLGL 313


>gi|289208130|ref|YP_003460196.1| ornithine carbamoyltransferase [Thioalkalivibrio sp. K90mix]
 gi|288943761|gb|ADC71460.1| ornithine carbamoyltransferase [Thioalkalivibrio sp. K90mix]
          Length = 304

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 141/297 (47%), Positives = 190/297 (63%), Gaps = 5/297 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSE-NIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
           P+H+    ++S+     ++E A ++K  +      +  L GK L MIFEK STRTRVSFE
Sbjct: 3   PRHYLSFHDLSADETRALLERAVELKRQTHAGEHHDDILRGKTLGMIFEKSSTRTRVSFE 62

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M+ LGG+ +FLS  + QLGR E I DTA+VLSR VD +++RT  H ++    ++++VP
Sbjct: 63  VGMQQLGGNALFLSPRDTQLGRGEPIEDTARVLSRMVDCVMIRTYEHEKIELFAQHSSVP 122

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HP Q++AD+ T+ EHRG ++GK  +W GDGNN+ HS +  A   ++ L  A
Sbjct: 123 VINGLTDREHPAQLLADLQTYLEHRGDIRGKRVAWIGDGNNMCHSYMYAAHLLDFQLVAA 182

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREEHVFQ 242
            P G +P  + +   R+      L  DA  A +GA  V TD W SM QE  K+     F 
Sbjct: 183 CPEGYDPEEDVVGATRDH---FELTRDARAAAEGADLVVTDVWASMGQEQEKSARRRAFA 239

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F V+  LM +A+ DALFMHCLPAHR EEV  EVL+GPQSVV+DEAENRLH QKA++
Sbjct: 240 GFFVDADLMRLANDDALFMHCLPAHREEEVSTEVLEGPQSVVWDEAENRLHAQKALM 296


>gi|261409620|ref|YP_003245861.1| ornithine carbamoyltransferase [Paenibacillus sp. Y412MC10]
 gi|329928726|ref|ZP_08282575.1| ornithine carbamoyltransferase [Paenibacillus sp. HGF5]
 gi|261286083|gb|ACX68054.1| ornithine carbamoyltransferase [Paenibacillus sp. Y412MC10]
 gi|328937507|gb|EGG33925.1| ornithine carbamoyltransferase [Paenibacillus sp. HGF5]
          Length = 318

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 133/296 (44%), Positives = 192/296 (64%), Gaps = 5/296 (1%)

Query: 10  DLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHL 69
           +L   S+  +  +++ A +IK   +N    +PL GK + +IFEK STRTRVSFE  M  L
Sbjct: 19  ELDEYSTEEIQFLLDSAIEIKRKQKNGEVYQPLKGKTIGLIFEKSSTRTRVSFEAGMFQL 78

Query: 70  GGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALT 129
           GG  +FLS +++QLGR E I DTA+V+SRY+D +++RT  H  ++ L +YA++PVIN L+
Sbjct: 79  GGHALFLSKNDIQLGRGEPISDTAQVMSRYLDGLMIRTFGHDNVVNLAKYASIPVINGLS 138

Query: 130 DNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSE 189
           D  HPCQ++AD+ T  EH+G +KG   ++ GDGNN+ HSL+ G A+    + +A+P G E
Sbjct: 139 DMAHPCQVLADLQTVLEHKGKLKGLKMAFIGDGNNMAHSLLIGGAKMGMHVAVASPKGYE 198

Query: 190 PRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMN-QEFKAREEHVFQPF 244
                +      A   G  + +  D ++A K A  ++TD W SM  +E +A+ E  F  +
Sbjct: 199 ADASIVKLSEEIAAQTGGKITITQDPLEAAKDADVIYTDVWASMGFEEEQAQREAAFADY 258

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           QVN  L+  A PD LF+HCLPAHRGEEV   V+DG  SV+FD+AENRLH QKA+++
Sbjct: 259 QVNEELVKAAKPDYLFLHCLPAHRGEEVSEGVIDGANSVIFDQAENRLHAQKALMV 314


>gi|50084545|ref|YP_046055.1| ornithine carbamoyltransferase [Acinetobacter sp. ADP1]
 gi|56404363|sp|Q6FCH8|OTC_ACIAD RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|49530521|emb|CAG68233.1| ornithine carbamoyltransferase [Acinetobacter sp. ADP1]
          Length = 306

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 138/295 (46%), Positives = 191/295 (64%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++SS  L+ I++ A ++K         +P  GKVL MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLRDLSSLELNSILDRASELKRQQHANQVYQPFKGKVLGMIFEKSSTRTRISFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +   GG  IFLS  + QLGR E I D+A+V+S  +D +++RT  H+ +     ++ VPVI
Sbjct: 64  ICQFGGSAIFLSPRDTQLGRGEPIEDSARVISSMLDIVMIRTFGHNIVERFASFSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ++AD+ T++EHRGS+KGK  +W GDGNN+ +S +E A    + L + +P
Sbjct: 124 NGLTDDHHPCQLLADLQTYQEHRGSIKGKTVAWIGDGNNMCNSYMEAAHMMGFKLKVGSP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQPF 244
            G EP+ E+L         V +F+ A  A   A  + TD W SM QE + +  E  F  F
Sbjct: 184 KGYEPKPEFL---AEFAHCVEVFNSAEDAAVNADLIVTDVWASMGQEEEQKLREKAFLTF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QVN +LM++AHP+ LFMHCLPAHRGEE+   +LD   SVV+DEAENRLH QKA++
Sbjct: 241 QVNEALMALAHPECLFMHCLPAHRGEEISENMLDHKNSVVWDEAENRLHAQKALM 295


>gi|30264206|ref|NP_846583.1| ornithine carbamoyltransferase [Bacillus anthracis str. Ames]
 gi|47529646|ref|YP_020995.1| ornithine carbamoyltransferase [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49187034|ref|YP_030286.1| ornithine carbamoyltransferase [Bacillus anthracis str. Sterne]
 gi|65321520|ref|ZP_00394479.1| COG0078: Ornithine carbamoyltransferase [Bacillus anthracis str.
           A2012]
 gi|165871200|ref|ZP_02215850.1| ornithine carbamoyltransferase [Bacillus anthracis str. A0488]
 gi|167633682|ref|ZP_02392006.1| ornithine carbamoyltransferase [Bacillus anthracis str. A0442]
 gi|167639559|ref|ZP_02397830.1| ornithine carbamoyltransferase [Bacillus anthracis str. A0193]
 gi|170687224|ref|ZP_02878442.1| ornithine carbamoyltransferase [Bacillus anthracis str. A0465]
 gi|170705919|ref|ZP_02896382.1| ornithine carbamoyltransferase [Bacillus anthracis str. A0389]
 gi|177652729|ref|ZP_02935145.1| ornithine carbamoyltransferase [Bacillus anthracis str. A0174]
 gi|190565925|ref|ZP_03018844.1| ornithine carbamoyltransferase [Bacillus anthracis Tsiankovskii-I]
 gi|227816907|ref|YP_002816916.1| ornithine carbamoyltransferase [Bacillus anthracis str. CDC 684]
 gi|229600698|ref|YP_002868429.1| ornithine carbamoyltransferase [Bacillus anthracis str. A0248]
 gi|254683895|ref|ZP_05147755.1| ornithine carbamoyltransferase [Bacillus anthracis str. CNEVA-9066]
 gi|254736242|ref|ZP_05193948.1| ornithine carbamoyltransferase [Bacillus anthracis str. Western
           North America USA6153]
 gi|254744132|ref|ZP_05201815.1| ornithine carbamoyltransferase [Bacillus anthracis str. Kruger B]
 gi|254754087|ref|ZP_05206122.1| ornithine carbamoyltransferase [Bacillus anthracis str. Vollum]
 gi|254758221|ref|ZP_05210248.1| ornithine carbamoyltransferase [Bacillus anthracis str. Australia
           94]
 gi|32699430|sp|Q81M99|OTC_BACAN RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|259515585|sp|C3P7R4|OTC_BACAA RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|259515588|sp|C3LJQ5|OTC_BACAC RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|30258851|gb|AAP28069.1| ornithine carbamoyltransferase [Bacillus anthracis str. Ames]
 gi|47504794|gb|AAT33470.1| ornithine carbamoyltransferase [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49180961|gb|AAT56337.1| ornithine carbamoyltransferase [Bacillus anthracis str. Sterne]
 gi|164713119|gb|EDR18646.1| ornithine carbamoyltransferase [Bacillus anthracis str. A0488]
 gi|167512618|gb|EDR87993.1| ornithine carbamoyltransferase [Bacillus anthracis str. A0193]
 gi|167531088|gb|EDR93775.1| ornithine carbamoyltransferase [Bacillus anthracis str. A0442]
 gi|170129459|gb|EDS98323.1| ornithine carbamoyltransferase [Bacillus anthracis str. A0389]
 gi|170668841|gb|EDT19586.1| ornithine carbamoyltransferase [Bacillus anthracis str. A0465]
 gi|172082064|gb|EDT67132.1| ornithine carbamoyltransferase [Bacillus anthracis str. A0174]
 gi|190562844|gb|EDV16810.1| ornithine carbamoyltransferase [Bacillus anthracis Tsiankovskii-I]
 gi|227005020|gb|ACP14763.1| ornithine carbamoyltransferase [Bacillus anthracis str. CDC 684]
 gi|229265106|gb|ACQ46743.1| ornithine carbamoyltransferase [Bacillus anthracis str. A0248]
          Length = 316

 Score =  280 bits (717), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 135/302 (44%), Positives = 194/302 (64%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTQEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FL+G EMQ+GR ET+ DTAKVLS Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLNGKEMQMGRGETVSDTAKVLSHYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEETNTFKGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G +P  E     L  A+  GA + + H+   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 VGYKPNEEIVKKALAIAKETGAEIEILHNPELAVNEADFIYTDVWMSMGQEGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINKELVKHAKQTYHFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|118581573|ref|YP_902823.1| ornithine carbamoyltransferase [Pelobacter propionicus DSM 2379]
 gi|189036336|sp|A1ATU5|OTC_PELPD RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|118504283|gb|ABL00766.1| ornithine carbamoyltransferase [Pelobacter propionicus DSM 2379]
          Length = 305

 Score =  280 bits (717), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 141/301 (46%), Positives = 190/301 (63%), Gaps = 2/301 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L + +   L  ++ +A ++K   +   E+  L GK LAMIF+K STRTR+SFEV 
Sbjct: 3   RHFLSLHDYTKEELDRLLALAIELKQEQKQGGEHHLLKGKTLAMIFDKSSTRTRISFEVG 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  +F+S    Q+GR E + DTA+VLSRY D I++RT     + EL  YATVPVI
Sbjct: 63  IYQLGGHGLFISTGTSQMGRGEPLKDTARVLSRYCDGIMIRTFGQEIVDELAAYATVPVI 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQI+AD+MT  EH+G   G  F+W GDGNN+ ++ IE AA F + L +A P
Sbjct: 123 NGLTDLFHPCQIMADVMTVMEHKGGYAGLKFAWVGDGNNMANTWIEAAAIFGFDLALACP 182

Query: 186 IGSEPRNEYLNWARNQG-ASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQP 243
            G EP  + + WA  +    V L  D  +AV GAH + TD W SM  E + +  E  F  
Sbjct: 183 QGYEPDAKVMAWAAERAPGRVTLTADPKEAVSGAHVINTDVWASMGMEAEQKVREQAFGG 242

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           F ++ +L  +AHPD + +HCLPAHRGEE+ + V++G  S V+DEAENRLH QKAI+    
Sbjct: 243 FCLDDALAGLAHPDHIVLHCLPAHRGEEISDSVIEGSNSRVWDEAENRLHAQKAIMATLM 302

Query: 304 G 304
           G
Sbjct: 303 G 303


>gi|229031776|ref|ZP_04187765.1| Ornithine carbamoyltransferase [Bacillus cereus AH1271]
 gi|228729522|gb|EEL80510.1| Ornithine carbamoyltransferase [Bacillus cereus AH1271]
          Length = 316

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 136/302 (45%), Positives = 193/302 (63%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTQEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR E++ DTAKVLS Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQIGRGESVSDTAKVLSHYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEEVKTFKGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A   GA + + H+   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 VGYEPNEEIVKKALMIAEETGAEIEILHNPELAVSEADFIYTDVWMSMGQEGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINKELVMHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|257453403|ref|ZP_05618698.1| ornithine carbamoyltransferase [Enhydrobacter aerosaccus SK60]
 gi|257449155|gb|EEV24103.1| ornithine carbamoyltransferase [Enhydrobacter aerosaccus SK60]
          Length = 306

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 140/298 (46%), Positives = 188/298 (63%), Gaps = 10/298 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L + S   L  +I+   +++         +P  G+ L MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLLDFSKEELMQVIKRGSELRLMQHEGVIYQPFVGRTLGMIFEKSSTRTRISFETG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M   GG  IFLS  + QLGR E I D+A+V+SR VD +++RT  HS + +  +Y+ VPVI
Sbjct: 64  MGQFGGHAIFLSPRDTQLGRGEPIEDSARVISRMVDIVMIRTFEHSIVEKFAQYSQVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD  HPCQ++ADI TF EHRGS++GK  +W GDGNN+  S I  A +F + L ++ P
Sbjct: 124 NALTDEQHPCQLLADIQTFMEHRGSIEGKTVTWIGDGNNMCASFIHAAHQFGFQLRVSAP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQE----FKAREEHVF 241
            G EP  + +   +     V L  D  +AVKG+H V TD W SM QE     +AR    F
Sbjct: 184 YGFEPNADLI---KQYSHCVELVEDVNEAVKGSHLVATDVWASMGQESEQNTRARR---F 237

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             + V  SL+  A PD LFMHCLPAHRGEE+  ++L+ P++VV+DEAENRLH QKA++
Sbjct: 238 AQYMVTRSLLDKADPDVLFMHCLPAHRGEEISYDLLEDPRAVVWDEAENRLHAQKALM 295


>gi|147919641|ref|YP_686616.1| ornithine carbamoyltransferase [uncultured methanogenic archaeon
           RC-I]
 gi|110622012|emb|CAJ37290.1| ornithine carbamoyltransferase [uncultured methanogenic archaeon
           RC-I]
          Length = 307

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 130/299 (43%), Positives = 188/299 (62%), Gaps = 1/299 (0%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAM 66
           HF   +++S + +  +I+ A+ +K           L  + LAMIFEK STRTRVSFEV M
Sbjct: 2   HFISFADMSPAEIEALIDRAEDLKRMRREGVITDYLKNRSLAMIFEKSSTRTRVSFEVGM 61

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
             LGG  ++L  + MQLGR ET+ DT ++LS YV  I++R  +H  L+EL + +TVPVIN
Sbjct: 62  TDLGGHALYLDPASMQLGRGETVADTGRILSSYVHGIMVRANDHDMLIELAKNSTVPVIN 121

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI 186
            L+D  HPCQ +AD+MT  E +G +KG  F W GDGNN+ +SL+   A     + +A P 
Sbjct: 122 GLSDREHPCQAVADLMTIREQKGKIKGLKFVWVGDGNNVCNSLMLACAMMGMEMVVACPK 181

Query: 187 GSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREEHVFQPFQ 245
           G EP  + L  AR+ G ++ +  D   A K A  ++TD W+SM QE  +A+     + +Q
Sbjct: 182 GYEPNQQILEQARSMGGNITITRDPKAASKDADVLYTDVWVSMGQEAERAQRFADLRDYQ 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           +N+ L+ +A  D L MHCLPAHRGEE+ ++ +  P SV+F++A+NRLH QKA+L+   G
Sbjct: 242 INMELVGLAKKDCLVMHCLPAHRGEEITDDAIRSPNSVIFEQAQNRLHAQKALLIRLMG 300


>gi|325288629|ref|YP_004264810.1| ornithine carbamoyltransferase [Syntrophobotulus glycolicus DSM
           8271]
 gi|324964030|gb|ADY54809.1| ornithine carbamoyltransferase [Syntrophobotulus glycolicus DSM
           8271]
          Length = 314

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 139/299 (46%), Positives = 194/299 (64%), Gaps = 5/299 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F  L++ +S  +  +I+VA ++K+ S+    +  L GK L MIF K STRTRVSFEV 
Sbjct: 12  RDFIALNDFTSEEILHMIDVAARLKSESKAGIPHHILQGKTLGMIFTKSSTRTRVSFEVG 71

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  +FLS  ++Q+GR E I DTA+VLSR VD I++RT +H  +++L +Y   PVI
Sbjct: 72  IYQLGGYGLFLSDRDIQIGRGEPIQDTARVLSRMVDGIMIRTFSHQEVVDLAKYCDKPVI 131

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HP QI+AD++T +EH+  +KG    + GDGNN+ +SL+ G  +    + IA P
Sbjct: 132 NGLTDYLHPTQILADMLTIKEHKEKIKGLKLVYIGDGNNVANSLLLGGTKVGMDVVIAAP 191

Query: 186 IGSEPRNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHV 240
            G +P  E +  A       G S A+F D + A +GA  ++TD W SM QE +A      
Sbjct: 192 QGYKPVPEIMALAAQNAEASGGSAAVFEDPLTAAEGADILYTDVWASMGQEEEAAVRRKA 251

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           F  +Q+N +L+  A PDA+ +HCLPAHRGEE+  E+L+GPQSVVFDEAENRLH  KAI+
Sbjct: 252 FAGYQINDTLLKAAKPDAIVLHCLPAHRGEEITEEILEGPQSVVFDEAENRLHAHKAIM 310


>gi|119504230|ref|ZP_01626310.1| ornithine carbamoyltransferase [marine gamma proteobacterium
           HTCC2080]
 gi|119459738|gb|EAW40833.1| ornithine carbamoyltransferase [marine gamma proteobacterium
           HTCC2080]
          Length = 301

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 134/299 (44%), Positives = 193/299 (64%), Gaps = 4/299 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M+ PKHF  L +++S  L  II  A ++K        +    GKVLAM+F K STRTRVS
Sbjct: 1   MSSPKHFLTLRDLTSDELRGIISRANELKTQQREGIPHAGYPGKVLAMLFSKASTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FEV M+ LGG  +FLS ++ QLGR E + DTA+VLS  VD +++RT +H+ +    + A+
Sbjct: 61  FEVGMRQLGGSALFLSSADTQLGRGEPVEDTARVLSSMVDLVMIRTHDHNSVERFADVAS 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD+ HPCQ++AD+ T+ EHRG ++G+   W GDGNN+ HS I  A   ++ L 
Sbjct: 121 VPVINGLTDDYHPCQLLADMQTWFEHRGDIQGRRVCWLGDGNNMCHSYINAARLLDFELV 180

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH-V 240
           +A P G +P ++ ++        V + HD  +AV+ A  + TD W SM QE + +     
Sbjct: 181 VACPDGYQPASQLVS---ENSDRVHIVHDPREAVQNADLLVTDVWASMGQEDEQQARSAA 237

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             P+Q+N  L+ +A P+AL+MHCLPAHR EE+  E++  P +V++DEAENRLH QKA++
Sbjct: 238 MAPYQLNRKLLELAAPEALYMHCLPAHRDEEISAELMAAPDTVIWDEAENRLHAQKALI 296


>gi|311693641|gb|ADP96514.1| ornithine carbamoyltransferase [marine bacterium HP15]
          Length = 304

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 141/296 (47%), Positives = 193/296 (65%), Gaps = 6/296 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L++++++ L  +++ A  ++N          L  +VLAMIFEK STRTRVSFE  
Sbjct: 4   RHFLTLNDMTTNELESLVDHATALRNEWRQGKVRDSLKNRVLAMIFEKSSTRTRVSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLS  + QLGR E I D+A V+S  VDA+++RT  H  +      + VPVI
Sbjct: 64  MTQLGGSAMFLSPRDTQLGRGEPIEDSAIVISSMVDAVMIRTFAHETVERFAAASRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+ HPCQ++AD+ TF EHRGS++G   +W GDGNN+ HS I  AA+F++ LNIA P
Sbjct: 124 NALTDDFHPCQLLADMQTFREHRGSIRGATVAWIGDGNNMCHSYINAAAQFDFNLNIACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQ--EFKAREEHVFQP 243
            G EP    L    ++   V +F +  +A + A  + TD W SM Q  E KAR E  F  
Sbjct: 184 EGYEPAESMLKGHEDR---VKVFREPAEAARNAQLLVTDVWASMGQEDEQKAR-ERAFSG 239

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           +Q+N  L+S+A  D LFMHCLPAHRGEE+  ++++ P SVV++EAENRLH QKA+L
Sbjct: 240 YQINPGLLSVADKDVLFMHCLPAHRGEEISADMMEHPASVVWNEAENRLHAQKALL 295


>gi|237756611|ref|ZP_04585127.1| ornithine carbamoyltransferase [Sulfurihydrogenibium yellowstonense
           SS-5]
 gi|237691225|gb|EEP60317.1| ornithine carbamoyltransferase [Sulfurihydrogenibium yellowstonense
           SS-5]
          Length = 307

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 131/302 (43%), Positives = 199/302 (65%), Gaps = 7/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F   +++S   +  II+ AKK+K      F ++ L GK + +IF K STRTR+SFEV 
Sbjct: 3   RDFVSFTDLSREEVLSIIDYAKKLKKDK---FADRTLEGKSIGLIFMKQSTRTRLSFEVG 59

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  +GG  I++SGS  QL R E I DTA+V+SRY+D IV+RT +H  + EL +Y+++PVI
Sbjct: 60  VYQMGGQPIYISGSTTQLSRGEDIKDTARVMSRYLDGIVIRTFSHQEVEELAKYSSIPVI 119

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD  HPCQ++AD+MT +E  GS++ K  ++ GDGNN+ ++L+   A     +++ATP
Sbjct: 120 NALTDYQHPCQVLADLMTIDEEFGSLENKKVAYVGDGNNMANTLLLACALMGMDMSVATP 179

Query: 186 IGSEPRN----EYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
              EP      E L  A+  G+ + + +D  +AV  A  ++TD W+SM QE +  ++ VF
Sbjct: 180 PNYEPNGKAVYESLEIAKKSGSKITITNDPKEAVLEADVIYTDVWVSMGQENEKGKKDVF 239

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           +PF VN  L+ +A PDA+ MHCLPAH+GEE+  +V +    V+F++AENRLH QK+++ +
Sbjct: 240 KPFTVNKDLVLLAKPDAIVMHCLPAHKGEEITEDVFEQYSDVIFNQAENRLHVQKSLMSF 299

Query: 302 CF 303
            F
Sbjct: 300 LF 301


>gi|302392284|ref|YP_003828104.1| ornithine carbamoyltransferase [Acetohalobium arabaticum DSM 5501]
 gi|302204361|gb|ADL13039.1| ornithine carbamoyltransferase [Acetohalobium arabaticum DSM 5501]
          Length = 313

 Score =  280 bits (715), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 135/299 (45%), Positives = 194/299 (64%), Gaps = 5/299 (1%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAM 66
           H   +S+++   +  I  +  K+K  ++   ++  L+G+ L MIF+K STRTRVSFE  M
Sbjct: 3   HLLTISDLTDEEIKQIFSLTNKLKEQNKQGIDHPVLAGQTLGMIFQKSSTRTRVSFETGM 62

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
             LGG  +FLS  ++QLGR ETI DTAK LSRYV+ I++RT +HS + EL    ++PVIN
Sbjct: 63  FQLGGHGLFLSSDDIQLGRGETISDTAKTLSRYVNGIMIRTYDHSDVEELAAAGSIPVIN 122

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI 186
            LTD  HPCQ++AD+ T +E  GS++ K  ++ GDGNN+ HSL+ GA +    +++A P 
Sbjct: 123 GLTDLLHPCQVLADLYTIQEKLGSLQDKKLTYIGDGNNMSHSLLIGATKVGMDISLAVPN 182

Query: 187 GSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVF 241
              P  + +  A  Q    G+ + +  D +QA + A  V+TD W SM  E +A E    F
Sbjct: 183 AYRPDEDIVATADKQAEESGSQIEILTDPLQAAENADAVYTDVWASMGDEDEAEERMKAF 242

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           + +QVN  +M+ A   A+F+HCLPA+RG+EV   V+DGPQSVVFDEAENR+H QKAI++
Sbjct: 243 KDYQVNEEVMNAAQNKAVFLHCLPAYRGKEVTAGVIDGPQSVVFDEAENRMHVQKAIMV 301


>gi|73666679|ref|YP_302695.1| ornithine carbamoyltransferase [Ehrlichia canis str. Jake]
 gi|72393820|gb|AAZ68097.1| ornithine carbamoyltransferase [Ehrlichia canis str. Jake]
          Length = 303

 Score =  280 bits (715), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 144/299 (48%), Positives = 193/299 (64%), Gaps = 4/299 (1%)

Query: 8   FADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMK 67
           F DL+  +   L+ I+     IK +      +K LS K +A+IF +PSTRTR+SFEV + 
Sbjct: 9   FIDLNLHTKEELNTILNYGAIIKKNPNQY--SKHLSNKNIALIFLQPSTRTRISFEVGVN 66

Query: 68  HLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINA 127
            LGG+ I L+G + QL R E I DTAKVLSRYVD IV+R   H  LLEL +Y+TVPVIN+
Sbjct: 67  QLGGNAITLNGKDTQLIRGECIHDTAKVLSRYVDLIVIRILEHDSLLELNKYSTVPVINS 126

Query: 128 LTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIG 187
           LT ++HPCQ++ADIMT+EE  G ++    SW GD NN+L S I  A   N+ LNI+T   
Sbjct: 127 LTQHSHPCQVLADIMTYEEKMGPIENATVSWIGDFNNMLVSWIHAATVLNFKLNISTLEY 186

Query: 188 SEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVN 247
           SE  +  L     +GA+V    +    +  A  + TD+W+SM  E K + E  F  +QVN
Sbjct: 187 SENLDLLLKLVNEKGANVVYNKNPYDIIPDADIITTDSWVSMGFENKIKTE--FFNYQVN 244

Query: 248 LSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGII 306
             L+  A P+ +F+HCLPAHRGEEV +E++DG  S +FDEAENRLH QKAI+LWC  ++
Sbjct: 245 AKLLEKAKPNYMFLHCLPAHRGEEVTSEIIDGLNSYIFDEAENRLHIQKAIMLWCLNLL 303


>gi|330721142|gb|EGG99267.1| Ornithine carbamoyltransferase [gamma proteobacterium IMCC2047]
          Length = 306

 Score =  280 bits (715), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 141/295 (47%), Positives = 195/295 (66%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF  L +++ +    +++ A ++K    +    +PL  +VLAM+FEK STRTRVSFE  
Sbjct: 4   KHFLTLCDLTGAEFEQLLQRAIELKKMQHDGVIYEPLKNRVLAMVFEKSSTRTRVSFETG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M   GG  +FLS  + QLGR E I D+A+V+SR VD I++RT  HS++    EY++  VI
Sbjct: 64  MAQFGGSALFLSPRDTQLGRGEAIEDSARVMSRMVDIIMIRTFEHSKIERFAEYSSGLVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+ HPCQ++AD+ T+ EHRGS++GK  ++ GDGNN+ +S I  A    + L+IA P
Sbjct: 124 NALTDDYHPCQLLADMQTYVEHRGSIRGKTVTYIGDGNNMCNSYINAAHLLGFKLHIACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN-QEFKAREEHVFQPF 244
            G EP    L   ++    V +F D  +A  G+H V TD W SM  +E +   E  F  F
Sbjct: 184 EGFEPMASLLEQHKSH---VKIFRDPAEATLGSHLVVTDVWASMGQEEEQKEREQQFAGF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QVN  LM +A PDALFMHCLPAHRGEE+ +++LD P+SVV++EAENRLH QKA++
Sbjct: 241 QVNPKLMDLASPDALFMHCLPAHRGEEISHDMLDDPRSVVWEEAENRLHAQKALI 295


>gi|320352649|ref|YP_004193988.1| ornithine carbamoyltransferase [Desulfobulbus propionicus DSM 2032]
 gi|320121151|gb|ADW16697.1| ornithine carbamoyltransferase [Desulfobulbus propionicus DSM 2032]
          Length = 306

 Score =  280 bits (715), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 139/295 (47%), Positives = 192/295 (65%), Gaps = 2/295 (0%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAM 66
           H   L + +   L  +I+ A ++K  S+    ++ L+G+ + ++FEKPSTRTRVSFE AM
Sbjct: 4   HLLALGDFTQEELRALIDRALELKAESKQGVRHQQLAGRKICLLFEKPSTRTRVSFEAAM 63

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
             LGG  IF+S  E QLGR E + DTA+VLSRYVDAIV+RT     + EL  YATVPVIN
Sbjct: 64  YGLGGQVIFMSTKESQLGRGEPLKDTARVLSRYVDAIVVRTFGQGVVEELARYATVPVIN 123

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI 186
           ALTD  HPCQ+++D+MT  E +G++      W GDGNN+ +S IE A+ F + L +A P 
Sbjct: 124 ALTDLHHPCQVLSDLMTVIEKKGTLDKTKTVWIGDGNNMANSWIEAASVFGFPLTLACPA 183

Query: 187 GSEPRNEYLNWARNQGA-SVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQPF 244
           G  P    L  AR +    + +  D  +A++GA  +  D W SM QE +  +   VF+ +
Sbjct: 184 GFSPNETILEKARVRSPLPIVVLRDPAEAIRGAAVINVDVWASMGQEAEQEQRLGVFRDY 243

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           Q++ +L++ A  DA+ +HCLPAHRGEEV  EVL+GPQSVVFD+AEN++H   AIL
Sbjct: 244 QLDSALLAKADKDAIVLHCLPAHRGEEVTEEVLEGPQSVVFDQAENKMHIHAAIL 298


>gi|299136472|ref|ZP_07029655.1| ornithine carbamoyltransferase [Acidobacterium sp. MP5ACTX8]
 gi|298600987|gb|EFI57142.1| ornithine carbamoyltransferase [Acidobacterium sp. MP5ACTX8]
          Length = 378

 Score =  280 bits (715), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 140/304 (46%), Positives = 192/304 (63%), Gaps = 7/304 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +    ++++S   ++ I+E+A  +K   E+      L  K + M FEK S RTR++FE A
Sbjct: 57  RDLCSITDLSVPEMAAIMELAHAVKTQPEDF--RHALDAKQMVMFFEKASLRTRLTFETA 114

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  +GG+ +F+  +   LG  E+I D A+ L R+++ IV+RT +H  + E+ E A +PVI
Sbjct: 115 MNTVGGNAVFVDQTSSPLGERESIPDVARNLERWMNVIVLRTYSHDTVTEMAENAKIPVI 174

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NAL+D  HPCQ IAD MT EE  GSV G  F++ GDGNN+ HSL+  AA       +ATP
Sbjct: 175 NALSDIEHPCQAIADFMTLEERFGSVMGLKFTYVGDGNNVCHSLMLTAALLGAHCTVATP 234

Query: 186 IGSEPR----NEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHV 240
               P+    ++ +  A N G S+ L HD ++A  GA  ++TD   SM QE + AR   +
Sbjct: 235 KNFGPKLDIIHKTIEIAENTGGSLTLTHDPIKAATGADAIYTDVCTSMGQEHEAARRAPI 294

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+PFQVN  LM++A P A FMHCLPAHRG EV + VLDGPQSVVFD+AENRLH QKAI+L
Sbjct: 295 FKPFQVNEELMALAQPSAAFMHCLPAHRGAEVTDAVLDGPQSVVFDQAENRLHAQKAIIL 354

Query: 301 WCFG 304
              G
Sbjct: 355 MLLG 358


>gi|322421563|ref|YP_004200786.1| ornithine carbamoyltransferase [Geobacter sp. M18]
 gi|320127950|gb|ADW15510.1| ornithine carbamoyltransferase [Geobacter sp. M18]
          Length = 303

 Score =  280 bits (715), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 134/296 (45%), Positives = 194/296 (65%), Gaps = 2/296 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K F  LS  + + L  +  + K++K  +++  E+  L GK LAMIFEK STRTR+SFEV 
Sbjct: 3   KDFLALSQFTKAELDAMFALTKELKEKTKSGVEHHLLKGKTLAMIFEKSSTRTRISFEVG 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +F+S  + Q+GR E I D+A+V++RY D +++RT   + + E  +YA+VP+I
Sbjct: 63  MYQLGGHPLFISSKDSQMGRGEPIKDSARVMARYCDGVMIRTFAQATVEEFAKYASVPII 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQI+AD+ T  E +GS  G  F+W GDGNN+ +S IE AA F + L +A P
Sbjct: 123 NGLTDLHHPCQIMADVFTVIEQKGSYDGLKFAWIGDGNNMANSWIEAAAIFGFDLTLACP 182

Query: 186 IGSEPRNEYLNWA-RNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQP 243
            G +P  + L WA +N  + + +  D  +A + A  + TD W SM QE + +  E  F  
Sbjct: 183 QGYDPNPQVLAWAQKNATSRIVITRDPKEAAQDADVLNTDVWASMGQEEEQKIREQAFAG 242

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           +Q+N  L+ +A  +A+ +HCLPAHRGEE+ ++V++GP S V+DEAENRLH QKAI+
Sbjct: 243 YQLNEELLDLAKGNAMVLHCLPAHRGEEISDDVIEGPHSAVWDEAENRLHVQKAIM 298


>gi|308173089|ref|YP_003919794.1| ornithine carbamoyltransferase [Bacillus amyloliquefaciens DSM 7]
 gi|307605953|emb|CBI42324.1| ornithine carbamoyltransferase [Bacillus amyloliquefaciens DSM 7]
 gi|328554069|gb|AEB24561.1| ornithine carbamoyltransferase [Bacillus amyloliquefaciens TA208]
 gi|328911150|gb|AEB62746.1| ornithine carbamoyltransferase [Bacillus amyloliquefaciens LL3]
          Length = 318

 Score =  280 bits (715), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 144/302 (47%), Positives = 202/302 (66%), Gaps = 11/302 (3%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSS-ENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           Y K F  L ++S S+++ ++  A  +K    + IF+     GK LAMIFEK STRTRVSF
Sbjct: 14  YGKDFLSLKDVSPSDINALLTEASLLKQHPIQPIFQ-----GKTLAMIFEKSSTRTRVSF 68

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E  M  LGG  +FLS S++QLGR ET+ DTAKVLS +VDAI++RT  H ++ EL E+A +
Sbjct: 69  EAGMAQLGGTGLFLSSSDLQLGRGETVADTAKVLSGFVDAIMIRTFAHEKVEELAEHADI 128

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVIN LTD  HPCQ +AD++T +E +G +KG   ++ GDGNN+ HSL+ G A+    + +
Sbjct: 129 PVINGLTDRYHPCQALADLLTIQEIKGKLKGVKVAYIGDGNNVAHSLMIGCAKMGCDVAV 188

Query: 183 ATPIGSEPRNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE 238
           A+P G E   E +N A+      G  + L  +  +AV+ A  +++D + SM QE + ++ 
Sbjct: 189 ASPKGYEVEEEAVNAAKEAAAVSGTKITLTDNPQEAVRDADVIYSDVFTSMGQEEETQQR 248

Query: 239 -HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
             VF P+QVN SL+S+A PD  F+HCLPAHR EEV ++++DGP S VF +AENRLH QKA
Sbjct: 249 LSVFAPYQVNASLVSLAKPDYTFLHCLPAHREEEVTSDIIDGPNSAVFQQAENRLHAQKA 308

Query: 298 IL 299
           +L
Sbjct: 309 LL 310


>gi|229086700|ref|ZP_04218868.1| Ornithine carbamoyltransferase [Bacillus cereus Rock3-44]
 gi|228696647|gb|EEL49464.1| Ornithine carbamoyltransferase [Bacillus cereus Rock3-44]
          Length = 316

 Score =  280 bits (715), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 139/299 (46%), Positives = 190/299 (63%), Gaps = 8/299 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K +         L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTQEEIIALIEFAIYLKQNKHEPL----LDGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQLGR E++ DTAKVLS Y+D I++RT +H+ + EL + A++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQLGRGESVSDTAKVLSHYIDGIMIRTFSHTDVEELAKEASIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEEVHTFKGIKLAYVGDGNNVCHSLLLASAKVGMNMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
            G EP  +     L  A   GA++ + HD   AVKGA  ++TD W+SM QE    +  +F
Sbjct: 188 PGYEPNEQIVKCALEIANETGANIEVLHDPELAVKGADFIYTDVWMSMGQEDTEEKYKLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           QPFQVN  L+  A     F+HCLPAHR EEV   ++DGP S+VF++A NRLH QKA+L+
Sbjct: 248 QPFQVNEKLVQHAKATYRFLHCLPAHREEEVTGGIIDGPSSIVFEQAGNRLHAQKALLV 306


>gi|148262310|ref|YP_001229016.1| ornithine carbamoyltransferase [Geobacter uraniireducens Rf4]
 gi|146395810|gb|ABQ24443.1| ornithine carbamoyltransferase [Geobacter uraniireducens Rf4]
          Length = 305

 Score =  279 bits (714), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 140/302 (46%), Positives = 192/302 (63%), Gaps = 4/302 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F  LS  + + L  I  + ++++   +   E+  L GK LAMIFEK STRTRVSFEV 
Sbjct: 3   RDFLALSQFTKTELDAIFALTRELQQKQKQGIEHHLLKGKTLAMIFEKSSTRTRVSFEVG 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +F+S  + Q+GR E I DTA+V++RY D +++RT     + E   Y+ VPVI
Sbjct: 63  MYQLGGHPLFISTKDSQMGRGEPIKDTARVMARYCDGVMIRTYGQEIVEEFARYSAVPVI 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQI+AD+ T  EHRGS +G   +W GDGNN+ ++ IE AA F + L +A P
Sbjct: 123 NGLTDLHHPCQIMADLFTVIEHRGSYEGLKIAWVGDGNNMANTWIEAAAIFGFDLTLACP 182

Query: 186 IGSEPRNEYLNWARNQGAS-VALFHDAVQAVKGAHCVFTDTWISMNQEF--KAREEHVFQ 242
            G EP    + WA+ +  S + L  D  +AVK A  + TD W SM QE   KARE+  F 
Sbjct: 183 KGYEPDARVMAWAQAKATSRIVLTDDPHEAVKDADVINTDVWASMGQEAEQKAREK-AFA 241

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            +Q+N +L+  A  + + +HCLPAHRGEE+ ++V++GP S V+DEAENRLH QKAI+   
Sbjct: 242 GYQLNEALLDPARGNCMVLHCLPAHRGEEITDDVIEGPHSAVWDEAENRLHVQKAIMATL 301

Query: 303 FG 304
            G
Sbjct: 302 MG 303


>gi|254281925|ref|ZP_04956893.1| ornithine carbamoyltransferase [gamma proteobacterium NOR51-B]
 gi|219678128|gb|EED34477.1| ornithine carbamoyltransferase [gamma proteobacterium NOR51-B]
          Length = 301

 Score =  279 bits (714), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 140/304 (46%), Positives = 191/304 (62%), Gaps = 4/304 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M  P+HF  L +I++     II  A ++K        +    GKVLAMIF K STRTRVS
Sbjct: 1   MAQPRHFLTLDDINADEFRSIIARATELKRLQREGISHARYPGKVLAMIFAKASTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  +FLS ++ QLGR E + DTA+V+S  VDA+++RT  HS +      ++
Sbjct: 61  FEAGMTQLGGSAMFLSAADTQLGRGEPVEDTARVISSMVDAVMIRTFEHSTVERFARMSS 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LT++ HPCQ++AD+ T+ EHRG + G+   W GDGNN+  S I  A   ++ L 
Sbjct: 121 VPVINGLTNDFHPCQLLADMQTWFEHRGDIAGRRVCWLGDGNNMCQSYINAARLLDFELV 180

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHV 240
           IA P G EP  + +  A+N    V + HDA  AV+G   + TD W SM QE + +  E  
Sbjct: 181 IACPEGYEPDADLV--AKN-AERVRIEHDADAAVEGVDLLVTDVWASMGQEEEQKIREAA 237

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
             PFQ++  L++ A  DAL++HCLPAHRGEE+  E++D P SV++DEAENRLH QKA+L 
Sbjct: 238 MAPFQLSRGLLARAAKDALYLHCLPAHRGEEITAELMDAPDSVIWDEAENRLHAQKALLE 297

Query: 301 WCFG 304
           +  G
Sbjct: 298 FLLG 301


>gi|332982559|ref|YP_004464000.1| ornithine carbamoyltransferase [Mahella australiensis 50-1 BON]
 gi|332700237|gb|AEE97178.1| ornithine carbamoyltransferase [Mahella australiensis 50-1 BON]
          Length = 320

 Score =  279 bits (714), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 134/299 (44%), Positives = 195/299 (65%), Gaps = 5/299 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    + +++   +  I+ +  K+K  S+    +  L GK L MIF+K STRTRVSFEV 
Sbjct: 17  KDLLSIHDLTQDEVYQILSLGLKLKAQSKAGIPHPLLKGKTLGMIFQKSSTRTRVSFEVG 76

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  +FLS +++QLGR ETI DTA+VLSRY+D I++RT     + +L  Y+++PVI
Sbjct: 77  IYQLGGYGLFLSSNDLQLGRGETIADTARVLSRYLDGIMIRTFKQKDVEDLAHYSSIPVI 136

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ+++D++T  E +    G   ++ GDGNN+ HSL+ G A+ +  + +A P
Sbjct: 137 NGLTDLLHPCQVLSDLLTVYEKKQRFSGLKLAFIGDGNNMAHSLMFGCAKVDMDIALACP 196

Query: 186 IGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EHV 240
            G  P ++ +  A+      G+ + +  D  +A++GA  V+TD W SM QE + +E +  
Sbjct: 197 EGYMPDDDIVKAAKTDAQLSGSHITITTDPAEAIEGADVVYTDVWASMGQEAETQERKKA 256

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            Q +QVN SL  +A PDA+FMHCLPAHRGEEV + ++DGP S +FDEAENRLH QKAI+
Sbjct: 257 MQNYQVNESLWQLAKPDAIFMHCLPAHRGEEVTDAIIDGPMSAIFDEAENRLHAQKAIM 315


>gi|258590899|emb|CBE67194.1| ornithine carbamoyltransferase (OTCase) [NC10 bacterium 'Dutch
           sediment']
          Length = 311

 Score =  279 bits (714), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 144/304 (47%), Positives = 194/304 (63%), Gaps = 5/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    +S+++ S +  +  +A  +K        +  L GK L MIFEKPS RTRV+FEV 
Sbjct: 3   KDLLSISDLTVSEIDSLFFLAADLKAQQRKGVAHPLLPGKTLGMIFEKPSLRTRVTFEVG 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  I+L+ +E+QLG  ET+ D AK L R+VD I+ RT  H  + EL  +A VPVI
Sbjct: 63  MAQLGGRAIYLAPAEIQLGVRETVKDVAKNLERWVDGIIARTFAHRTVEELAAHAAVPVI 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D THPCQI+AD+ T +E  G++ G   ++ GDGNN+ HS + GAAR    L++A P
Sbjct: 123 NGLSDLTHPCQILADLFTLQEKCGTLHGVKVAYIGDGNNVCHSWLYGAARTGIELHVACP 182

Query: 186 IGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHV 240
            G EP    +  +R +    G  + L +DA  A + A  ++TD W SM QE + A+  H 
Sbjct: 183 KGYEPDAGIVAASRQEAEAAGGRITLLNDARAAAERADVLYTDVWTSMGQETETAKRRHD 242

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+ FQVN +L+ +A PD L MHCLPAHRGEE+ +EVLDGP S+V+DEAENRLH QKAIL+
Sbjct: 243 FRGFQVNAALVRLAKPDVLVMHCLPAHRGEEITDEVLDGPHSIVYDEAENRLHVQKAILV 302

Query: 301 WCFG 304
              G
Sbjct: 303 TLLG 306


>gi|192359088|ref|YP_001983334.1| ornithine carbamoyltransferase [Cellvibrio japonicus Ueda107]
 gi|190685253|gb|ACE82931.1| ornithine carbamoyltransferase [Cellvibrio japonicus Ueda107]
          Length = 305

 Score =  279 bits (714), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 147/305 (48%), Positives = 202/305 (66%), Gaps = 14/305 (4%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIK-----NSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           P+HF  L++++S+ L  II  A ++K       +  +F+NK     VLAMIFEK STRTR
Sbjct: 7   PRHFLTLNDVNSAELQHIIARAIELKALLRQGKAPALFDNK-----VLAMIFEKNSTRTR 61

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSFE  +  LGG  IFLS  + QLGR E I D A+ ++  VD +++RT  H+ +    EY
Sbjct: 62  VSFESGVAKLGGHAIFLSTKDSQLGRGEPIEDAARCIASMVDMVMIRTYGHATVERFAEY 121

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LTD  HPCQ++ADI T+ E RGS+ GK  +W GDGNN+ +S I+ A   ++ 
Sbjct: 122 SRVPVINGLTDEYHPCQLLADIQTYVEQRGSLAGKTVAWVGDGNNMCNSYIQAAELCDFE 181

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQE-FKAREE 238
           L IATP G EP +E++   +++ ASV+  +D  +AV GA  V TDTW SM QE  K + E
Sbjct: 182 LRIATPKGFEPEDEFVTPYQHR-ASVS--NDPREAVAGADLVVTDTWASMGQEDEKKQRE 238

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
            +F  +QVN  LMS A  DALFMHCLPA+RG+EV  ++LD P +VV++EAENR+H Q A+
Sbjct: 239 KIFIGYQVNKELMSYAKSDALFMHCLPAYRGKEVSADILDAPDAVVWEEAENRMHAQNAL 298

Query: 299 LLWCF 303
           + + F
Sbjct: 299 MEFLF 303


>gi|319779510|ref|YP_004130423.1| Ornithine carbamoyltransferase [Taylorella equigenitalis MCE9]
 gi|317109534|gb|ADU92280.1| Ornithine carbamoyltransferase [Taylorella equigenitalis MCE9]
          Length = 311

 Score =  279 bits (713), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 139/298 (46%), Positives = 197/298 (66%), Gaps = 9/298 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L + S+  +  I++ A  +K   +N   + PL  + LAM+FEK STRTRVSFE  
Sbjct: 11  RHFLQLKDFSTEEILYILDRAILLKKKFKNYEPHTPLLDRTLAMVFEKASTRTRVSFEAG 70

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  +GG  I L+ ++ QLGR+E I DTA+V+SR VD +++RT   +RL +  EY+ VPVI
Sbjct: 71  MYQMGGFVINLTSNDSQLGRSEPIEDTARVVSRMVDIVMIRTFEQARLEKFAEYSRVPVI 130

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+AD++T+ E+RG +KGK  +W GD NN+ ++ I+ A   ++ LN    
Sbjct: 131 NGLTNEFHPCQILADLLTYIEYRGPIKGKTVTWIGDENNMSYTWIQAAELLDFTLNF--- 187

Query: 186 IGSEPRNEYLNWARNQGAS---VALFHDAVQAVKGAHCVFTDTWISMN-QEFKAREEHVF 241
             S P++  L   R  G S   + +F D ++A +G+  + TD W SM  +E  A+ +  F
Sbjct: 188 --SAPKDYQLKADRIAGVSEKHLKVFDDPIEAARGSDLITTDVWTSMGYEEENAKRKSAF 245

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             +QVN  LMS+A  DA+FMHCLPAHRGEEV  EV+DGPQSVV+DEAENR+H QKA++
Sbjct: 246 ANWQVNQELMSVAAKDAIFMHCLPAHRGEEVTAEVIDGPQSVVWDEAENRMHVQKAVM 303


>gi|262370294|ref|ZP_06063620.1| ornithine carbamoyltransferase [Acinetobacter johnsonii SH046]
 gi|262314636|gb|EEY95677.1| ornithine carbamoyltransferase [Acinetobacter johnsonii SH046]
          Length = 305

 Score =  279 bits (713), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 139/295 (47%), Positives = 188/295 (63%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++S+  L+ +++   ++K    N    +P  GKV+ MIFEK STRTRVSFE  
Sbjct: 4   RHFLTLRDLSTLELNQVVQRGIELKRKQHNSEVFQPFVGKVMGMIFEKSSTRTRVSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M   GG  IFLS  + QLGR E I D+A+V+S  +D +++RT  H  +     Y+ VPVI
Sbjct: 64  MSQFGGSAIFLSPRDTQLGRGEPIEDSARVISSMLDIVMIRTFGHDIVERFASYSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+ HPCQ++AD+ TF EHRG + GK  +W GDGNN+ +S IE A  + + L IA P
Sbjct: 124 NALTDDHHPCQLLADVQTFVEHRGPIAGKTVAWIGDGNNMCNSYIEAAHMWGFKLKIAAP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQPF 244
            G EP+ E+L+          L + A  A   A  + TD W SM QE + +  E  F  +
Sbjct: 184 KGYEPKAEFLS---EFAHCAELVNSAEDAAVNADLIVTDVWASMGQEEEQKIREAAFADY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QVN  LM++AHPD LFMHCLPAHRGEE+  ++LD   +VV+DEAENRLH QKA++
Sbjct: 241 QVNERLMNLAHPDCLFMHCLPAHRGEEISEKMLDHKNAVVWDEAENRLHAQKALV 295


>gi|284163618|ref|YP_003401897.1| ornithine carbamoyltransferase [Haloterrigena turkmenica DSM 5511]
 gi|284013273|gb|ADB59224.1| ornithine carbamoyltransferase [Haloterrigena turkmenica DSM 5511]
          Length = 309

 Score =  279 bits (713), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 135/303 (44%), Positives = 189/303 (62%), Gaps = 4/303 (1%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           T P+HF D+ +++ + L  I+E A + K +     +++ L G+ L MIF+KPSTRTRVSF
Sbjct: 8   TEPRHFLDVDDVTPAELDAILERAAEYKRAQHAGEDHEDLEGQTLGMIFQKPSTRTRVSF 67

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E  M  LGG  +FL   ++QLGR E + DT++ LSRYVDA++ R   H  +  L EY++V
Sbjct: 68  ETGMTQLGGHAVFLGEDDIQLGRGEPLKDTSRTLSRYVDAVMARVFKHGNMEVLAEYSSV 127

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PV+N LTD+ HPCQ +AD++T  E  G  +    +W GDGNN+  S   GAA  +  L +
Sbjct: 128 PVVNGLTDDAHPCQTLADLLTIREQEGGFEDVSAAWIGDGNNVAQSFAVGAALTDIDLTV 187

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV-- 240
           ATP G    +  L  AR+ G      HD V+A   A  ++TD WISM QE   R+  +  
Sbjct: 188 ATPEGYGIDDAVLERARDLGGDPTTTHDPVEAATDADIIYTDVWISMGQE-DERDVRMND 246

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+ FQ++  L+     DA  MHCLPAHRGEE+ ++V++  +SVVFD+AENRLH QKA+L 
Sbjct: 247 FEGFQISADLLEHT-ADASVMHCLPAHRGEEITDDVIESDRSVVFDQAENRLHAQKALLS 305

Query: 301 WCF 303
           W  
Sbjct: 306 WLL 308


>gi|229917792|ref|YP_002886438.1| ornithine carbamoyltransferase [Exiguobacterium sp. AT1b]
 gi|229469221|gb|ACQ70993.1| ornithine carbamoyltransferase [Exiguobacterium sp. AT1b]
          Length = 308

 Score =  279 bits (713), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 138/300 (46%), Positives = 202/300 (67%), Gaps = 7/300 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  +  ++   L  ++++A ++K S ++      L+GK +A++FEK STRTR+SFEV 
Sbjct: 7   QHFLTMEELTPDTLDSLMQLAHEVKRSPQSY--ATALTGKKVALLFEKASTRTRMSFEVG 64

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  +FLSG ++Q+GR E + DT +V+SRYVDA+++RT  H  +  L ++ ++P+I
Sbjct: 65  VVELGGYPLFLSGQDLQIGRGEPLTDTIQVMSRYVDALMIRTYAHETVETLAQHGSIPII 124

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ++AD++T EE  GS  GK+ ++ GDGNN+ HSL+ G A     + IA+P
Sbjct: 125 NGLTDLHHPCQVLADLLTIEEQFGSRAGKVLAYIGDGNNMAHSLMIGGALSGMHIRIASP 184

Query: 186 IGSEPRNEYLNWAR----NQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV- 240
            G    +     A+    + G S+ALF +   A   A  V+TD + SM QE +A E  + 
Sbjct: 185 NGYTVDHAIYEKAQKLATSTGGSIALFENPSLAANEADIVYTDVFASMGQEGEAEERLMK 244

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F  FQVN  LM++A+PDA+F+HCLPAHRGEEV  +V+DGPQS VFD+AENRLH QKA++L
Sbjct: 245 FNGFQVNKELMALANPDAIFLHCLPAHRGEEVTADVIDGPQSWVFDQAENRLHAQKALML 304


>gi|167044180|gb|ABZ08862.1| putative aspartate/ornithine carbamoyltransferase, carbamoyl-P
           binding domain protein [uncultured marine crenarchaeote
           HF4000_APKG5E24]
 gi|167044478|gb|ABZ09153.1| putative aspartate/ornithine carbamoyltransferase, carbamoyl-P
           binding domain protein [uncultured marine crenarchaeote
           HF4000_APKG6J21]
          Length = 304

 Score =  279 bits (713), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 149/305 (48%), Positives = 193/305 (63%), Gaps = 1/305 (0%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M    K    +  ISS     +I+ + K+K  ++ + E   L  K LAM+F KPSTRTRV
Sbjct: 1   MKLKTKDLLTVDEISSKEFLELIDFSIKLKKENKTVKEKPLLKNKTLAMLFGKPSTRTRV 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFE+ M  LGG T+ LS +EMQ  R E++ DTAK LSRYVDAIV R   HS + +L ++A
Sbjct: 61  SFEIGMLQLGGHTVNLSLNEMQHSRGESVEDTAKTLSRYVDAIVARVYEHSFIEKLAKHA 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVIN L+++ HPCQ +AD+MT +EH+   K    +W GDGNN+ +SLI G ++    +
Sbjct: 121 TVPVINGLSNSYHPCQTLADLMTIKEHKKKFKDLKIAWIGDGNNVCNSLIFGCSKTQTQI 180

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            IATP G EP  E +  + ++   V L  D   AVK A  V TDT+ S++     R E  
Sbjct: 181 VIATPKGFEPNPEVVKKS-SKYTVVDLTTDPKSAVKDADIVMTDTFTSIHTSDPKRTEKF 239

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
              FQVN SLM  A  DA+FMHCLPA R +EV +EV+DG QSVV+DEAENRLHTQKA+LL
Sbjct: 240 LPSFQVNQSLMEKAKNDAIFMHCLPAKRDQEVTSEVIDGSQSVVWDEAENRLHTQKALLL 299

Query: 301 WCFGI 305
               I
Sbjct: 300 SLLSI 304


>gi|330507741|ref|YP_004384169.1| ornithine carbamoyltransferase [Methanosaeta concilii GP-6]
 gi|328928549|gb|AEB68351.1| ornithine carbamoyltransferase [Methanosaeta concilii GP-6]
          Length = 304

 Score =  278 bits (712), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 138/295 (46%), Positives = 193/295 (65%), Gaps = 3/295 (1%)

Query: 11  LSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLG 70
           ++++S  ++  +I+ A+  +  +      +PL GK LAMIFEKPSTRTRVS EVA   LG
Sbjct: 6   IADLSGEDILRLIQSAEAFR--ARRGRHGQPLEGKSLAMIFEKPSTRTRVSLEVAAWELG 63

Query: 71  GDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTD 130
           G  ++LS +E+QLGR ETI DTA+VLSRYV  I  R  +H  +L+L E+A+VPVINAL+D
Sbjct: 64  GHPLYLSANELQLGRGETIADTARVLSRYVHGITARVHSHGTVLQLAEHASVPVINALSD 123

Query: 131 NTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEP 190
             HP QI+AD+ T  ++  ++ G    W GDGNN+ +SLI  +A     + +A+P G  P
Sbjct: 124 WEHPLQILADLQTMSQNFQALDGLQIGWIGDGNNVCNSLILASAILRMEITVASPPGYGP 183

Query: 191 RNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQPFQVNLS 249
           + E L  AR  G S  +  +  +A  GA  + TDTW+SM  E +  E   VF  +Q+N  
Sbjct: 184 KAEILEEARALGGSPRVVEEPEEAAGGADVLVTDTWVSMGDEAEEAERLRVFGRYQINSQ 243

Query: 250 LMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           LM +A   A+ +HCLPAHRG+E+ +EV+DGP+S VFDEAENR+HT KA++ W  G
Sbjct: 244 LMDLAGDGAIALHCLPAHRGQEITDEVMDGPRSRVFDEAENRMHTSKAVMAWLMG 298


>gi|312127410|ref|YP_003992284.1| ornithine carbamoyltransferase [Caldicellulosiruptor hydrothermalis
           108]
 gi|311777429|gb|ADQ06915.1| ornithine carbamoyltransferase [Caldicellulosiruptor hydrothermalis
           108]
          Length = 308

 Score =  278 bits (712), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 138/308 (44%), Positives = 205/308 (66%), Gaps = 8/308 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L+++S  ++  ++E+A ++K  ++  F    L  K L +IF K STRTRVSFEV 
Sbjct: 2   RHFLHLNDLSKEDIMYLVELASRLKKEAKKGFYFPYLKNKALGLIFTKASTRTRVSFEVG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG +++L  +++QLGR ETI DTAKVLSRY+D IV+RT     + E  +Y+++PVI
Sbjct: 62  IHQLGGYSLYLGKNDLQLGRGETIEDTAKVLSRYLDLIVIRTYEQKEVEEFAKYSSIPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HP QIIAD  T  E +G +     ++ GDGNN+  +L+ GAA+    + +ATP
Sbjct: 122 NGLTDDYHPTQIIADFQTIFEEKGRLSNLKIAYVGDGNNVAATLLVGAAKLGLDIAVATP 181

Query: 186 IGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV- 240
              E + E +++    A+   +++   +   +AVK A  V+TDTW+SM QE + +E+ + 
Sbjct: 182 PDYEIKKEVVDFSLDEAKKSKSNIIFTNSPKEAVKDADVVYTDTWVSMGQE-EEKEKRIR 240

Query: 241 -FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ +QV+ SLM +A  DA+F+HCLPA+RG EV +EV+DG QS VFDEAENRLH  KAI+
Sbjct: 241 DFEGYQVDSSLMKLAKDDAIFLHCLPAYRGFEVTSEVIDGSQSRVFDEAENRLHAHKAIM 300

Query: 300 LW-CFGII 306
           ++ C G I
Sbjct: 301 IFVCLGKI 308


>gi|90416148|ref|ZP_01224080.1| ornithine carbamoyltransferase [marine gamma proteobacterium
           HTCC2207]
 gi|90331873|gb|EAS47087.1| ornithine carbamoyltransferase [marine gamma proteobacterium
           HTCC2207]
          Length = 304

 Score =  278 bits (712), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 146/302 (48%), Positives = 199/302 (65%), Gaps = 7/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++S + LS +I++A ++K +     +     GKVL MIFEK STRTRVSFE  
Sbjct: 4   RHFLSLRDLSPAELSQVIDLAIEMKAAKREGRQEPIFEGKVLGMIFEKSSTRTRVSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGGD IFLS ++ QLGR E + D+A+V+SR VD +++RT     +      + VPVI
Sbjct: 64  MAQLGGDAIFLSSNDTQLGRGEPVEDSARVISRMVDIVMIRTHGQEIVERFAANSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALT+  HPCQ++AD+ TF EHRGS++GK  +W GDGNN+  S I  A +F++ L IATP
Sbjct: 124 NALTNEYHPCQLLADVQTFVEHRGSIQGKTVAWIGDGNNMCSSWINAAIQFDFKLQIATP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV--FQP 243
           +G EP    +  A   G  +++ +D V A  GA  V TD + SM QE + +EE +  F  
Sbjct: 184 VGYEPNAALVAEA---GKRLSVSNDPVAAATGADLVTTDVFASMGQEAE-QEERLKHFAG 239

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVL-DGPQSVVFDEAENRLHTQKAILLWC 302
           FQVN +LM+ A  +ALFMHCLPAHR EEV  E++ D   SVV+DEAENRLH QKA++++ 
Sbjct: 240 FQVNHALMAHAADNALFMHCLPAHRDEEVSGELMEDEAISVVWDEAENRLHAQKALMVFL 299

Query: 303 FG 304
            G
Sbjct: 300 LG 301


>gi|78357575|ref|YP_389024.1| ornithine carbamoyltransferase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|123551965|sp|Q30YB7|OTC_DESDG RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|78219980|gb|ABB39329.1| ornithine carbamoyltransferase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 300

 Score =  278 bits (712), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 141/298 (47%), Positives = 191/298 (64%), Gaps = 4/298 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF  + ++       ++  AK++K+S      +  L GK   M+FEK STRTRVSFE A
Sbjct: 3   KHFTQIRDLGYQAAWDVLRRAKEMKDSRHR---STLLEGKSAIMLFEKASTRTRVSFETA 59

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG TIF++ +E QLGR+E + DTA+VLSRY D +++RT    ++ EL EY ++PVI
Sbjct: 60  VHQLGGKTIFMTPAESQLGRSEPLRDTARVLSRYNDLMIVRTFGQEKIDELVEYGSIPVI 119

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD  HPCQ+++D++T  E    ++    +W GDGNN+ +S IE A  F + L +A P
Sbjct: 120 NALTDEGHPCQVMSDMLTIYERTPDLEKVRVAWVGDGNNMANSWIEAAIFFKFELFMAFP 179

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EHVFQPF 244
            G EP    L  A   GA + L HD   AV GAH V TD W SM QE + ++ E  F  F
Sbjct: 180 EGYEPDRNLLALAMQAGAKIFLTHDPAMAVDGAHYVNTDVWASMGQEEEQKKREKAFAGF 239

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            V+ +LM+ A PDA FMHCLPAHRGEEV  +V + P S+V+D+AENRLH QKA++ W 
Sbjct: 240 CVDDALMAKAAPDARFMHCLPAHRGEEVTEDVFESPASIVWDQAENRLHMQKALIEWV 297


>gi|34558060|ref|NP_907875.1| ornithine carbamoyltransferase [Wolinella succinogenes DSM 1740]
 gi|56749127|sp|Q7M8B5|OTC_WOLSU RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|34483778|emb|CAE10775.1| ORNITHINE CARBAMOYLTRANSFERASE [Wolinella succinogenes]
          Length = 307

 Score =  278 bits (712), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 138/301 (45%), Positives = 198/301 (65%), Gaps = 6/301 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L + S+  +  I+ ++K+IK+  +       + GKVL MIFEK STRTRVSFE  
Sbjct: 2   RHFLTLKDFSAQEILEILALSKEIKDDLKKGIRPPLMQGKVLGMIFEKSSTRTRVSFESG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  +FLS  ++QLGR E + DTA+V+SR VD +++RT+ H R+ E  +Y+ VPV+
Sbjct: 62  IYQLGGMGMFLSNRDIQLGRGEPMKDTARVISRMVDMVMIRTSGHERIEEFAKYSQVPVV 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HP Q++AD +T  E  G  +  + ++ GDGNN+ HS +  A++  + L +ATP
Sbjct: 122 NGLTDSYHPVQLMADYLTMMEQ-GKDQNPIVAYVGDGNNMTHSWLMLASKLGFELRVATP 180

Query: 186 IGSEPRNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQ-EFKAREEHV 240
            G EP  +    A+      GA + L +D  +AV+GA  V TDTW SM Q E K +    
Sbjct: 181 RGYEPNLKIFEEAQKIASLSGAKITLTNDPKRAVEGADVVTTDTWASMGQEEEKEKRARD 240

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           FQ + V+ +LM +A  DA+F+HCLPA+RG+EV  EVL+GPQS++FDEAENRLH QK I++
Sbjct: 241 FQGYCVDSALMGLAKSDAIFLHCLPAYRGQEVSEEVLEGPQSLIFDEAENRLHVQKGIMV 300

Query: 301 W 301
           W
Sbjct: 301 W 301


>gi|227505059|ref|ZP_03935108.1| ornithine carbamoyltransferase [Corynebacterium striatum ATCC 6940]
 gi|227198347|gb|EEI78395.1| ornithine carbamoyltransferase [Corynebacterium striatum ATCC 6940]
          Length = 306

 Score =  278 bits (711), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 140/302 (46%), Positives = 199/302 (65%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRVSFEV 64
           +HF    ++S +  + ++++A K+K      F  +PL G K +A++F+K STRTR SFE 
Sbjct: 4   RHFLADDDLSPAEQAEVLDLALKLKAEP---FSERPLEGPKSVAVLFDKTSTRTRFSFEA 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            + HLGG  I       Q+G+ ET  DTA VLSR+V+AIV RT +H   LE+ E ATVP+
Sbjct: 61  GIAHLGGHAIVTETKSTQMGKGETYQDTAAVLSRFVEAIVWRTYDHQNFLEMAETATVPI 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLNIA 183
           +NAL+D+ HPCQI+AD++T  E+ G +KG+   + GDG NN+ +S + G A     + I 
Sbjct: 121 VNALSDDLHPCQILADLLTCRENFGDLKGRKAVYLGDGNNNMANSYMLGFATAGMEVGII 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV-FQ 242
            P G +P+ E+++ AR +G+      D+++AV+GA  V TDTW+SM QE    +    F 
Sbjct: 181 APEGFQPQQEFVDRARQRGSITVT--DSLEAVRGADVVITDTWVSMGQEADGLDRRTPFI 238

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           P+QVN  +M+MA  DA+F+HCLPA+RG EV  EV+DGPQS VFDEAENRLH QKA+L+W 
Sbjct: 239 PYQVNADVMAMAKDDAIFLHCLPAYRGSEVSAEVIDGPQSRVFDEAENRLHAQKALLVWL 298

Query: 303 FG 304
             
Sbjct: 299 LA 300


>gi|315649810|ref|ZP_07902893.1| ornithine carbamoyltransferase [Paenibacillus vortex V453]
 gi|315274784|gb|EFU38165.1| ornithine carbamoyltransferase [Paenibacillus vortex V453]
          Length = 318

 Score =  278 bits (711), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 132/296 (44%), Positives = 194/296 (65%), Gaps = 5/296 (1%)

Query: 10  DLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHL 69
           +L   S+  +  +++ A +IK   +N    +PL GK + +IFEK STRTR+SFE  M  L
Sbjct: 19  ELDEYSTEEIQFLLDSAIEIKRKQKNGEVYQPLKGKTIGLIFEKSSTRTRISFETGMFQL 78

Query: 70  GGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALT 129
           GG  +FLS +++QLGR E I D A+V+SRY+D +++RT  H  ++ L +YA++PVIN L+
Sbjct: 79  GGHALFLSKNDIQLGRGEPISDMAQVMSRYLDGLMIRTFGHDNVVNLAKYASIPVINGLS 138

Query: 130 DNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSE 189
           D  HPCQ++AD+ T  EH+G +KG   ++ GDGNN+ HSL+ G A+    + +A+P G E
Sbjct: 139 DMAHPCQVLADLQTVLEHKGKLKGLKMAFIGDGNNMAHSLLIGGAKMGMHVALASPKGYE 198

Query: 190 PRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN-QEFKAREEHVFQPF 244
                +    + A   G S+ +  D ++A K A+ ++TD W SM  +E +A+ E  F  +
Sbjct: 199 ADAGIVKLSEDIAAQTGGSITITQDPIEAAKDANVIYTDVWASMGFEEEQAQREVAFADY 258

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           QVN  L+  A PD LF+HCLPAHRGEEV   V+DG  SV+FD+AENRLH QKA+++
Sbjct: 259 QVNEELVKAAKPDYLFLHCLPAHRGEEVSEGVIDGVNSVIFDQAENRLHAQKALMV 314


>gi|323703500|ref|ZP_08115146.1| ornithine carbamoyltransferase [Desulfotomaculum nigrificans DSM
           574]
 gi|323531491|gb|EGB21384.1| ornithine carbamoyltransferase [Desulfotomaculum nigrificans DSM
           574]
          Length = 313

 Score =  278 bits (711), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 140/299 (46%), Positives = 196/299 (65%), Gaps = 5/299 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F  L + +   ++ I++ A ++K   +    +  L GK LAMIF+K STRTRVSFEVA
Sbjct: 11  RDFLSLRDFTGREINFILDEAARLKAMQKAGIPHPYLQGKTLAMIFQKSSTRTRVSFEVA 70

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M HLGG  +FLS  ++Q+GR E++ DTA+VLSRYVD I++RT + S + EL EYATVPVI
Sbjct: 71  MLHLGGHALFLSPRDIQMGRGESVPDTARVLSRYVDGIMIRTFSQSEVEELAEYATVPVI 130

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD THP QI+AD++T +EH+G + G   ++ GDGNNI HSL+ G  +    +++A+P
Sbjct: 131 NGLTDLTHPGQILADLLTVKEHKGQLAGLKLAYIGDGNNIAHSLLLGCPKVGMHISVASP 190

Query: 186 IGSEPRNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMN-QEFKAREEHV 240
            G  P  + +  A+      G  V +  + VQA+  A  V TD W SM  ++ +   E  
Sbjct: 191 EGYRPNPDIVTLAKQAAEETGVKVEVISNPVQAITDADVVVTDVWASMGQEQEQKEREQA 250

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           F  +QVN +L + A PD +F+HCLPAHRGEEV  +++DGP S  +DEAENRLH  KA+L
Sbjct: 251 FAGYQVNQALCAHAKPDYIFLHCLPAHRGEEVTADIIDGPHSAAWDEAENRLHIHKALL 309


>gi|58616767|ref|YP_195966.1| ornithine carbamoyltransferase [Ehrlichia ruminantium str. Gardel]
 gi|58416379|emb|CAI27492.1| Ornithine carbamoyltransferase [Ehrlichia ruminantium str. Gardel]
          Length = 305

 Score =  278 bits (711), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 138/299 (46%), Positives = 195/299 (65%), Gaps = 4/299 (1%)

Query: 8   FADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMK 67
           F DL   +   L  I++    IK   +    NK LS K +A+IF +PSTRTR+SFEV + 
Sbjct: 11  FIDLDLHTYEELRKILDYGSLIKKHPDKY--NKHLSNKNVALIFMQPSTRTRISFEVGVN 68

Query: 68  HLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINA 127
            LGG+ I L     QL R E+I DTAKVLSRYV+ +V+R  +HS LLE  ++++VP+IN+
Sbjct: 69  QLGGNAIVLDWQNSQLTRGESIYDTAKVLSRYVNLVVIRILDHSSLLEFRKHSSVPIINS 128

Query: 128 LTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIG 187
           LT  +HPCQ++ADIMT+EE  GS++    SW GD NN+L S I  A   N+ LN++T   
Sbjct: 129 LTQYSHPCQVLADIMTYEEKMGSIEHATVSWIGDFNNMLVSWIHAATMLNFKLNVSTLEH 188

Query: 188 SEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVN 247
           S+     L  A+ QGA++    +    ++ A+ + TD+W+SM  +   + E  F  +QVN
Sbjct: 189 SKDLELLLESAKKQGANIVYDRNPNNIIQDANVITTDSWVSMGDKNNIKSE--FFNYQVN 246

Query: 248 LSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGII 306
            +L+  A PD +F+HCLPAHRGEEV +E++DGP S +FDEAENRLH QK+I+LWC  ++
Sbjct: 247 ATLLKNARPDYMFLHCLPAHRGEEVTSEIIDGPNSYIFDEAENRLHIQKSIMLWCLNLL 305


>gi|32699598|sp|Q97C32|OTCC_THEVO RecName: Full=Ornithine carbamoyltransferase, catabolic;
           Short=OTCase
 gi|14324487|dbj|BAB59415.1| ornithine/aspartate carbamoyl transferase [Thermoplasma volcanium
           GSS1]
          Length = 305

 Score =  278 bits (711), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 138/288 (47%), Positives = 194/288 (67%), Gaps = 7/288 (2%)

Query: 17  SNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFL 76
           ++L  II ++ ++K +    +E+  L  K+L +IFEKPSTRTR S EVA+  LGG  ++L
Sbjct: 14  NDLDEIINLSIELKKNRYRSYES--LRNKMLGLIFEKPSTRTRTSLEVAIDQLGGHAVYL 71

Query: 77  SGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQ 136
           + SEMQLGR ETI DT  VLSR++DAI  R  +H  ++EL    ++PVINAL D  HP Q
Sbjct: 72  NPSEMQLGRGETISDTGHVLSRFLDAIAYRAFDHKNVVELARSTSIPVINALDDVEHPLQ 131

Query: 137 IIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLN 196
           I+AD MT +E +G   G  FS+ GDGNN+ +SL+ GAA     + +ATP G EP++E+++
Sbjct: 132 IVADFMTVKEKKGKFSGLKFSYIGDGNNMANSLMLGAAILGVDIYVATPHGYEPKSEFVD 191

Query: 197 WARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EHVFQPFQVNLSLM 251
            A+     +G+ V + +DA++A K A  ++TD WISM +E K  E E  F  +Q+N  L+
Sbjct: 192 KAKQVAKERGSKVIITNDAIEAAKDADVIYTDVWISMGEESKRGEKEKAFTKYQINSDLV 251

Query: 252 SMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           S A  D +FMHCLPAHRG EV ++V D   SV+FDEAENRLH++K +L
Sbjct: 252 SNAKKDYIFMHCLPAHRGLEVTDDVADSINSVIFDEAENRLHSEKGVL 299


>gi|289581426|ref|YP_003479892.1| ornithine carbamoyltransferase [Natrialba magadii ATCC 43099]
 gi|289530979|gb|ADD05330.1| ornithine carbamoyltransferase [Natrialba magadii ATCC 43099]
          Length = 323

 Score =  278 bits (711), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 133/302 (44%), Positives = 190/302 (62%), Gaps = 2/302 (0%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           + P+HF ++ ++S   L  ++  A + K + +    ++ LSG+ L MIF+KPSTRTRVSF
Sbjct: 22  SQPRHFLEIDDLSHEELLTVLVRAAEFKRAQQEGTAHEALSGQTLGMIFQKPSTRTRVSF 81

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E  M  LGG  +FL   ++QLGR E + DT++ LSRYVDA++ R   H  +  L E+++V
Sbjct: 82  ETGMTQLGGHAVFLGEDDIQLGRGEPLKDTSRTLSRYVDAVMARVFRHENIEVLAEHSSV 141

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           P+IN LTD+ HPCQ +AD++T  E  G  +    +W GDGNN+  S + GAA  +  + +
Sbjct: 142 PIINGLTDDAHPCQTLADLLTIREEMGGFENVSVAWVGDGNNVGQSFVIGAAMTDMDVTV 201

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREEHVF 241
           ATP G    +  ++ AR  G    + HD V+AV  A  ++TD WISM QE  +      F
Sbjct: 202 ATPPGYSMDDAVIDRARELGGDPTVTHDPVEAVTDADIIYTDVWISMGQEDERDVRMDAF 261

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           + FQV   L++ A PDA  MHCLPAHRGEE+ +E ++  QS+VFD+AENRLH QKA+L W
Sbjct: 262 EGFQVCSDLLAHA-PDASVMHCLPAHRGEEITDEAIESDQSIVFDQAENRLHAQKALLHW 320

Query: 302 CF 303
             
Sbjct: 321 LL 322


>gi|13541103|ref|NP_110791.1| ornithine carbamoyltransferase [Thermoplasma volcanium GSS1]
          Length = 307

 Score =  278 bits (711), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 138/288 (47%), Positives = 194/288 (67%), Gaps = 7/288 (2%)

Query: 17  SNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFL 76
           ++L  II ++ ++K +    +E+  L  K+L +IFEKPSTRTR S EVA+  LGG  ++L
Sbjct: 16  NDLDEIINLSIELKKNRYRSYES--LRNKMLGLIFEKPSTRTRTSLEVAIDQLGGHAVYL 73

Query: 77  SGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQ 136
           + SEMQLGR ETI DT  VLSR++DAI  R  +H  ++EL    ++PVINAL D  HP Q
Sbjct: 74  NPSEMQLGRGETISDTGHVLSRFLDAIAYRAFDHKNVVELARSTSIPVINALDDVEHPLQ 133

Query: 137 IIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLN 196
           I+AD MT +E +G   G  FS+ GDGNN+ +SL+ GAA     + +ATP G EP++E+++
Sbjct: 134 IVADFMTVKEKKGKFSGLKFSYIGDGNNMANSLMLGAAILGVDIYVATPHGYEPKSEFVD 193

Query: 197 WARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EHVFQPFQVNLSLM 251
            A+     +G+ V + +DA++A K A  ++TD WISM +E K  E E  F  +Q+N  L+
Sbjct: 194 KAKQVAKERGSKVIITNDAIEAAKDADVIYTDVWISMGEESKRGEKEKAFTKYQINSDLV 253

Query: 252 SMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           S A  D +FMHCLPAHRG EV ++V D   SV+FDEAENRLH++K +L
Sbjct: 254 SNAKKDYIFMHCLPAHRGLEVTDDVADSINSVIFDEAENRLHSEKGVL 301


>gi|229492690|ref|ZP_04386491.1| ornithine carbamoyltransferase [Rhodococcus erythropolis SK121]
 gi|229320349|gb|EEN86169.1| ornithine carbamoyltransferase [Rhodococcus erythropolis SK121]
          Length = 313

 Score =  278 bits (710), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 139/305 (45%), Positives = 196/305 (64%), Gaps = 10/305 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRVSFEV 64
           KHF    +++ +  + ++E+A  +K   ++ F  +PL G + + +IFEK STRTR SFE+
Sbjct: 3   KHFLRDDDLTPAQQAEVLELAAILK---KDPFARRPLEGPRGVGVIFEKNSTRTRFSFEM 59

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  +GG  + + G   QLGR ET+ DT +VLSRYVDA+V RT    RL ++   AT+P+
Sbjct: 60  GIAQMGGHAVVVDGRSTQLGREETLADTGRVLSRYVDAVVWRTFGQKRLEQMATGATIPI 119

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLNIA 183
           +NAL+D  HPCQ++AD+ T  E +G +KG   ++ GDG NN+ HSL+ G       + IA
Sbjct: 120 VNALSDEFHPCQVLADLQTLIEQKGELKGLKLTYLGDGANNMAHSLMLGGVTAGIDVTIA 179

Query: 184 TPIGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE- 238
           +P G EP +  +  AR +    GA++ L  D    V GA  + TDTW SM QE    +  
Sbjct: 180 SPAGFEPADWVVAAARKRAEETGATITLTQDPQAGVVGADALVTDTWTSMGQENDGLDRV 239

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F+PFQ+N  L++ A P A+ +HCLPAHRGEEV +EVLDGPQSVV+DEAENRLH QKA+
Sbjct: 240 GPFRPFQINKELLAKADPKAVVLHCLPAHRGEEVTDEVLDGPQSVVWDEAENRLHAQKAL 299

Query: 299 LLWCF 303
           L+W  
Sbjct: 300 LVWLL 304


>gi|323140992|ref|ZP_08075902.1| ornithine carbamoyltransferase [Phascolarctobacterium sp. YIT
           12067]
 gi|322414529|gb|EFY05338.1| ornithine carbamoyltransferase [Phascolarctobacterium sp. YIT
           12067]
          Length = 313

 Score =  278 bits (710), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 141/301 (46%), Positives = 195/301 (64%), Gaps = 9/301 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    + ++S   ++ I++VAKK+K   +    ++ L GK LAM+F K STRTR SFEV 
Sbjct: 6   KDLISIHDLSVGEVATILDVAKKLKRKQKAGEPHQYLKGKTLAMLFSKASTRTRTSFEVG 65

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
              LGG  I+LS S  Q+GR E I DTA+VLSR+VD I++RT +H  ++EL +YA+VPVI
Sbjct: 66  FWQLGGHPIYLSDSASQIGRGEPIRDTARVLSRFVDGIMIRTFSHDSVIELAKYASVPVI 125

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ + DI T +E    +KG+   + GDGNN+ HSL+   A+    +  A+P
Sbjct: 126 NGLTDLLHPCQALTDIFTIQEKMKVLKGRKLVYVGDGNNMAHSLMFACAKVGMNMICASP 185

Query: 186 IGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
            G +P  E L  A+      G S+ +  D  +A KGA  ++TD W SM +E  A  E  F
Sbjct: 186 KGYQPDPEILRLAQEDAAQTGCSITVEEDIFKAAKGADVLYTDVWTSMGEE--AEREVRF 243

Query: 242 QP---FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
           +    +Q+N +L++ A P+A+ +HCLPAHRGEE+  EVL+GPQSVVFD+AENRLH QKAI
Sbjct: 244 KALHNYQINQALLNEARPEAIVLHCLPAHRGEEITEEVLEGPQSVVFDQAENRLHVQKAI 303

Query: 299 L 299
           +
Sbjct: 304 M 304


>gi|196034940|ref|ZP_03102347.1| ornithine carbamoyltransferase [Bacillus cereus W]
 gi|229123652|ref|ZP_04252847.1| Ornithine carbamoyltransferase [Bacillus cereus 95/8201]
 gi|195992479|gb|EDX56440.1| ornithine carbamoyltransferase [Bacillus cereus W]
 gi|228659787|gb|EEL15432.1| Ornithine carbamoyltransferase [Bacillus cereus 95/8201]
          Length = 316

 Score =  278 bits (710), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 133/302 (44%), Positives = 192/302 (63%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTQEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR E++ DTAKVLS Y+D I++RT +H+ + E  + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQIGRGESVSDTAKVLSHYIDGIMIRTFSHADVEEFAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E + + +G   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEEKNTFEGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A   GA + + H+   AV  A  ++ D W+SM QE +  +  +F
Sbjct: 188 VGYEPNEEIVKKALAIAEETGAKIEILHNPELAVSEADFIYADVWMSMGQEGEEEKYTIF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINNELVKHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|325295569|ref|YP_004282083.1| ornithine carbamoyltransferase [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325066017|gb|ADY74024.1| Ornithine carbamoyltransferase [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 309

 Score =  278 bits (710), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 141/300 (47%), Positives = 196/300 (65%), Gaps = 5/300 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K F  + +     +  II ++  +K   +     +PL G   A+IFEKPSTRTRVSFEV 
Sbjct: 2   KDFISMVDADRLFIENIISLSSFLKEKQKKGELYRPLEGFTAALIFEKPSTRTRVSFEVG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  I++     QLGR E I DTA+VLSRYV+ IV+RT    R+ EL +Y+ VPVI
Sbjct: 62  VYQLGGHGIYMDNRSSQLGRGEPIKDTARVLSRYVNLIVIRTFGQERVEELAKYSDVPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD  HPCQ++ADI T  E++ ++KG   ++ GDGNN+ +S + GAA        ATP
Sbjct: 122 NALTDEEHPCQVLADIFTIWEYKRNLKGLKVAYVGDGNNMCNSWLIGAAYTGMKFYAATP 181

Query: 186 IGSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHV 240
            G EP  EY+      A++ GA + + ++ ++AVK A  ++TD W SM QE +A + + +
Sbjct: 182 KGFEPLIEYVEKAKEIAKDTGAEIVITNNPIEAVKEADIIYTDVWASMGQEDEAEKRKEI 241

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F P+QVN  L+  A  D LFMHCLPAHRGEEV NE+++  +S+V+D+AENRLHTQKA++L
Sbjct: 242 FMPYQVNRELVKHAKSDFLFMHCLPAHRGEEVTNEIIESDRSIVWDQAENRLHTQKALIL 301


>gi|298527842|ref|ZP_07015246.1| ornithine carbamoyltransferase [Desulfonatronospira thiodismutans
           ASO3-1]
 gi|298511494|gb|EFI35396.1| ornithine carbamoyltransferase [Desulfonatronospira thiodismutans
           ASO3-1]
          Length = 299

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 135/300 (45%), Positives = 196/300 (65%), Gaps = 4/300 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K F  + +++      ++E A  +K      F +  L GK + +IFEK STRT+VSFEV+
Sbjct: 3   KDFLSIRDLTREEAHELVERAHWMKAED---FRSNLLEGKTVILIFEKASTRTKVSFEVS 59

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           + HLGG  +F++ +E QLGR+E + DTA+VLSRY   +V+RT    +L+EL  + +VPVI
Sbjct: 60  INHLGGHHVFMTPAESQLGRSEPLRDTARVLSRYAQGMVVRTFGQDKLVELARHGSVPVI 119

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NAL+D+ HPCQ+++D++T  E     +    +W GDGNN+ HS I  A  F + LNIA P
Sbjct: 120 NALSDDFHPCQVMSDLLTIFERTPEFEALNIAWVGDGNNMSHSWINAAVHFPFRLNIAVP 179

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQ-EFKAREEHVFQPF 244
            G EPR + L  A++ GA++   HD ++AV+ AH + TD W SM Q E K      F  F
Sbjct: 180 RGFEPRADILQEAKDLGANINFTHDPLEAVREAHYINTDVWASMGQEEEKKSRADAFAGF 239

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           +V+  ++  AHP+A  +HCLPAHRGEE+ + V++G +S+V+D+AENRLH QKAIL W +G
Sbjct: 240 RVDDRILEAAHPEARVLHCLPAHRGEEITDAVMEGERSIVWDQAENRLHMQKAILEWIYG 299


>gi|328956772|ref|YP_004374158.1| ornithine carbamoyltransferase [Carnobacterium sp. 17-4]
 gi|328673096|gb|AEB29142.1| ornithine carbamoyltransferase [Carnobacterium sp. 17-4]
          Length = 325

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 142/300 (47%), Positives = 192/300 (64%), Gaps = 6/300 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    + +++   L+ +I+ A  +K  ++    +  L GK L MIFEK STRTRVSFEV 
Sbjct: 17  KDILQVVDLTRKELTALIQDAIVMKQQTKAGIPHPHLQGKTLGMIFEKSSTRTRVSFEVG 76

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLS  ++QLGR E+I DTAKVLSRYVD +++RT  H  + E  E ++VP+I
Sbjct: 77  MTQLGGHALFLSSKDIQLGRGESIADTAKVLSRYVDGLMIRTFGHEIIEEFAENSSVPII 136

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNIL-HSLIEGAARFNYLLNIAT 184
           N LT+  HP Q++AD+MT  E +G ++G   ++ GDGNN + HSL+EGAA     + IA+
Sbjct: 137 NGLTNEHHPMQVLADLMTIYEKKGKLEGLTMAYVGDGNNNMPHSLMEGAAIMGMNMRIAS 196

Query: 185 PIGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-H 239
           P G EP       A+ +    GA++   +D ++AVK A  V TD W SM  E +  E   
Sbjct: 197 PRGYEPLEAVFQHAKTKAEKLGATIHFTYDPIEAVKEADIVVTDVWTSMGMESEETERLT 256

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F P+QVN +L   A  D +F+HCLPAHRGEEV  E++DG  SVVFDEAENRLH QKA+L
Sbjct: 257 AFLPYQVNAALTHYAQEDFIFLHCLPAHRGEEVTAEIIDGNHSVVFDEAENRLHAQKAVL 316


>gi|262376358|ref|ZP_06069587.1| ornithine carbamoyltransferase [Acinetobacter lwoffii SH145]
 gi|262308497|gb|EEY89631.1| ornithine carbamoyltransferase [Acinetobacter lwoffii SH145]
          Length = 306

 Score =  277 bits (709), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 140/295 (47%), Positives = 188/295 (63%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++S+  L+ I++ A ++K    N    +P  GKV+ MIFEK STRTRVSFE  
Sbjct: 4   RHFLTLRDLSTLELNQILQRAIELKRKQHNNEVFQPFVGKVMGMIFEKSSTRTRVSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M   GG  IFLS  + QLGR E I D+A+V+S  +D +++RT  H  +     Y+ VPVI
Sbjct: 64  MSQFGGSAIFLSSRDTQLGRGEPIEDSARVISSMLDIVMIRTFGHDIVERFASYSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+ HPCQ++AD+ T+ E RGS++GK  +W GDGNN+ +S IE A  + + L IA P
Sbjct: 124 NALTDDHHPCQLLADMQTYVEQRGSIEGKTVAWIGDGNNMCNSYIEAAHMWGFNLKIAAP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQPF 244
            G EP+ ++L+        V L   A  A   A  + TD W SM QE + +  E  F  +
Sbjct: 184 KGYEPQEKFLS---EFAHCVELVPSAEDAAVNADLIVTDVWASMGQEEEQKIREKAFADY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QVN  LM +AHPD LFMHCLPAHRGEE+   +LD   +VV+DEAENRLH QKA++
Sbjct: 241 QVNERLMDLAHPDCLFMHCLPAHRGEEISENLLDHKNAVVWDEAENRLHAQKALV 295


>gi|15615457|ref|NP_243760.1| ornithine carbamoyltransferase [Bacillus halodurans C-125]
 gi|32699482|sp|Q9K8V8|OTC_BACHD RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|10175516|dbj|BAB06613.1| ornithine carbamoyltransferase [Bacillus halodurans C-125]
          Length = 319

 Score =  277 bits (709), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 140/286 (48%), Positives = 184/286 (64%), Gaps = 9/286 (3%)

Query: 19  LSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSG 78
           L+  +E+ +K KN     +    L+GK L MIFE  STRTRVSFEV M  LGG  +FLS 
Sbjct: 31  LTQALELKQKAKNGEPTPY----LTGKSLGMIFENASTRTRVSFEVGMTQLGGHALFLSP 86

Query: 79  SEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQII 138
            ++Q+GR E I DTA VLSRYVDAI++RT +H  + EL  YATVPVINALTD  HPCQ +
Sbjct: 87  KDLQIGRGEPIKDTANVLSRYVDAIMIRTNSHESVEELAHYATVPVINALTDAYHPCQAL 146

Query: 139 ADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLN-- 196
           AD +T  E + ++ GK  ++ GDGNN+ HSL+   A+    + +ATP G E   E     
Sbjct: 147 ADALTILEKKETLIGKKLAYIGDGNNVCHSLLAIGAKTGMDVTVATPKGYEVDQEIFQRA 206

Query: 197 --WARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EHVFQPFQVNLSLMSM 253
              A+  GA++    +   A + A  ++TD W SM  E +  E E VFQP+QVN  L+++
Sbjct: 207 TEAAKETGATLVQTTNPQVAAENADAIYTDVWASMGYEAEQSEREEVFQPYQVNDQLLTL 266

Query: 254 AHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           A  D  F+HCLPAHRGEEV   V+DGP S ++D+AENRLH QKA+L
Sbjct: 267 AKKDVSFLHCLPAHRGEEVTASVIDGPHSAIYDQAENRLHAQKAVL 312


>gi|218905268|ref|YP_002453102.1| ornithine carbamoyltransferase [Bacillus cereus AH820]
 gi|228929179|ref|ZP_04092206.1| Ornithine carbamoyltransferase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|218535734|gb|ACK88132.1| ornithine carbamoyltransferase [Bacillus cereus AH820]
 gi|228830469|gb|EEM76079.1| Ornithine carbamoyltransferase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
          Length = 316

 Score =  277 bits (709), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 133/302 (44%), Positives = 192/302 (63%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTQEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR E++ DTAKVLS Y+D I++RT +H+ + E  + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQIGRGESVSDTAKVLSHYIDGIMIRTFSHADVEEFAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E + + +G   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEEKNTFEGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A   GA + + H+   AV  A  ++ D W+SM QE +  +  +F
Sbjct: 188 VGYEPNEEIVKKALAIAEETGAKIEILHNPELAVSEADFIYADVWMSMGQEGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINNELVKHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|288923777|ref|ZP_06417868.1| ornithine carbamoyltransferase [Frankia sp. EUN1f]
 gi|288344877|gb|EFC79315.1| ornithine carbamoyltransferase [Frankia sp. EUN1f]
          Length = 317

 Score =  277 bits (709), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 136/297 (45%), Positives = 196/297 (65%), Gaps = 6/297 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSS-ENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           +HF   ++++SS  + ++++A ++K +  E     +PL G+ +A+IFEKPSTRTR+SF+V
Sbjct: 4   RHFLLDTDLTSSEQAALLDLADRLKATRRERGAAPRPLEGRSVALIFEKPSTRTRLSFDV 63

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           A+  LGG  I +  +  QLGR ETI DTA VLSRYVDAIV+RT    R+  +   ATVPV
Sbjct: 64  AVAELGGHPIVIDSATTQLGRGETIEDTAAVLSRYVDAIVIRTFAQERVERMAAAATVPV 123

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INAL+D+ HPCQ +AD+ T  E RG + G   ++ GDGNN+ HSL+   A     +++A+
Sbjct: 124 INALSDHAHPCQALADLQTIRELRGRLAGLTLTYLGDGNNVAHSLMLAGAMAGMRVHVAS 183

Query: 185 PIGSEPRNEYLNWARNQGASVA----LFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH- 239
           P G EP ++ +  A   GA       + HDA++A   A  ++TD W SM Q+ ++     
Sbjct: 184 PPGYEPFDQVVRQANEIGAVTGGEALVMHDALEAATDADVLYTDVWASMGQDDESDTRAL 243

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
           VFQP++++  ++ +A PDA+ MHCLPAHR  E+   VLDGP+SVVFD+AENRLH QK
Sbjct: 244 VFQPYRLDEKVVEVARPDAIVMHCLPAHRDVEISAAVLDGPRSVVFDQAENRLHAQK 300


>gi|260893668|ref|YP_003239765.1| ornithine carbamoyltransferase [Ammonifex degensii KC4]
 gi|260865809|gb|ACX52915.1| ornithine carbamoyltransferase [Ammonifex degensii KC4]
          Length = 312

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 143/297 (48%), Positives = 196/297 (65%), Gaps = 3/297 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F  +++ +S  +  ++  A ++K + +    +   +GK LAMIF+KPSTRTRVSFEVA
Sbjct: 12  RDFLSIADFTSEEIMGLLSFAAELKEAKKRGETHTFCAGKSLAMIFQKPSTRTRVSFEVA 71

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  ++L+  ++QLGR E+I DT +VLSRYVD  V+RT     + EL E AT+PVI
Sbjct: 72  MFDLGGYALYLNAQDLQLGRGESIADTGRVLSRYVDGCVIRTFRQEEVEELAEAATIPVI 131

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT   HPCQI+AD +T  + +G + G   ++ GDGNNI HSL+ G  R    + +ATP
Sbjct: 132 NGLTSWEHPCQILADFLTILQSKGRLAGLKLAYVGDGNNICHSLLLGCPRVGMSIYVATP 191

Query: 186 IGSEPRNEYLNWARN--QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQ 242
               P    +  A+   +G  V +  D VQAVKGA  V TD W+SM QE +A  ++ VF 
Sbjct: 192 PQYAPHPTVVARAQEAARGTEVVVTEDPVQAVKGADVVVTDVWVSMGQEEEAETKKKVFL 251

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           P+QVN  L+S A PD +F+HCLPAHRGEEV  E++DGP S+V++EAENRLH QKA+L
Sbjct: 252 PYQVNEELVSHAKPDFIFLHCLPAHRGEEVTAEIIDGPHSLVWEEAENRLHVQKALL 308


>gi|288553455|ref|YP_003425390.1| ornithine carbamoyltransferase [Bacillus pseudofirmus OF4]
 gi|288544615|gb|ADC48498.1| ornithine carbamoyltransferase [Bacillus pseudofirmus OF4]
          Length = 318

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 145/300 (48%), Positives = 196/300 (65%), Gaps = 7/300 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F  L + +   ++ +++ A  +K  ++       L+GK L MIFE  STRTRVSFEV 
Sbjct: 15  RDFLTLLDYTPEEVNQLLKTAMLLKAEAKEKSIQPLLNGKSLGMIFENSSTRTRVSFEVG 74

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLS  ++Q+GR E I DTAKVLSRYVDAI++RT +H  + EL  +A VPVI
Sbjct: 75  MTQLGGHALFLSPKDLQIGRGEPIMDTAKVLSRYVDAIMIRTNSHEMVEELAAHADVPVI 134

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKL-FSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           NALTD  HPCQ +AD++T +EH+ + +GK+  ++ GDGNN+ HSL+   A+    + IAT
Sbjct: 135 NALTDAFHPCQALADLLTIKEHKPN-QGKIKMAYVGDGNNVAHSLLAAGAKAGMDVAIAT 193

Query: 185 PIGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREEH 239
           P G E   +  N     A+  GA ++  +D   AV  A  ++TD W SM  E  +A    
Sbjct: 194 PEGYEVNQDIFNQAVEAAKETGAILSQSNDPAYAVNDADVIYTDVWASMGYEAEQAARME 253

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           VF PFQVN +L + A PD LF+HCLPAHRGEEV +EV+DG  SV++D+AENRLH QKAIL
Sbjct: 254 VFTPFQVNEALAAYAKPDYLFLHCLPAHRGEEVTSEVIDGGNSVIYDQAENRLHAQKAIL 313


>gi|228998918|ref|ZP_04158502.1| Ornithine carbamoyltransferase [Bacillus mycoides Rock3-17]
 gi|228760834|gb|EEM09796.1| Ornithine carbamoyltransferase [Bacillus mycoides Rock3-17]
          Length = 316

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 139/299 (46%), Positives = 189/299 (63%), Gaps = 8/299 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K           L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTQEEIIALIEFAMYLKKEKHEPL----LEGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQLGR E++ DTAKVLS Y+D I++RT +H+ + EL + A++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQLGRGESVSDTAKVLSHYIDGIMIRTFSHADVEELAKEASIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEEVHTFKGIKLAYLGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
            G EP  +     L  A   GA++ + +D   AVKGA  ++TD W+SM QE    +  +F
Sbjct: 188 PGYEPNEQIVKRALEIANETGANIEVLNDPELAVKGADFIYTDVWMSMGQEDTEGKYQLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           QPFQVN  L+  A     F+HCLPAHR EEV  E++DG  SVVF++A NRLH QKA+L+
Sbjct: 248 QPFQVNEKLVQHAKATYRFLHCLPAHREEEVTGEIIDGSHSVVFEQAGNRLHAQKALLV 306


>gi|154150382|ref|YP_001404000.1| ornithine carbamoyltransferase [Candidatus Methanoregula boonei
           6A8]
 gi|153998934|gb|ABS55357.1| ornithine carbamoyltransferase [Methanoregula boonei 6A8]
          Length = 303

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 140/296 (47%), Positives = 192/296 (64%), Gaps = 1/296 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K F  + +I+ + L  I+  A+++K   +    ++ L G  LAMIFEK STRT +SFEV 
Sbjct: 3   KDFLSILDITKTELDEILIDAERLKRQKKAGVPHELLRGMSLAMIFEKSSTRTHISFEVG 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FL+  ++Q+GR E I DTA+V SRYV AI++R   HS +++L E ATVPVI
Sbjct: 63  MHELGGHALFLNAKDLQIGRGEEIRDTARVASRYVSAIMIRAYRHSTVVDLAENATVPVI 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D  HPCQ++ADI+T +EH G V+G   +W GDGNN+ +SL+  +A     + +A P
Sbjct: 123 NGLSDIEHPCQLLADILTIKEHFGKVRGLKVAWVGDGNNVCNSLVLSSALTGMEIAVAGP 182

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREEHVFQPF 244
            G E   E +  A+  G  V        AVK AH + TDTWISM  E  + +    F+ F
Sbjct: 183 KGYEIAPELVEKAQALGGRVTRVKTPQDAVKDAHVIVTDTWISMGDEAEQEKRRAAFKGF 242

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
            VN +L+  A PDA  +HCLPAHRGEE+  +VLDGP+S+V+DEAENRLH QKA+L+
Sbjct: 243 TVNDALLRHASPDARVLHCLPAHRGEEITGDVLDGPKSLVWDEAENRLHAQKALLV 298


>gi|57238781|ref|YP_179917.1| ornithine carbamoyltransferase [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58578705|ref|YP_196917.1| ornithine carbamoyltransferase [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57160860|emb|CAH57762.1| ornithine carbamoyltransferase [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58417331|emb|CAI26535.1| Ornithine carbamoyltransferase [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 305

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 138/299 (46%), Positives = 194/299 (64%), Gaps = 4/299 (1%)

Query: 8   FADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMK 67
           F DL   +   L  I++    IK   +    NK LS K +A+IF +PSTRTR+SFEV + 
Sbjct: 11  FIDLDLHTYEELRKILDYGSLIKKHPDKY--NKHLSNKNVALIFMQPSTRTRISFEVGVN 68

Query: 68  HLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINA 127
            LGG  I L     QL R E+I DTAKVLSRYV+ +V+R  +HS LLE  ++++VP+IN+
Sbjct: 69  QLGGSAIVLDWQNSQLTRGESIYDTAKVLSRYVNLVVIRILDHSSLLEFRKHSSVPIINS 128

Query: 128 LTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIG 187
           LT  +HPCQ++ADIMT+EE  GS++    SW GD NN+L S I  A   N+ LN++T   
Sbjct: 129 LTQYSHPCQVLADIMTYEEKIGSIEHATVSWIGDFNNMLVSWIHAATMLNFKLNVSTLEH 188

Query: 188 SEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVN 247
           S+     L  A+ QGA++    +    ++ A+ + TD+W+SM  +   + E  F  +QVN
Sbjct: 189 SKDLELLLESAKKQGANIVYDRNPNNIIQDANVITTDSWVSMGDKNNIKSE--FFNYQVN 246

Query: 248 LSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGII 306
            +L+  A PD +F+HCLPAHRGEEV +E++DGP S +FDEAENRLH QK+I+LWC  ++
Sbjct: 247 ATLLKNARPDYMFLHCLPAHRGEEVTSEIIDGPNSYIFDEAENRLHIQKSIMLWCLNLL 305


>gi|118473037|ref|YP_888066.1| ornithine carbamoyltransferase [Mycobacterium smegmatis str. MC2
           155]
 gi|171472981|sp|A0QYS8|OTC_MYCS2 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|118174324|gb|ABK75220.1| ornithine carbamoyltransferase [Mycobacterium smegmatis str. MC2
           155]
          Length = 307

 Score =  276 bits (707), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 141/305 (46%), Positives = 190/305 (62%), Gaps = 10/305 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRVSFEV 64
           +HF    ++S    + ++ +A  +K +    F  +PL G + +A+IFEK STRTR SFE+
Sbjct: 3   RHFLRDDDLSPEEQAEVLTLAADLKKTP---FSRRPLEGPRGVAVIFEKNSTRTRFSFEM 59

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG  I + G   QLGR ET+ DT  VLSRYVDAIV RT    RL  +   A+VP+
Sbjct: 60  GIAQLGGHAIVVDGRSTQLGREETLEDTGAVLSRYVDAIVWRTFAQERLTAMASGASVPI 119

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLNIA 183
           +NAL+D  HPCQ++AD+ T  E +G + G   ++ GDG NN+ HSL+ G       + IA
Sbjct: 120 VNALSDEFHPCQVLADLQTLAERKGKLAGLRMTYFGDGANNMAHSLMLGGVTAGVHVTIA 179

Query: 184 TPIGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE- 238
            P G EP   +++ AR +    GA+VAL  DA     GA  + TDTW SM QE    +  
Sbjct: 180 APDGFEPDPRFVDAARRRAAETGATVALTKDAKAGADGADVLVTDTWTSMGQENDGLDRV 239

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F+PFQVN  L+ +A P A+ +HCLPAHRG E+ +EV+DGPQS VFDEAENRLH QKA+
Sbjct: 240 RPFRPFQVNADLLELADPAAVVLHCLPAHRGHEITDEVIDGPQSAVFDEAENRLHAQKAL 299

Query: 299 LLWCF 303
           L+W  
Sbjct: 300 LVWLL 304


>gi|219852931|ref|YP_002467363.1| ornithine carbamoyltransferase [Methanosphaerula palustris E1-9c]
 gi|219547190|gb|ACL17640.1| ornithine carbamoyltransferase [Methanosphaerula palustris E1-9c]
          Length = 303

 Score =  276 bits (707), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 135/289 (46%), Positives = 187/289 (64%), Gaps = 1/289 (0%)

Query: 13  NISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGD 72
           ++ + +L  I++ A  +K   +   E+  L+GK LAMIFEKPSTRTR+SFEV M  LGG 
Sbjct: 10  DLKAEDLEQIMQDAATLKTLRKEGKEHPVLAGKNLAMIFEKPSTRTRISFEVGMNDLGGH 69

Query: 73  TIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNT 132
            + L+  +MQLGR E + DTA+V+SRY   +++R   HS + E   ++T+PVIN L+D  
Sbjct: 70  ALHLNHKDMQLGRGEEVRDTARVISRYASGVMIRAFLHSTITEFAAHSTIPVINGLSDKE 129

Query: 133 HPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRN 192
           HPCQ++ADI T  E+ GS +    +W GDGNN+ +SLI  +      L +ATP G  P  
Sbjct: 130 HPCQLLADIFTIREYFGSTEDIRVAWVGDGNNVCNSLILASGLTGMDLRVATPDGYRPDP 189

Query: 193 EYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREEHVFQPFQVNLSLM 251
             +   R  G  V +F+   +AVK A  +FTDTWISM  E  +A+    F  + V+ +L+
Sbjct: 190 AVVERGRTVGGKVTVFNSPEEAVKDAEVIFTDTWISMGDETQQAQRVKAFAGYTVDEALL 249

Query: 252 SMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
             A PDA+ MHCLPAHRG+E+ +EVLDGP S V+DEAENRLH QKA+L+
Sbjct: 250 KKADPDAIVMHCLPAHRGQEITDEVLDGPHSAVWDEAENRLHVQKAVLV 298


>gi|229019344|ref|ZP_04176168.1| Ornithine carbamoyltransferase [Bacillus cereus AH1273]
 gi|229025590|ref|ZP_04181997.1| Ornithine carbamoyltransferase [Bacillus cereus AH1272]
 gi|228735684|gb|EEL86272.1| Ornithine carbamoyltransferase [Bacillus cereus AH1272]
 gi|228741912|gb|EEL92088.1| Ornithine carbamoyltransferase [Bacillus cereus AH1273]
          Length = 316

 Score =  276 bits (707), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 135/302 (44%), Positives = 192/302 (63%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTQEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR E++ DTAKVLS Y+D I++RT +H+ + EL + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQIGRGESVSDTAKVLSHYIDGIMIRTFSHADVEELAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + K    ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEEVKTFKRIKLAYVGDGNNVCHSLLLASAKVGMNMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A   GA + + H+   AV  A  ++TD W+SM QE +  +  +F
Sbjct: 188 VGYEPNEEIVKKALAIAEETGAEIEILHNPKLAVNEADFIYTDVWMSMGQEGEEEKYTLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINKELVMHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|258513891|ref|YP_003190113.1| ornithine carbamoyltransferase [Desulfotomaculum acetoxidans DSM
           771]
 gi|257777596|gb|ACV61490.1| ornithine carbamoyltransferase [Desulfotomaculum acetoxidans DSM
           771]
          Length = 320

 Score =  276 bits (707), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 143/300 (47%), Positives = 191/300 (63%), Gaps = 7/300 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F  L + S+  +  +I VA ++K   +    +  L GK LAMIF+K STRTRVSFEVA
Sbjct: 16  RDFLLLLDFSAEEIKHLINVAVELKAIQKKGEPHPYLQGKTLAMIFQKSSTRTRVSFEVA 75

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLS +++Q+GR ETI DTA+ LSRYVD I++RT   S + EL EYA +PVI
Sbjct: 76  MYQLGGYPLFLSSNDLQMGRGETIADTARTLSRYVDGIMIRTYAQSDVEELAEYADIPVI 135

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HP Q+IAD+ T  EH+G + G   ++ GDGNN+ HSL+ G A+    + +A P
Sbjct: 136 NGLTDLVHPTQVIADLQTVLEHKGKLAGLKMAFLGDGNNVAHSLMAGCAKVGMNITLANP 195

Query: 186 IGSEPRNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH-- 239
            G +P  E +  A+      G+ + +  D V AVK A  ++TD W SM QE K +EE   
Sbjct: 196 AGYKPLPEMVEKAKQVAETTGSIIEIIEDPVAAVKDADVIYTDVWASMGQE-KEQEERAK 254

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           +  P+QVN  L+  A PD +F+HCLPA R +EV +E+LD   S  FDEAENRLH  KAIL
Sbjct: 255 MMAPYQVNAELVRHAKPDYIFLHCLPAKREQEVTSEILDSNHSAAFDEAENRLHAHKAIL 314


>gi|188996483|ref|YP_001930734.1| ornithine carbamoyltransferase [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188931550|gb|ACD66180.1| ornithine carbamoyltransferase [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 304

 Score =  276 bits (706), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 129/302 (42%), Positives = 200/302 (66%), Gaps = 7/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F   +++S   +  II+ AKK+K      F ++ L GK + +IF K STRTR+SFEV 
Sbjct: 3   RDFVSFTDLSREEVLGIIDYAKKLKKDK---FADRTLEGKSIGLIFMKQSTRTRLSFEVG 59

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  +GG  I++SGS  QL R E I DTA+V+SRY+D IV+RT +H  + EL +Y ++PVI
Sbjct: 60  VYQMGGQPIYISGSTTQLSRGEDIKDTARVMSRYLDGIVIRTFSHQEVEELAKYGSIPVI 119

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD  HPCQ++AD+MT +E  GS++ K  ++ GDGNN+ ++L+   A     +++ATP
Sbjct: 120 NALTDYQHPCQVLADLMTIDEEFGSLENKKVAYVGDGNNMANTLLLACALMGMDISVATP 179

Query: 186 IGSEPRN----EYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
              EP +    E ++ A+  G+ + + +D  +AV  A  ++TD W+SM QE +  ++ VF
Sbjct: 180 PNYEPNSKAVYESVDIAKKTGSKITITNDPKEAVLEADVIYTDVWVSMGQENEKGKKDVF 239

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           +PF VN  L+ +A P+A+ MHCLPAH+GEE+  +V +    V+F++AENRLH QK+++ +
Sbjct: 240 KPFTVNKDLVLLAKPNAIVMHCLPAHKGEEITEDVFEQYSDVIFNQAENRLHVQKSLMSF 299

Query: 302 CF 303
            F
Sbjct: 300 LF 301


>gi|85859273|ref|YP_461475.1| ornithine carbamoyltransferase [Syntrophus aciditrophicus SB]
 gi|123516497|sp|Q2LT98|OTC_SYNAS RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|85722364|gb|ABC77307.1| ornithine carbamoyltransferase [Syntrophus aciditrophicus SB]
          Length = 302

 Score =  276 bits (706), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 136/296 (45%), Positives = 190/296 (64%), Gaps = 2/296 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    + ++ + +   I E A+ +K+  E      PL GK L MIF+K STRTR+SFEV 
Sbjct: 3   KDLLSIYDLEAGDFKAIFEKARHLKSVHEQGVAYTPLKGKTLGMIFDKSSTRTRISFEVG 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLS  + QLGR ET+ D+A+++SRY++ I++RT +H  + E   +AT+PVI
Sbjct: 63  MYQLGGLALFLSNRDTQLGRGETVADSARIMSRYLNGIMIRTFSHLIIEEFAAHATIPVI 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQI++D+ T  E +GS +     + GDGNNI +S I  AAR  + L ++ P
Sbjct: 123 NGLTDLLHPCQILSDLFTIIEKKGSYERLKIVYVGDGNNIANSWINAAARLPFHLALSCP 182

Query: 186 IGSEPRNEYLNWARNQGA-SVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQP 243
            G +P +  L+    +    V+L  D  +AV+ A  V+TD W SM QE +      VF+P
Sbjct: 183 EGYDPDSGILDRGVKEAKEGVSLMRDPYEAVRNADVVYTDVWASMGQEAEQEARARVFRP 242

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           +Q+N +L+S A  DA+ MHCLPAHRGEE+   VLDGP+SV+ D+AENRLH QKAIL
Sbjct: 243 YQINEALLSPAKKDAIVMHCLPAHRGEEITAAVLDGPRSVIIDQAENRLHVQKAIL 298


>gi|229006445|ref|ZP_04164103.1| Ornithine carbamoyltransferase [Bacillus mycoides Rock1-4]
 gi|228754808|gb|EEM04195.1| Ornithine carbamoyltransferase [Bacillus mycoides Rock1-4]
          Length = 316

 Score =  276 bits (706), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 138/299 (46%), Positives = 189/299 (63%), Gaps = 8/299 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  ++E A  +K           L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTQEEIIALVEFAMYLKKEKHEPL----LEGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQLGR E++ DTAKVLS Y+D I++RT +H+ + EL + A++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQLGRGESVSDTAKVLSHYIDGIMIRTFSHADVEELAKEASIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEEVHTFKGIKLAYLGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
            G EP  +     L  A   GA++ + +D   AVKGA  ++TD W+SM QE    +  +F
Sbjct: 188 PGYEPNEQIVKRALEIANETGANIEVLNDPELAVKGADFIYTDVWMSMGQEDTEGKYQLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           QPFQVN  L+  A     F+HCLPAHR EEV  E++DG  SVVF++A NRLH QKA+L+
Sbjct: 248 QPFQVNEKLVQHAKATYRFLHCLPAHREEEVTGEIIDGSHSVVFEQAGNRLHAQKALLV 306


>gi|91773048|ref|YP_565740.1| ornithine carbamoyltransferase [Methanococcoides burtonii DSM 6242]
 gi|91712063|gb|ABE51990.1| Ornithine carbamoyltransferase [Methanococcoides burtonii DSM 6242]
          Length = 301

 Score =  276 bits (706), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 135/297 (45%), Positives = 192/297 (64%), Gaps = 3/297 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH   +++++   +  I+++A+ +K           L  K LAMIFEK STRTRVSFEVA
Sbjct: 2   KHLISMTDLTQEEIIEILDMAEDLKEKRLRGKMTDLLKNKSLAMIFEKSSTRTRVSFEVA 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG +I+L+  ++Q+GR ET+ DTA+VLSRYV  I  R  +H  + +L +++ VPVI
Sbjct: 62  MSDLGGHSIYLNSRDIQIGRGETVSDTAQVLSRYVAGITARVNSHRTVEDLAKHSNVPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NAL+D  HPCQI+AD +T  E++  + G  F+W GDGNN+ +SLI G A     + +A P
Sbjct: 122 NALSDLEHPCQILADFLTIREYKNRLNGLKFAWIGDGNNVCNSLILGCALVGMQIAVACP 181

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV--FQP 243
            G  P  E +   R  G  + +  D  +A   A  ++ D W+SM  E + RE+ +   + 
Sbjct: 182 EGYMPNPEIVAKGRELGGDILITTDPEEAAADADVLYADVWVSMGDE-EEREKRLSDLEN 240

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           +Q+N +L+ +A PD +FMHCLPAHRGEEV  EV+DGP SVVFD+AENRLH QKA+L+
Sbjct: 241 YQINSNLVELAKPDVIFMHCLPAHRGEEVSAEVMDGPHSVVFDQAENRLHAQKALLM 297


>gi|261855943|ref|YP_003263226.1| ornithine carbamoyltransferase [Halothiobacillus neapolitanus c2]
 gi|261836412|gb|ACX96179.1| ornithine carbamoyltransferase [Halothiobacillus neapolitanus c2]
          Length = 312

 Score =  276 bits (706), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 142/295 (48%), Positives = 190/295 (64%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L + S ++   I+  A+ +K + +       L  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSLLDYSQADYRRILARAEALKKAYDAGVRPDTLRQRVLGMIFEKASTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  IFLS  + QLGR E I D+A+V+SR VDA+++R  +H  + +   Y+ VPVI
Sbjct: 64  IAQLGGTAIFLSPRDTQLGRGEPIEDSARVISRMVDAVMIRAKDHHMVEQFAAYSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD  HPCQ++AD+  FE++RGS++GK  +W GDG N+ HS I  A  F++ L IATP
Sbjct: 124 NALTDLNHPCQLLADVFAFEQNRGSIQGKRVAWIGDGFNMCHSYINAAQVFDFELMIATP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREEHVFQPF 244
            G +P    +  A   G  V +   A +A  GA  V TD W SM QE  + R    F+ F
Sbjct: 184 EGYQPDPAVVAAA---GDRVHIVRTAHEAASGADLVVTDVWASMGQEDERERRLRDFKTF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            ++  +M+ A+ DALFMHCLPAHRGEEV  EV+DGPQSVV+ EAE RLHTQKA+L
Sbjct: 241 VIDDGVMAHANSDALFMHCLPAHRGEEVTAEVIDGPQSVVWQEAEARLHTQKALL 295


>gi|68171575|ref|ZP_00544949.1| Ornithine carbamoyltransferase [Ehrlichia chaffeensis str. Sapulpa]
 gi|88658104|ref|YP_506907.1| ornithine carbamoyltransferase [Ehrlichia chaffeensis str.
           Arkansas]
 gi|67999001|gb|EAM85678.1| Ornithine carbamoyltransferase [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599561|gb|ABD45030.1| ornithine carbamoyltransferase [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 303

 Score =  276 bits (705), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 140/299 (46%), Positives = 194/299 (64%), Gaps = 4/299 (1%)

Query: 8   FADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMK 67
           F DL+  +   L  I++ +  IK        +K L  K +A+IF +PSTRTR+SFEV + 
Sbjct: 9   FTDLNLHTKEELRTILDYSSIIKKKPNQY--SKHLLNKNIALIFLQPSTRTRISFEVGIN 66

Query: 68  HLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINA 127
            LGG+ I L+  + QL R E+I DTAKVLSRYVD IV+R   H+ LLEL +++TVPVIN+
Sbjct: 67  QLGGNAIILNEKDTQLTRGESIYDTAKVLSRYVDLIVIRILEHNSLLELDKHSTVPVINS 126

Query: 128 LTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIG 187
           LT ++HPCQ++ADIMT+EE  G ++    SW GD NN+L S I  A   N+ LNI+T   
Sbjct: 127 LTQHSHPCQVLADIMTYEEKTGPIENATVSWIGDFNNMLVSWIHAATVLNFKLNISTLEY 186

Query: 188 SEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVN 247
           S+  +  L  A+ +G ++    +    +  A  + TD+WISM  E   + E  F  +QVN
Sbjct: 187 SKNLDLLLKSAQEKGNNITYDANPHNIISDADIITTDSWISMGYENNIKTE--FFKYQVN 244

Query: 248 LSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGII 306
             L+  A P+ +F+HCLPAHRGEEV +E++DGP S +FDEAENRLH QKAI+LWC  ++
Sbjct: 245 AKLLEKAKPNYMFLHCLPAHRGEEVTSEIIDGPNSYIFDEAENRLHIQKAIMLWCLNLL 303


>gi|158313577|ref|YP_001506085.1| ornithine carbamoyltransferase [Frankia sp. EAN1pec]
 gi|254772726|sp|A8LE44|OTC_FRASN RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|158108982|gb|ABW11179.1| ornithine carbamoyltransferase [Frankia sp. EAN1pec]
          Length = 317

 Score =  276 bits (705), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 139/304 (45%), Positives = 199/304 (65%), Gaps = 6/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIF-ENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           +HF   ++++SS  + ++++A ++K +  +     +PL G+ +A+IFEKPSTRTR+SF+V
Sbjct: 4   RHFLLDTDLTSSEQAALLDLADQLKATRRDRKPARRPLEGRSVALIFEKPSTRTRLSFDV 63

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           A+  LGG  I +     QLGR ETI DTA VLSRYVDAIV+RT    R+  +   ATVPV
Sbjct: 64  AVAELGGHPIVIDSGSSQLGRGETIEDTAAVLSRYVDAIVIRTFAQDRVDRMAAAATVPV 123

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INAL+D+THPCQ +AD+ T  E RG + G   ++ GDGNN+ HSL+   A     +++A+
Sbjct: 124 INALSDHTHPCQALADLQTIREIRGRLAGVTLAYLGDGNNVAHSLLLAGALAGLRVHVAS 183

Query: 185 PIGSEPRNEYLNWARNQGASVA----LFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH- 239
           P G EP  + +  A   GA       + HDA++A  GA  ++TD W SM Q+ ++     
Sbjct: 184 PPGYEPIEQVVRHANEIGAVTGGEALVTHDALEAAAGADVLYTDVWASMGQDTESDSRAL 243

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           VFQP++++  ++  A PDA+ MHCLPAHR  E+   VLDGP+SVVFD+AENRLH QKA+L
Sbjct: 244 VFQPYRLDEKVVEAASPDAIVMHCLPAHREMEISAAVLDGPRSVVFDQAENRLHAQKALL 303

Query: 300 LWCF 303
            +  
Sbjct: 304 SFLL 307


>gi|111224577|ref|YP_715371.1| ornithine carbamoyltransferase [Frankia alni ACN14a]
 gi|111152109|emb|CAJ63837.1| Ornithine carbamoyltransferase (OTCase) [Frankia alni ACN14a]
          Length = 342

 Score =  276 bits (705), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 135/297 (45%), Positives = 192/297 (64%), Gaps = 6/297 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIF-ENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           +HF   ++++S+  + I++VA ++K    +    ++PL+G+ +A++FEKPSTRTR+SF+V
Sbjct: 4   RHFLLDTDLTSAEQAGILDVADQLKARRRDPGPADRPLAGRSVALLFEKPSTRTRLSFDV 63

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG  I +  +   LGR ETI DTA VLSRYVDAIV+RT    RL  L   A+VPV
Sbjct: 64  GVAELGGHPIVIDATTSHLGRGETIEDTAAVLSRYVDAIVVRTFAQQRLERLAAAASVPV 123

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           +NAL+D+ HPCQ +AD+ T  E RG + G   ++ GDGNN+ HSL+   A     +++A+
Sbjct: 124 VNALSDHAHPCQALADLQTIRERRGRLAGLTLTYLGDGNNVAHSLLLAGALAGMRVHVAS 183

Query: 185 PIGSEPRNEYLNWARNQGASVA----LFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH- 239
           P G EP  + +  A   GA+      + HDA++A  GA  ++TD W SM QE ++     
Sbjct: 184 PPGYEPFEQVVRHANEIGATTGGEALVMHDALEAAAGADVLYTDVWASMGQEDESDSRSL 243

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
           VFQP++++   +  A PD L MHCLPAHR  E+   VLDGP SVVFD+AENRLH QK
Sbjct: 244 VFQPYRLDEKAVEAARPDVLVMHCLPAHRDLEIAASVLDGPHSVVFDQAENRLHAQK 300


>gi|39995263|ref|NP_951214.1| ornithine carbamoyltransferase [Geobacter sulfurreducens PCA]
 gi|56404386|sp|Q74GU2|OTC_GEOSL RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|39982025|gb|AAR33487.1| ornithine carbamoyltransferase [Geobacter sulfurreducens PCA]
 gi|298504268|gb|ADI82991.1| ornithine carbamoyltransferase [Geobacter sulfurreducens KN400]
          Length = 303

 Score =  276 bits (705), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 129/296 (43%), Positives = 196/296 (66%), Gaps = 2/296 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L+  +   L  +  +++++K+  +    ++ L GK +A+IFEK STRTRVSFEV 
Sbjct: 3   RHFLALNQFTKEELDGLFTLSRELKDKQKQGVPHRLLEGKSVALIFEKSSTRTRVSFEVG 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LG   +F+S +  Q+GR E I DTA+V++RY D +++RT     + E   Y++VPVI
Sbjct: 63  VAQLGAHPLFISSATSQMGRGEPIKDTARVMARYCDGVMIRTYGQEIVEEFARYSSVPVI 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQI+AD+ T  E++G  +G  F+W GDGNN+ ++ IE AA   + L +A P
Sbjct: 123 NGLTDLFHPCQIMADLFTVIEYKGGYQGLKFAWVGDGNNMANTWIEAAAILGFDLALACP 182

Query: 186 IGSEPRNEYLNWARNQG-ASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EHVFQP 243
            G EP  +  +WA+ +  +S+ +  D  +AV+ A  V TD W SM QE + +E E  FQ 
Sbjct: 183 TGYEPDRQVWDWAQQRATSSITITEDPEEAVRDADVVNTDVWASMGQEQEQKEREAAFQG 242

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + ++ +L+++A PD + +HCLPAHRGEE+ + V++GP+S V+DEAENRLH QKAI+
Sbjct: 243 YCLDDALVALARPDCMVLHCLPAHRGEEITDSVIEGPRSAVWDEAENRLHIQKAIM 298


>gi|227825140|ref|ZP_03989972.1| ornithine carbamoyltransferase [Acidaminococcus sp. D21]
 gi|226905639|gb|EEH91557.1| ornithine carbamoyltransferase [Acidaminococcus sp. D21]
          Length = 313

 Score =  275 bits (704), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 135/300 (45%), Positives = 196/300 (65%), Gaps = 7/300 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    + ++S   ++ I++V++K+K   +    ++ L GK LAMIF K STRTRVSFE  
Sbjct: 6   KDLISIHDLSVGEVATILDVSRKLKKKQKMGEPHEYLKGKTLAMIFSKASTRTRVSFETG 65

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
              LGG  I++S +  Q+GR E + DTA+VLSR+VD I++RT +H  + EL  YA+VPVI
Sbjct: 66  FHQLGGHPIYMSEATSQIGRGEPVKDTARVLSRFVDGIMIRTYSHEAVKELAAYASVPVI 125

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ + D+ T  E++  +KG+   + GDGNN+ HSL+   A+    +  A+P
Sbjct: 126 NGLTDLLHPCQALTDLFTIMEYKEVLKGRKLVFVGDGNNMAHSLMYACAKVGMNMVCASP 185

Query: 186 IGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV- 240
            G  P  + L  A+      GAS+ +  D ++A +GA  ++TD W SM +E +  EE V 
Sbjct: 186 KGYYPDPQVLKQAQEDAALTGASITVEEDVMKAAEGADVLYTDVWASMGEEAE-HEERVK 244

Query: 241 -FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            FQ +Q+N +L+ +A PDA+ +HCLPAHRGEE+ ++V++GP S VFDEAENRLH QKAI+
Sbjct: 245 KFQGYQINQALLDVARPDAMVLHCLPAHRGEEITDDVIEGPHSAVFDEAENRLHVQKAIM 304


>gi|254775565|ref|ZP_05217081.1| ornithine carbamoyltransferase [Mycobacterium avium subsp. avium
           ATCC 25291]
          Length = 309

 Score =  275 bits (704), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 141/306 (46%), Positives = 195/306 (63%), Gaps = 10/306 (3%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRVSFE 63
           P+HF    ++S +  + ++ +A ++K   ++ F  +PL G + +A++F+K STRTR SFE
Sbjct: 3   PRHFLRDDDLSPAEQAEVLALAAELK---KDPFSARPLEGPRGVAVLFDKNSTRTRFSFE 59

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V +  LGG  + +     QLGR ET+ DTA+VLSRYV+AIV RT    RL  +   ATVP
Sbjct: 60  VGIAQLGGHAVVVDARSTQLGRDETLEDTARVLSRYVEAIVWRTFEQQRLEAMAGAATVP 119

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLNI 182
           VINAL+D  HPCQ++AD+    EH+GS+ G    + GDG NN+ HSL+ G       + I
Sbjct: 120 VINALSDEFHPCQVLADLQAIAEHKGSLSGLRMCYLGDGANNMAHSLMLGGVTAGIHVTI 179

Query: 183 ATPIGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE 238
           A P G  P  E++  AR +    GA+V L  DA  A +G   + TDTW SM QE    + 
Sbjct: 180 AAPDGFTPAPEFVAAARRRAESTGATVTLTTDARAAARGVDVLVTDTWTSMGQEDDGLDR 239

Query: 239 HV-FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
              F P+Q+N  L+S+A P+A+ +HCLPAHRGEE+ +EV+DGP SVV+DEAENRLH QKA
Sbjct: 240 RTPFWPYQLNADLVSLADPEAIVLHCLPAHRGEEITDEVMDGPSSVVWDEAENRLHAQKA 299

Query: 298 ILLWCF 303
           +L W  
Sbjct: 300 LLTWLL 305


>gi|228992873|ref|ZP_04152798.1| Ornithine carbamoyltransferase [Bacillus pseudomycoides DSM 12442]
 gi|228766922|gb|EEM15560.1| Ornithine carbamoyltransferase [Bacillus pseudomycoides DSM 12442]
          Length = 316

 Score =  275 bits (704), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 139/299 (46%), Positives = 188/299 (62%), Gaps = 8/299 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K           L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTQEEIIALIEFAMYLKKEKHEPL----LEGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQLGR E++ DTAKVLS Y+D I++RT +H+ + EL + A++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQLGRGESVSDTAKVLSHYIDGIMIRTFSHADVEELAKEASIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E   + KG   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEEVHTFKGIKLAYLGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
            G EP  +     L  A   GA++ + +D   AVKGA  ++TD W+SM QE    +  +F
Sbjct: 188 PGYEPNEQIVKRALEIANETGANIEVLNDPELAVKGADFIYTDVWMSMGQEDTEGKYQLF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           QPFQVN  L+  A     F+HCLPAHR EEV  E++DG  SVVF +A NRLH QKA+L+
Sbjct: 248 QPFQVNEKLVQHAKATYRFLHCLPAHREEEVTGEIIDGSHSVVFAQAGNRLHAQKALLV 306


>gi|326315993|ref|YP_004233665.1| ornithine carbamoyltransferase [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323372829|gb|ADX45098.1| ornithine carbamoyltransferase [Acidovorax avenae subsp. avenae
           ATCC 19860]
          Length = 309

 Score =  275 bits (704), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 135/296 (45%), Positives = 196/296 (66%), Gaps = 5/296 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH+    ++S  + + + E A  IK   ++  ++ PL+ + LAMIFEK STRTRVSFE  
Sbjct: 8   KHYLQFKDLSPEDYAYLFERAAVIKGKFKSYEKHHPLTDRTLAMIFEKASTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  + L+  + QLGRAE I D+AKV+SR VD +++RT   +++     ++ VPVI
Sbjct: 68  MYQLGGSVVHLTTGDSQLGRAEPIEDSAKVISRMVDLVMIRTYEQTKIERFAAHSRVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI TF EHRGS++G+  +W GDGNN+ ++ ++ A    + ++++TP
Sbjct: 128 NGLTNEFHPCQILADIFTFIEHRGSIQGRTVAWVGDGNNMANTWLQAAELLGFTVHVSTP 187

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF--KAREEHVFQP 243
            G E  +     A   G+   +F D ++A +GA  + TD W SM  E   +AR++  F  
Sbjct: 188 SGYEVDSRIAGVA--AGSHYKVFSDPLEACRGADLITTDVWTSMGYEAENEARKK-AFAD 244

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + V+  +M+ A PDALFMHCLPAHRGEEV  +V+DGPQSVV+DEAENR+H QKA++
Sbjct: 245 WCVDAEMMAAARPDALFMHCLPAHRGEEVEADVIDGPQSVVWDEAENRMHVQKALM 300


>gi|291280007|ref|YP_003496842.1| ornithine carbamoyltransferase [Deferribacter desulfuricans SSM1]
 gi|290754709|dbj|BAI81086.1| ornithine carbamoyltransferase [Deferribacter desulfuricans SSM1]
          Length = 310

 Score =  275 bits (704), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 140/303 (46%), Positives = 194/303 (64%), Gaps = 5/303 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F  L++ S+  L  +IE A K+K   +N    K L  K +A+IFEK STRTRVSFEV 
Sbjct: 3   RDFLTLADFSTQELKEMIESAIKLKEERKNGIFRKYLENKKVALIFEKSSTRTRVSFEVG 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  +GG  +FLS +++QL R E+I DTA+ LSRYVD +++RT  H R+ E  ++A+VPVI
Sbjct: 63  VAEMGGYPLFLSRNDIQLARGESIRDTARTLSRYVDMVMIRTFEHERIEEFAKFASVPVI 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQ++ADIMT  E  G  +G   ++ GDGNN+ HSL+ G A+F   ++IATP
Sbjct: 123 NGLTNEFHPCQVMADIMTIYEKMGKYEGVKLAYVGDGNNMAHSLLIGCAKFGIDISIATP 182

Query: 186 IGSEPRNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EHV 240
              +   + +  A+      GA + + +D  +AVKGA  ++TD W SM  E +A E + +
Sbjct: 183 EKYQCLQDVVEKAKTIAAETGAKIEITNDPFKAVKGADFIYTDVWASMGFEDEAEERKKI 242

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F  +QVN +L+        FMHCLPAH GEEV  EV +   S+VFDEAENRLH QKAI+ 
Sbjct: 243 FIDYQVNKNLLEATGKRTYFMHCLPAHLGEEVTEEVFESEISIVFDEAENRLHAQKAIMK 302

Query: 301 WCF 303
           W F
Sbjct: 303 WLF 305


>gi|261403491|ref|YP_003247715.1| ornithine carbamoyltransferase [Methanocaldococcus vulcanius M7]
 gi|261370484|gb|ACX73233.1| ornithine carbamoyltransferase [Methanocaldococcus vulcanius M7]
          Length = 304

 Score =  275 bits (704), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 143/307 (46%), Positives = 204/307 (66%), Gaps = 16/307 (5%)

Query: 7   HFADLSNISSSNLSCIIEVA---KKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
           H  DL  +S  ++  IIE     KK +   E I E     GK +A+IFEKPSTRTR+SF+
Sbjct: 2   HLLDLDVLSREDVLKIIEYGIYFKKNRRKHEKILE-----GKSIAIIFEKPSTRTRMSFD 56

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           +A+  LGG  + ++ +E+ LG+ E+I DTAKV+SRYVDAIV R   H  L E+ +Y+TVP
Sbjct: 57  IAVYELGGHPLIMNQNEIHLGKKESIKDTAKVMSRYVDAIVARVYKHRHLEEMAKYSTVP 116

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINAL+D  HPCQI+AD+MT +E++G+ KG   ++ GDGNN+ +SLI G+A     + IA
Sbjct: 117 VINALSDLAHPCQILADLMTIKEYKGNFKGLKIAYLGDGNNVCNSLILGSALVGMDIYIA 176

Query: 184 TPIGSEPRNEYLNWAR----NQG-ASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE 238
           TP G EP  + +  A+    N G  S+ L +D ++AV+ A  ++TD W+SM  + K +EE
Sbjct: 177 TPRGYEPNAKTILKAKEIIDNYGEGSLTLTNDPIEAVEEADILYTDVWVSMGDD-KNKEE 235

Query: 239 --HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
              +F PFQ+N +++  A  D + MHCLPA+RG E+ ++V+DG  SVV+DEAENRLH QK
Sbjct: 236 VLKIFPPFQINNNILEYAKDDVIVMHCLPANRGLEITDDVIDGEHSVVYDEAENRLHVQK 295

Query: 297 AILLWCF 303
            +  + F
Sbjct: 296 GVFKFIF 302


>gi|187478605|ref|YP_786629.1| ornithine carbamoyltransferase [Bordetella avium 197N]
 gi|123514691|sp|Q2KZD0|OTC_BORA1 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|115423191|emb|CAJ49722.1| ornithine carbamoyltransferase [Bordetella avium 197N]
          Length = 313

 Score =  275 bits (703), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 136/298 (45%), Positives = 197/298 (66%), Gaps = 9/298 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF    ++++S +  +++ A+ IK+  +    + PL  + LAM+FEK STRTRVSFE  
Sbjct: 12  RHFLQFKDLTASEIGYVLDRARIIKDKFKRYEPHMPLHDRTLAMVFEKASTRTRVSFEAG 71

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  +GG  I L+ ++ QLGR+E I DTA+V+SR VD +++RT   +R+     ++ VPVI
Sbjct: 72  MYQMGGSVINLTSNDSQLGRSEPIEDTARVVSRMVDIVMIRTFEQTRIERFAAHSRVPVI 131

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI T+ EHRGS+ G++ +W GD NN+ ++ ++ A    + L+++TP
Sbjct: 132 NGLTNEYHPCQILADIFTYIEHRGSIAGRIVAWVGDANNMSYTWLQAAEMLGFTLHVSTP 191

Query: 186 IGSEPRNEYLNWAR--NQGASV-ALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH-VF 241
            G +     L+ AR  N   SV   F D +QA +GAH V TD W SM  E +  E    F
Sbjct: 192 AGYQ-----LDPARIGNPPPSVLKQFKDPMQACQGAHLVTTDVWTSMGYEAENEERRKAF 246

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             + V+  +M+ A P+A+FMHCLPAHRGEEV  EV+DGPQSVV+DEAENR+H QKA++
Sbjct: 247 ADWCVDAEMMAAADPNAVFMHCLPAHRGEEVTGEVIDGPQSVVWDEAENRMHAQKALM 304


>gi|145571538|gb|ABP80644.1| ornithine carbamoyltransferase, anabolic [Pseudomonas stutzeri
           A1501]
          Length = 280

 Score =  275 bits (703), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 133/261 (50%), Positives = 178/261 (68%), Gaps = 4/261 (1%)

Query: 40  KPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRY 99
           +PL  +VL MIFEK STRTR+SFE  M  LGG  IFLS  + QLGR E I D+A V+SR 
Sbjct: 12  EPLKNRVLGMIFEKASTRTRLSFEAGMIQLGGQAIFLSPRDTQLGRGEPISDSAIVMSRM 71

Query: 100 VDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWS 159
           +DA+++RT  HS L +    ++VPVIN L+D+ HPCQ++AD+ T+ EHRGS+ GK  +W 
Sbjct: 72  LDAVMIRTFAHSTLTDFAANSSVPVINGLSDDLHPCQLMADMQTYHEHRGSIAGKTVAWI 131

Query: 160 GDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAH 219
           GDGNN+ ++ IE A +F++ L +A P G EP  E L  A   G  V +  D  +A  GA+
Sbjct: 132 GDGNNMCNTYIEAAIQFDFRLKVACPEGYEPDAELLARA---GERVQVLRDPREAAAGAN 188

Query: 220 CVFTDTWISMNQEFK-AREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLD 278
            + TD W SM QE + A     F+P+QVN +L+  A  D LFMHCLPAHRGEE+ +++LD
Sbjct: 189 LISTDVWASMGQEDEVAARLATFRPYQVNRALLDCAAADVLFMHCLPAHRGEEISHDLLD 248

Query: 279 GPQSVVFDEAENRLHTQKAIL 299
            P+S  +D+AENRLH QKA+L
Sbjct: 249 DPRSAAWDQAENRLHVQKALL 269


>gi|228916769|ref|ZP_04080334.1| Ornithine carbamoyltransferase [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228842956|gb|EEM88039.1| Ornithine carbamoyltransferase [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
          Length = 316

 Score =  275 bits (703), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 133/302 (44%), Positives = 191/302 (63%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L  ++   +  +IE A  +K + +       L GK+L +IF+K STRTRVSFE  
Sbjct: 12  KDLLTLEELTQEEIISLIEFAIYLKKNKQEPL----LQGKILGLIFDKHSTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLSG EMQ+GR E++ DTAKVLS Y+D I++RT +H+ + E  + +++PVI
Sbjct: 68  MVQLGGHGMFLSGKEMQIGRGESVSDTAKVLSHYIDGIMIRTFSHADVEEFAKESSIPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD+MT  E + + +G   ++ GDGNN+ HSL+  +A+    + +ATP
Sbjct: 128 NGLTDDHHPCQALADLMTIYEEKNTFEGIKLAYVGDGNNVCHSLLLASAKVGMHMTVATP 187

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +G EP  E     L  A    A + + H+   AV  A  ++ D W+SM QE +  +  VF
Sbjct: 188 VGYEPNEEIVKKALAIAEETEAKIEILHNPELAVSEADFIYADVWMSMGQEGEEEKYTVF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+  A     F+HCLPAHR EEV  E++DGPQS+VF++A NRLH QKA+L+ 
Sbjct: 248 QPYQINNELVKHAKQTYRFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHAQKALLVS 307

Query: 302 CF 303
            F
Sbjct: 308 LF 309


>gi|317402720|gb|EFV83268.1| ornithine carbamoyltransferase [Achromobacter xylosoxidans C54]
          Length = 319

 Score =  275 bits (703), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 137/298 (45%), Positives = 191/298 (64%), Gaps = 9/298 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF    + SS+ ++ +++ A+ IK   +    + PL  + LAM+FEK STRTRVSFE  
Sbjct: 18  RHFLQFKDFSSAEIAYVLDRARLIKEKFKRYEPHMPLHDRTLAMVFEKASTRTRVSFEAG 77

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  +GG  I L+ ++ QLGR+E I DTA+V+SR VD +++RT   +R+     ++ VPVI
Sbjct: 78  MYQMGGSVINLTSNDSQLGRSEPIEDTARVISRMVDIVMIRTFEQTRIERFASHSRVPVI 137

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI T+ EHRG + GK  +W GD NN+ ++ ++ A    + L+++TP
Sbjct: 138 NGLTNEFHPCQILADIFTYIEHRGPIAGKTVAWVGDANNMAYTWLQAAEMLGFTLHVSTP 197

Query: 186 IGSEPRNEYLNWARNQGAS---VALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH-VF 241
            G E     L  AR    S   +  F D +QA +GAH V TD W SM  E +  E    F
Sbjct: 198 AGYE-----LEAARIGSPSDKVLRQFKDPMQACQGAHLVTTDVWTSMGYEAENEERRAAF 252

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             + V+  +M+ A P A+FMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA++
Sbjct: 253 ADWCVDAEMMAAADPQAVFMHCLPAHRGEEVTGEVIDGPQSVVWDEAENRLHVQKALM 310


>gi|160897621|ref|YP_001563203.1| ornithine carbamoyltransferase [Delftia acidovorans SPH-1]
 gi|160363205|gb|ABX34818.1| ornithine carbamoyltransferase [Delftia acidovorans SPH-1]
          Length = 310

 Score =  275 bits (702), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 140/302 (46%), Positives = 196/302 (64%), Gaps = 6/302 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT  KH+   S+ ++   + ++E A  IK   +   ++  LS + LAMIFEK STRTRVS
Sbjct: 1   MTAIKHYLQFSDFTADEYAYVLERAALIKKKFKGYEKHHTLSDRTLAMIFEKASTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  + L+  + QLGRAE I D+A+V+SR  D +++RT    +++   EY+ 
Sbjct: 61  FEAGMYQLGGSVVHLTTGDSQLGRAEPIEDSARVISRMTDLVMIRTYGQDKIVRFAEYSR 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LT+  HPCQI+ADI TF EHRGS++GK  +W GDGNN+ ++ ++ A    + ++
Sbjct: 121 VPVINGLTNEFHPCQILADIFTFIEHRGSIQGKTVAWVGDGNNMANTWLQAADLLGFTVH 180

Query: 182 IATPIGSEPRNEYLNWARN--QGASVALFHDAVQAVKGAHCVFTDTWISMNQEF--KARE 237
           ++TP G E  +E L +     +     +F D + A KGA  V TD W SM  E   +AR+
Sbjct: 181 VSTPGGYEV-DEKLAFGGKTPREGCYKVFKDPLDACKGADLVTTDVWTSMGYEAENEARK 239

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
           +  F  + V+  +M+ A  DALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENR+H QKA
Sbjct: 240 K-AFADWCVDAEMMAAARGDALFMHCLPAHRGEEVEAEVIDGPQSVVWDEAENRMHVQKA 298

Query: 298 IL 299
           ++
Sbjct: 299 LM 300


>gi|41407463|ref|NP_960299.1| ornithine carbamoyltransferase [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|56404385|sp|Q740I5|OTC_MYCPA RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|41395815|gb|AAS03682.1| ArgF [Mycobacterium avium subsp. paratuberculosis K-10]
          Length = 309

 Score =  275 bits (702), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 141/306 (46%), Positives = 195/306 (63%), Gaps = 10/306 (3%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRVSFE 63
           P+HF    ++S +  + ++ +A ++K   ++ F  +PL G + +A++F+K STRTR SFE
Sbjct: 3   PRHFLRDDDLSPAEQAEVLALAAELK---KDPFSARPLEGPRGVAVLFDKNSTRTRFSFE 59

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V +  LGG  + +     QLGR ET+ DTA+VLSRYV+AIV RT    RL  +   ATVP
Sbjct: 60  VGIAQLGGHAVVVDARSTQLGRDETLEDTARVLSRYVEAIVWRTFEQQRLEAMAGAATVP 119

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLNI 182
           VINAL+D  HPCQ++AD+    EH+GS+ G    + GDG NN+ HSL+ G       + I
Sbjct: 120 VINALSDEFHPCQMLADLQAIAEHKGSLSGLRMCYLGDGANNMAHSLMLGGVTAGIHVTI 179

Query: 183 ATPIGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE 238
           A P G  P  E++  AR +    GA+V L  DA  A +G   + TDTW SM QE    + 
Sbjct: 180 AAPDGFTPAPEFVAAARRRAESTGATVTLTTDARAAARGVDVLVTDTWTSMGQEDDGLDR 239

Query: 239 HV-FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
              F P+Q+N  L+S+A P+A+ +HCLPAHRGEE+ +EV+DGP SVV+DEAENRLH QKA
Sbjct: 240 RTPFWPYQLNADLVSLADPEAIVLHCLPAHRGEEITDEVMDGPSSVVWDEAENRLHAQKA 299

Query: 298 ILLWCF 303
           +L W  
Sbjct: 300 LLTWLL 305


>gi|86741857|ref|YP_482257.1| ornithine carbamoyltransferase [Frankia sp. CcI3]
 gi|86568719|gb|ABD12528.1| ornithine carbamoyltransferase [Frankia sp. CcI3]
          Length = 340

 Score =  275 bits (702), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 133/300 (44%), Positives = 190/300 (63%), Gaps = 6/300 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSE-NIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           +HF   ++++ +  + ++++A   K          +PL+G+ +A++FEKPSTRTR+SF+V
Sbjct: 4   RHFLLDTDLTPAEQTALLDLADGFKARRRVTRLTERPLAGRSVALLFEKPSTRTRLSFDV 63

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG  + +  +  QLGR ETI DTA VLSRYVDAIV+RT    RL  L   ATVPV
Sbjct: 64  GVAELGGHPVVIDAASAQLGRGETIEDTAAVLSRYVDAIVVRTFAQERLERLAAAATVPV 123

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INAL+D+ HPCQ +AD+ T  E RG + G   ++ GDGNN+ HSL+   A     +++A+
Sbjct: 124 INALSDHAHPCQALADLQTIRERRGRLAGLTLTYLGDGNNVAHSLLLAGASAGMRVHVAS 183

Query: 185 PIGSEPRNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH- 239
           P G EP  + +  A       G    + HDA++A  GA  ++TD W SM QE ++     
Sbjct: 184 PPGYEPFEQVVRHANEIGMVTGGEALVMHDALEAAAGADVLYTDVWASMGQESESDSRAL 243

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           VFQP++++   +  A PD + MHCLPAHR  E+   V+DGP+SVVFD+AENRLH QKA+L
Sbjct: 244 VFQPYRLDEKAVEAASPDVIVMHCLPAHRELEITTSVIDGPRSVVFDQAENRLHAQKALL 303


>gi|302876836|ref|YP_003845469.1| ornithine carbamoyltransferase [Clostridium cellulovorans 743B]
 gi|307687521|ref|ZP_07629967.1| ornithine carbamoyltransferase [Clostridium cellulovorans 743B]
 gi|302579693|gb|ADL53705.1| ornithine carbamoyltransferase [Clostridium cellulovorans 743B]
          Length = 309

 Score =  275 bits (702), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 134/300 (44%), Positives = 201/300 (67%), Gaps = 5/300 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH   + +++  ++  +I++ + +K   +N   +K L GK L MIFEK STRTRVSFE  
Sbjct: 3   KHLTSMIDLTKEDILDLIQLGEDLKFKRKNNIPHKYLEGKTLGMIFEKASTRTRVSFETG 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG   FLS +++Q+GR E I DTA+VLSRY+D I++RT     + EL +Y++VPVI
Sbjct: 63  IFQLGGVGEFLSSNDLQIGRGEPIKDTARVLSRYLDIIMIRTFKDEVVKELAQYSSVPVI 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTDN HPCQ++AD+MT +E++G ++G   ++ GDGNN+++S + G +     ++IA+P
Sbjct: 123 NALTDNEHPCQVLADLMTIKEYKGQLQGLKVAFIGDGNNMVNSYLIGCSIMGMDISIASP 182

Query: 186 IGSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HV 240
            G +P + Y+     +A+  G+ + + +  + A K A  V TD W SM QE +A E    
Sbjct: 183 EGYKPNDFYVEKAKEYAKATGSKIEISNSPIAATKDADVVVTDVWASMGQESEAAERIKA 242

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+ FQVN+ L+S A  DA+ +HCLPAHR EE+ +EVL+   + +FDEAENRLH QKAI++
Sbjct: 243 FKGFQVNMELLSYAKKDAMVLHCLPAHREEEITDEVLEAHANEIFDEAENRLHIQKAIMV 302


>gi|118464590|ref|YP_882298.1| ornithine carbamoyltransferase [Mycobacterium avium 104]
 gi|166926152|sp|A0QHB0|OTC_MYCA1 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|118165877|gb|ABK66774.1| ornithine carbamoyltransferase [Mycobacterium avium 104]
          Length = 309

 Score =  275 bits (702), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 141/306 (46%), Positives = 195/306 (63%), Gaps = 10/306 (3%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRVSFE 63
           P+HF    ++S +  + ++ +A ++K   ++ F  +PL G + +A++F+K STRTR SFE
Sbjct: 3   PRHFLRDDDLSPAEQAEVLALAAELK---KDPFSARPLEGPRGVAVLFDKNSTRTRFSFE 59

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V +  LGG  + +     QLGR ET+ DTA+VLSRYV+AIV RT    RL  +   ATVP
Sbjct: 60  VGIAQLGGHAVVVDARSTQLGRDETLEDTARVLSRYVEAIVWRTFEQHRLEAMAGAATVP 119

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLNI 182
           VINAL+D  HPCQ++AD+    EH+GS+ G    + GDG NN+ HSL+ G       + I
Sbjct: 120 VINALSDEFHPCQVLADLQAIAEHKGSLSGLRMCYLGDGANNMAHSLMLGGVTAGIHVTI 179

Query: 183 ATPIGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE 238
           A P G  P  E++  AR +    GA+V L  DA  A +G   + TDTW SM QE    + 
Sbjct: 180 AAPDGFTPAPEFVAAARRRAESTGATVTLTTDARTAARGVDVLVTDTWTSMGQEDDGLDR 239

Query: 239 HV-FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
              F P+Q+N  L+S+A P+A+ +HCLPAHRGEE+ +EV+DGP SVV+DEAENRLH QKA
Sbjct: 240 RTPFWPYQLNADLVSLADPEAIVLHCLPAHRGEEITDEVMDGPSSVVWDEAENRLHAQKA 299

Query: 298 ILLWCF 303
           +L W  
Sbjct: 300 LLTWLL 305


>gi|324998018|ref|ZP_08119130.1| ornithine carbamoyltransferase [Pseudonocardia sp. P1]
          Length = 306

 Score =  275 bits (702), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 138/305 (45%), Positives = 191/305 (62%), Gaps = 10/305 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRVSFEV 64
           +H     ++S +  + ++++A ++K    + F  +PL G K +A++F+K STRTRVSFE 
Sbjct: 3   RHLLRDDDLSPAEQTEVLDLADRLK---ADRFSERPLEGPKAVAVVFDKSSTRTRVSFEA 59

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG  + L G+  QLGR ETI DT++VLSRYVDAIV RT+   R+ E+   ATVPV
Sbjct: 60  GITQLGGTAVILDGTTSQLGRGETISDTSRVLSRYVDAIVWRTSGQERIEEMASVATVPV 119

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLNIA 183
           +NALTD  HPCQI+AD+ T  E  G + G   ++ GDG NNI HSL+ G A     + ++
Sbjct: 120 VNALTDRFHPCQILADLQTVRERLGRLAGVTLTYLGDGANNIAHSLLLGGATAGLHVRVS 179

Query: 184 TPIGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
            P G  P  E +  A+ +    G SV L  D V AV GA  + TDTW SM QE    +  
Sbjct: 180 APAGFTPDPEVVRDAKARAEQTGGSVTLVADPVAAVAGADVLVTDTWTSMGQEEDGLDRI 239

Query: 240 V-FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F+ +Q+   L++ A P A+ +HCLPAHRGEE+ ++V+DG  S V+DEAENRLH QKA+
Sbjct: 240 APFRSYQIGADLLARAAPGAIVLHCLPAHRGEEITDDVIDGSASAVWDEAENRLHAQKAL 299

Query: 299 LLWCF 303
           L W  
Sbjct: 300 LTWLL 304


>gi|307545336|ref|YP_003897815.1| ornithine carbamoyltransferase [Halomonas elongata DSM 2581]
 gi|307217360|emb|CBV42630.1| ornithine carbamoyltransferase [Halomonas elongata DSM 2581]
          Length = 306

 Score =  275 bits (702), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 142/296 (47%), Positives = 190/296 (64%), Gaps = 5/296 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFEN-KPLSGKVLAMIFEKPSTRTRVSFEV 64
           +HF  L ++S      +++ A  IKN  +       P + + LAMIFEK STRTRVSFE 
Sbjct: 4   RHFLTLLDLSPEESRYLVQRAISIKNGLKTHGPTYTPFANRTLAMIFEKSSTRTRVSFET 63

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           AM   GG  +FLS  + QLGR E IGDTA+VL+  VD +++RT +H  L E    + VPV
Sbjct: 64  AMAQFGGHALFLSPRDTQLGRGEPIGDTARVLAEMVDIVMIRTFSHQGLEEYAAASDVPV 123

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALTD+ HPCQ++AD+MT+ E RGSV+G+   W GDGNN+ HS I  A +F++ L I  
Sbjct: 124 INALTDDYHPCQLLADVMTWTELRGSVRGRTAVWIGDGNNMCHSWINAARQFDFQLRICC 183

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQ-EFKAREEHVFQP 243
           P G EP  + L+ A   G  V +  D + AV+GA  V TD W SM Q E +A+ E  F  
Sbjct: 184 PEGYEPHQDILDAA---GDRVTIHRDPMSAVEGADLVTTDVWASMGQEEEQAKREADFAG 240

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           FQV+ +++  A  D LF+HCLPAHRGEE+   +LD P++VV+ EA NRLH QKA++
Sbjct: 241 FQVSEAMLDRAASDVLFLHCLPAHRGEEISETLLDDPRAVVWQEAGNRLHAQKALI 296


>gi|226306767|ref|YP_002766727.1| ornithine carbamoyltransferase [Rhodococcus erythropolis PR4]
 gi|226185884|dbj|BAH33988.1| ornithine carbamoyltransferase [Rhodococcus erythropolis PR4]
          Length = 316

 Score =  275 bits (702), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 140/310 (45%), Positives = 195/310 (62%), Gaps = 10/310 (3%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTR 59
           M T  KHF    +++ +  + ++E+A  +K   ++ F  +PL G + + +IFEK STRTR
Sbjct: 1   MTTVVKHFLRDDDLTPAQQAEVLELAAILK---KDPFARRPLEGPRGVGVIFEKNSTRTR 57

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
            SFE+ +  +GG  + + G   QLGR ET+ DT +VLSRYVDA+V RT    RL ++   
Sbjct: 58  FSFEMGIAQMGGHAVVVDGRSTQLGREETLADTGRVLSRYVDAVVWRTFGQKRLEQMATG 117

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNY 178
           AT+P++NAL+D  HPCQ++AD+ T  E +G +KG   ++ GDG NN+ HSL+ G      
Sbjct: 118 ATIPIVNALSDEFHPCQVLADLQTLIEQKGELKGLKLTYLGDGANNMAHSLMLGGVTAGI 177

Query: 179 LLNIATPIGSEPRN----EYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK 234
            + IA+P G EP +         A   GA++ L  D    V GA  + TDTW SM QE  
Sbjct: 178 DVTIASPAGFEPADWVVAAARTRAAETGATITLTQDPQAGVVGADALVTDTWTSMGQEND 237

Query: 235 AREE-HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLH 293
             +    F+PFQ+N  L++ A P A+ +HCLPAHRGEEV +EVLDGPQSVV+DEAENRLH
Sbjct: 238 GLDRVGPFRPFQINKELLAKADPKAVVLHCLPAHRGEEVTDEVLDGPQSVVWDEAENRLH 297

Query: 294 TQKAILLWCF 303
            QKA+L+W  
Sbjct: 298 AQKALLVWLL 307


>gi|332526344|ref|ZP_08402470.1| ornithine carbamoyltransferase [Rubrivivax benzoatilyticus JA2]
 gi|332110480|gb|EGJ10803.1| ornithine carbamoyltransferase [Rubrivivax benzoatilyticus JA2]
          Length = 303

 Score =  275 bits (702), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 134/295 (45%), Positives = 193/295 (65%), Gaps = 3/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH+    ++ +   + + E A+ IK   +N  + +PL  + LAMIFEK STRTRVSFE  
Sbjct: 2   KHYLQFKDLRAEEYAYLFERARIIKTRFKNYEKYQPLVDRTLAMIFEKASTRTRVSFEAG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  +GG  + L+  + QLGRAE I D+A+V+SR VD +++RT   +++     ++ VPVI
Sbjct: 62  MYQMGGSVVHLTTGDSQLGRAEPIEDSARVISRMVDIVMIRTFEQAKIERFAAHSRVPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+AD+ T+ EHRGS++GK+ +W GDGNN+ ++ ++ A    + ++++TP
Sbjct: 122 NGLTNEFHPCQILADLFTYIEHRGSIEGKVVAWVGDGNNMANTWLQAAEILGFTVHVSTP 181

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH-VFQPF 244
            G E  +  L   R+ G    +F D  +A +GAH V TD W SM  E +       F  +
Sbjct: 182 GGYEV-DPALAGIRDSGC-YKVFADPREACRGAHLVTTDVWTSMGYEAENEARRTAFADW 239

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            V+  +M+ A PDALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENR+H QKA++
Sbjct: 240 CVDAGMMAAAQPDALFMHCLPAHRGEEVSAEVIDGPQSVVWDEAENRMHVQKALM 294


>gi|296242053|ref|YP_003649540.1| ornithine carbamoyltransferase [Thermosphaera aggregans DSM 11486]
 gi|296094637|gb|ADG90588.1| ornithine carbamoyltransferase [Thermosphaera aggregans DSM 11486]
          Length = 314

 Score =  275 bits (702), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 150/305 (49%), Positives = 195/305 (63%), Gaps = 14/305 (4%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKN---SSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           + F  L+  +   L  ++E A ++K    S E I     L G+ LAMIFEKPSTRTR+SF
Sbjct: 8   RDFLTLTEYTREELWFMLETAAQLKQRYLSGERII--PVLQGRHLAMIFEKPSTRTRLSF 65

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E AMK LGGD I+LS SE+QL R ETI DTA+VLSRYVD I+ R   H ++ +L EYA+V
Sbjct: 66  ETAMKELGGDAIYLSSSELQLARGETIEDTARVLSRYVDGIMARVYEHYKIEKLAEYASV 125

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKL-FSWSGD-GNNILHSLIEGAARFNYLL 180
           PVIN L+D  HP Q ++D++T  E +G    KL   + GD G+N+LHSL+         +
Sbjct: 126 PVINGLSDLHHPAQALSDVLTIIEKKGKDISKLKIVFVGDGGDNVLHSLMLAVGILGGRV 185

Query: 181 NIATPIGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR 236
            IA+P G EP    +      A   G S  +  D  QAV+ A  V+TD W+SM Q+ K R
Sbjct: 186 IIASPKGYEPHPSVVKLFNEHAVPNGGSYEVLRDPYQAVENADVVYTDVWVSMGQD-KER 244

Query: 237 EEHV--FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHT 294
           E  +   +P++V + LMS A  DA+FMHCLPAHRGEEV+NEV+DG  SVV+D+AENR H 
Sbjct: 245 ERRIKDLEPYRVTVELMSKAKSDAIFMHCLPAHRGEEVVNEVIDGKWSVVWDQAENRKHA 304

Query: 295 QKAIL 299
           QKAIL
Sbjct: 305 QKAIL 309


>gi|297570151|ref|YP_003691495.1| ornithine carbamoyltransferase [Desulfurivibrio alkaliphilus AHT2]
 gi|296926066|gb|ADH86876.1| ornithine carbamoyltransferase [Desulfurivibrio alkaliphilus AHT2]
          Length = 305

 Score =  274 bits (701), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 133/296 (44%), Positives = 191/296 (64%), Gaps = 2/296 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +H   L++ S + L+ +I+ A  +K        ++ L+G+ +A++FEKPSTRTRVSFE A
Sbjct: 3   RHLLSLADFSGAELAALIDRALVLKKERREGVRHRDLAGRTIALVFEKPSTRTRVSFEAA 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  I+LS  + QL R E + D A+V++RYVD +V+RT     + EL  Y+ VPVI
Sbjct: 63  MYGLGGQVIYLSSRDTQLARNEPLKDMARVMARYVDGLVVRTFGQQIVDELARYSEVPVI 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD  HPCQ+++D+MT  EH+G +K    +W GDGNN+ +S I+ AAR  + L +A P
Sbjct: 123 NALTDLHHPCQVLSDLMTVIEHKGELKQLKIAWVGDGNNMANSWIQAAARLGFALTLACP 182

Query: 186 IGSEPRNEYLNWARNQGAS-VALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQP 243
            G EP  + L  AR +    + L  D ++AV  A  + TD W SM QE +  +   VF+P
Sbjct: 183 EGYEPDLDILKAARAEAERPINLVRDPIEAVAEADVINTDVWASMGQEDEQLQRLQVFRP 242

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           +Q+N  L++ A   A+ +HCLPAHR EE+   VL+GPQSVV+D+AEN++H   AIL
Sbjct: 243 YQINERLLAQADGRAVVLHCLPAHRDEEITEAVLEGPQSVVWDQAENKMHIHAAIL 298


>gi|218671753|ref|ZP_03521422.1| ornithine carbamoyltransferase [Rhizobium etli GR56]
          Length = 183

 Score =  274 bits (701), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 154/179 (86%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           PKHF DLS ++S++L  I+  A   K + +    +KPL+GK+LAMIFEKPSTRTRVSF+V
Sbjct: 3   PKHFLDLSAVTSADLRTIMNDALSRKQAFKAGQGDKPLAGKMLAMIFEKPSTRTRVSFDV 62

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M+ LGG+T+FLSG+EMQLGRAETIGDTAKVLSRYVDAI++RTT HSRLL+L E+ATVPV
Sbjct: 63  GMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTEHSRLLKLAEHATVPV 122

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           INALTD+THPCQI+ADIMTFEEHRG +KGK  +W+GDGNN+LHSL+EGAARF Y +N+ 
Sbjct: 123 INALTDDTHPCQIMADIMTFEEHRGPIKGKTIAWTGDGNNVLHSLVEGAARFGYRMNMG 181


>gi|86608303|ref|YP_477065.1| ornithine carbamoyltransferase [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86556845|gb|ABD01802.1| ornithine carbamoyltransferase [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 314

 Score =  274 bits (701), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 135/302 (44%), Positives = 188/302 (62%), Gaps = 7/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +    LS+++ + LS ++  A ++K     +     L G+VL ++F+K STRTR SF  A
Sbjct: 15  RDLLKLSDLTPAELSALLAQAAELKRDPYRV----ELRGRVLGLLFQKASTRTRASFTAA 70

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M   GG T+ L  + MQ+ R E + DTA+VLSRY+D I +RT +   L    EYA VPVI
Sbjct: 71  MAQCGGSTLDLVPTVMQVSRGEPLQDTARVLSRYLDVIAIRTYDQKELETFAEYADVPVI 130

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD  HPCQ++AD++T +E+ G + G   ++ GDGNN+ HSL+ G A     + +ATP
Sbjct: 131 NALTDQFHPCQVLADLLTIQENFGQLAGLTLAYCGDGNNVAHSLLLGCAMSGIHIRVATP 190

Query: 186 IGSEPRNEYLNWARN--QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQ 242
            G EP    +  AR   QG+ V +  D  +AV G+  V+TD W SM QE +A   +  F 
Sbjct: 191 PGYEPDAAVVEQARTLAQGSQVLVLQDPQEAVSGSQVVYTDVWASMGQEAEAEARKATFL 250

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           P+QVN  L+  A P A+ +HCLPAHR EE+  EVL+G QS V+D+AENRLH QKA+L+  
Sbjct: 251 PYQVNAELLQRADPQAIVLHCLPAHREEEITTEVLEGSQSRVWDQAENRLHVQKALLIQV 310

Query: 303 FG 304
            G
Sbjct: 311 LG 312


>gi|217968170|ref|YP_002353676.1| ornithine carbamoyltransferase [Dictyoglomus turgidum DSM 6724]
 gi|217337269|gb|ACK43062.1| ornithine carbamoyltransferase [Dictyoglomus turgidum DSM 6724]
          Length = 309

 Score =  274 bits (700), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 141/295 (47%), Positives = 192/295 (65%), Gaps = 11/295 (3%)

Query: 13  NISSSNLSCIIEVAKKIKN---SSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHL 69
           ++S  ++  I  +AK +K+   + + I +   L GK +A+ FEKPSTRTR+SFEV +  L
Sbjct: 14  DLSREDMEQIFHLAKNLKSEYYAGKKIHDY--LKGKTVALFFEKPSTRTRISFEVGVYQL 71

Query: 70  GGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALT 129
           GG  ++L+  EMQL R ETI DTA+VL RYVD I+ R  +H  L+EL +++++PVIN L+
Sbjct: 72  GGYPLYLNAQEMQLKRGETIADTARVLERYVDGIMARVYSHDTLVELAQHSSIPVINGLS 131

Query: 130 DNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSE 189
           D  HPCQIIAD  T  E +G  K K+  + GDGNN+ +SLI   A     +  ++P    
Sbjct: 132 DLEHPCQIIADYFTIIEKKGFRKLKVV-YLGDGNNVANSLILAGAILGMNVVCSSPFQFM 190

Query: 190 PRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQ-EFKAREEHVFQPF 244
           P  + L    N A+  G  V +  D  +AVKGA  ++TD W+SM Q E K   + VF P+
Sbjct: 191 PPKKILDEANNLAKKYGGKVEIVEDPKEAVKGADVIYTDVWVSMGQEEEKELRKRVFPPY 250

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QVN  L+S+A  D + MHCLPAHRGEE+ +EV+DGP SVVFDEAENRLH QKAI+
Sbjct: 251 QVNKELVSLAKEDVIVMHCLPAHRGEEITDEVIDGPNSVVFDEAENRLHVQKAIM 305


>gi|293604406|ref|ZP_06686813.1| ornithine carbamoyltransferase [Achromobacter piechaudii ATCC
           43553]
 gi|292817283|gb|EFF76357.1| ornithine carbamoyltransferase [Achromobacter piechaudii ATCC
           43553]
          Length = 319

 Score =  274 bits (700), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 137/298 (45%), Positives = 191/298 (64%), Gaps = 9/298 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF    + SS+ ++ +++ A+ IK   +    + PL  + LAM+FEK STRTRVSFE  
Sbjct: 18  RHFLQFKDFSSAEIAYVLDRARLIKEKFKRYEPHMPLHDRTLAMVFEKASTRTRVSFEAG 77

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  +GG  I L+ ++ QLGR+E I DTA+V+SR VD +++RT   +R+     ++ VPVI
Sbjct: 78  MYQMGGSVINLTSNDSQLGRSEPIEDTARVISRMVDIVMIRTFEQTRIERFASHSRVPVI 137

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI T+ EHRG + GK  +W GD NN+ ++ +  A    + L+++TP
Sbjct: 138 NGLTNEFHPCQILADIFTYIEHRGPIAGKTVAWVGDANNMAYTWLHAAEMLGFTLHVSTP 197

Query: 186 IGSEPRNEYLNWARNQGAS---VALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH-VF 241
            G E     L  AR    S   +  F D +QA +GAH V TD W SM  E +  E    F
Sbjct: 198 AGYE-----LEAARIGTPSDKVLRQFKDPMQACQGAHLVTTDVWTSMGYEAENEERRAAF 252

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             + V+  +M+ A P+A+FMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA++
Sbjct: 253 ADWCVDAEMMAAADPEAVFMHCLPAHRGEEVTGEVIDGPQSVVWDEAENRLHVQKALM 310


>gi|254483528|ref|ZP_05096755.1| ornithine carbamoyltransferase [marine gamma proteobacterium
           HTCC2148]
 gi|214036249|gb|EEB76929.1| ornithine carbamoyltransferase [marine gamma proteobacterium
           HTCC2148]
          Length = 304

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 136/299 (45%), Positives = 195/299 (65%), Gaps = 4/299 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M   +HF  L + S + L+ +IE A  +K + ++  + +   GKVL MIF K STRTRVS
Sbjct: 1   MADTRHFLTLLDFSPAELNDMIERAIAMKQAHKSGADQRHFPGKVLGMIFAKSSTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  +FLS ++ QLGR E I D+A+V+S  VD +++RT  H  +     +++
Sbjct: 61  FEAGMAQLGGHAMFLSPTDTQLGRGEPIEDSARVISSMVDIVMIRTFGHDIVETFAAHSS 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVINALTD+ HPCQ++AD+ T+ EHRGS+ GK+ +W GDGNN+  S I  A +F++ L 
Sbjct: 121 VPVINALTDDYHPCQLLADMQTYVEHRGSIAGKVVTWVGDGNNMAQSYINAARQFDFELR 180

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHV 240
           IA P G EP    +   R++   V++  D V A +GA  + TD W SM QE + +  E  
Sbjct: 181 IACPEGYEPSPALVEANRDR---VSIVRDPVIAAEGADLLVTDVWASMGQEQEQQAREAA 237

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           F  +Q+N  L+S A  DAL+MHCLPAHRGEE+ + ++D   +V+++EAENRLH QKA++
Sbjct: 238 FDGYQLNEELLSRAASDALYMHCLPAHRGEEISSGLMDAADTVIWNEAENRLHAQKALM 296


>gi|119478319|ref|ZP_01618350.1| ornithine carbamoyltransferase [marine gamma proteobacterium
           HTCC2143]
 gi|119448659|gb|EAW29904.1| ornithine carbamoyltransferase [marine gamma proteobacterium
           HTCC2143]
          Length = 301

 Score =  273 bits (698), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 137/295 (46%), Positives = 189/295 (64%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF  L ++S + L+ +I  A ++K        N+P   KVL M+FEK STRTRVSFE  
Sbjct: 4   KHFLTLLDLSPAELASLITRAIELKAELAAGGHNEPFKNKVLGMVFEKSSTRTRVSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M   GG  IFLS  + QLGR E + D+A+VLS  VD I++RT  H  +    +++ VPVI
Sbjct: 64  MAQFGGHAIFLSPRDTQLGRGEPVEDSARVLSAMVDVIMIRTFGHEIIERFAKHSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+ HPCQ++ADI T+ EHRGS++GK  SW GDGNN+  S I  A +F++ L IA P
Sbjct: 124 NALTDDYHPCQLLADIQTYVEHRGSIQGKTVSWIGDGNNMCQSYINAAKQFDFELRIACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQE-FKAREEHVFQPF 244
            G EP  E +   +++   V++  D   A K +H + TD W SM QE  +A+    F  F
Sbjct: 184 KGFEPNAELVAANKDR---VSIIRDPKLAAKDSHLLVTDVWASMGQEDQQAQRIQAFSGF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           Q+N  L+S A   AL+MHCLPAHR EE+   +++ P +V+++EAENRLH QKA++
Sbjct: 241 QINEELLSYADSKALYMHCLPAHREEEISTGLMERPDTVIWEEAENRLHAQKALM 295


>gi|307353462|ref|YP_003894513.1| ornithine carbamoyltransferase [Methanoplanus petrolearius DSM
           11571]
 gi|307156695|gb|ADN36075.1| ornithine carbamoyltransferase [Methanoplanus petrolearius DSM
           11571]
          Length = 311

 Score =  273 bits (698), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 136/301 (45%), Positives = 198/301 (65%), Gaps = 2/301 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    + +++S  L+ ++ +A K+K   +N    + L  K + +IFEK STRTR+SFE  
Sbjct: 3   KDILSILDLNSEELTGVLALADKLKGERKNGIFPEYLYKKSVGLIFEKASTRTRISFETG 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  +FL+ ++MQLGR ETI DTAKVLSRY+ AI+MR+ +H  + EL  ++T+PVI
Sbjct: 63  IFELGGHPLFLNPNDMQLGRGETISDTAKVLSRYLSAIMMRSYSHRTVEELALHSTIPVI 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRG-SVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           N L+D  HPCQI+ADIMT  E+ G +++    +W GDGNN+  SL+  +A   Y +N+A+
Sbjct: 123 NGLSDEEHPCQILADIMTMRENFGNNLEDLTIAWIGDGNNVCDSLMLSSALTGYRVNVAS 182

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREEHVFQP 243
           P    P+ +Y+  A   GA V  F +   AV GA  ++TDTWISM +E  K    + F+ 
Sbjct: 183 PPAYRPKEKYIELAEKAGAYVKFFDNPRDAVSGADVIYTDTWISMGRENEKEARVNAFKG 242

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           ++V+ SL++    D++  HCLPAHRGEE+ +EV+DGP S V+D+AENRLH QKA+L    
Sbjct: 243 YRVDESLLAGCDSDSIVFHCLPAHRGEEISDEVIDGPMSRVWDQAENRLHAQKALLAKLL 302

Query: 304 G 304
           G
Sbjct: 303 G 303


>gi|54023908|ref|YP_118150.1| ornithine carbamoyltransferase [Nocardia farcinica IFM 10152]
 gi|54015416|dbj|BAD56786.1| putative ornithine carbamoyltransferase [Nocardia farcinica IFM
           10152]
          Length = 316

 Score =  273 bits (697), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 137/305 (44%), Positives = 195/305 (63%), Gaps = 10/305 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRVSFEV 64
           +HF    ++S +  + I+ +A ++K +    F  +PL G + + +IFEK STRTR SFE+
Sbjct: 7   RHFLRDDDVSPTEQAEILALAAELKRAP---FSRRPLEGPRGVGVIFEKNSTRTRFSFEM 63

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG  + + G + QLGR ET+ DT +VLSRYVDA+V RT   SRL E+   ATVPV
Sbjct: 64  GIAQLGGHAVVVDGRDTQLGREETLADTGRVLSRYVDAVVWRTFEQSRLDEMASAATVPV 123

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLNIA 183
           +NAL++  HPCQ++AD++T  E +G + G+  ++ GDG NN+ HSL+ G       + IA
Sbjct: 124 VNALSNEFHPCQVLADLLTLTERKGDLAGRKLAYFGDGANNMAHSLLLGGVTAGLNVTIA 183

Query: 184 TPIGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE- 238
            P G EP    L  AR +    GA+V +  D   A +GA  + TDTW SM QE    +  
Sbjct: 184 APAGFEPLPWVLEAARKRAADTGATVTVTGDPQAAAEGADALVTDTWTSMGQENDGLDRV 243

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F+PF+++ +L++ A PD   +HCLPAHRG+E+ +EVLDGP S V+DEAENRLH QKA+
Sbjct: 244 GPFRPFRLDAALLAEAKPDVSVLHCLPAHRGDEITDEVLDGPHSAVWDEAENRLHAQKAL 303

Query: 299 LLWCF 303
           L+W  
Sbjct: 304 LVWLL 308


>gi|120609851|ref|YP_969529.1| ornithine carbamoyltransferase [Acidovorax citrulli AAC00-1]
 gi|166918643|sp|A1TLB7|OTC_ACIAC RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|120588315|gb|ABM31755.1| ornithine carbamoyltransferase [Acidovorax citrulli AAC00-1]
          Length = 309

 Score =  273 bits (697), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 134/296 (45%), Positives = 194/296 (65%), Gaps = 5/296 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH+    + S+   + + E A  IK   +   ++ PL+ + LAMIFEK STRTRVSFE  
Sbjct: 8   KHYLQFKDFSAQEYAYLFERAAVIKGKFKRYEKHHPLTDRTLAMIFEKASTRTRVSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  + L+  + QLGRAE I D+AKV+SR VD +++RT   +++     ++ VPVI
Sbjct: 68  MYQLGGSVVHLTTGDSQLGRAEPIEDSAKVISRMVDLVMIRTYEQTKIERFAAHSRVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI TF EHRGS++G+  +W GDGNN+ ++ ++ A    + ++++TP
Sbjct: 128 NGLTNEFHPCQILADIFTFIEHRGSIQGRTVAWVGDGNNMANTWLQAAELLGFTVHVSTP 187

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF--KAREEHVFQP 243
            G E  +     A   G+   +F D ++A +GA  + TD W SM  E   +AR++  F  
Sbjct: 188 SGYEVDSRVAGVA--AGSHYKVFSDPLEACRGADLITTDVWTSMGYEAENEARKK-AFAD 244

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + V+  +M+ A P+ALFMHCLPAHRGEEV  +V+DGPQSVV+DEAENR+H QKA++
Sbjct: 245 WCVDAEMMAAARPEALFMHCLPAHRGEEVEADVIDGPQSVVWDEAENRMHVQKALM 300


>gi|255658226|ref|ZP_05403635.1| ornithine carbamoyltransferase [Mitsuokella multacida DSM 20544]
 gi|260849536|gb|EEX69543.1| ornithine carbamoyltransferase [Mitsuokella multacida DSM 20544]
          Length = 310

 Score =  273 bits (697), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 142/305 (46%), Positives = 194/305 (63%), Gaps = 8/305 (2%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M   K    + ++S   +  I+ +AK++K   +    ++ L GK L MIFEK STRTRVS
Sbjct: 1   MLKGKDMLSIHDLSVDEVQEILALAKELKAKQKAGVPHEILKGKTLGMIFEKSSTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  +FLS  ++QLGR E I DTA+VLSRY+D I++RT  H R+ EL ++A 
Sbjct: 61  FETGMYQLGGQALFLSNRDLQLGRGEPIRDTARVLSRYLDGIMIRTFGHDRVEELAKWAD 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRG-SVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +PVINALTD  HPCQ++ D++T EE++G ++KG   ++ GDGNN+ +S + G A+     
Sbjct: 121 IPVINALTDLLHPCQVLTDLLTIEEYKGKNLKGLKMAYVGDGNNMTNSFLYGCAKVGMTF 180

Query: 181 NIATPIGSEPR----NEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQ--EFK 234
             ATP    P        L  A+  GA ++L  D  +AVK A  V TDTW SM Q  E +
Sbjct: 181 VAATPEDYRPDETVFKNALEDAKETGAELSLVTDPKEAVKDADIVVTDTWASMGQEAEHE 240

Query: 235 AREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHT 294
           AR++ +F P+QVN  L+  A    + MHCLPA+RGEE+  EVL+    V+FDEAENRLHT
Sbjct: 241 ARKK-IFAPYQVNKELLKGADKRVIVMHCLPAYRGEEITEEVLEANADVIFDEAENRLHT 299

Query: 295 QKAIL 299
           QKAI+
Sbjct: 300 QKAIM 304


>gi|91789427|ref|YP_550379.1| ornithine carbamoyltransferase [Polaromonas sp. JS666]
 gi|91698652|gb|ABE45481.1| ornithine carbamoyltransferase [Polaromonas sp. JS666]
          Length = 329

 Score =  273 bits (697), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 137/296 (46%), Positives = 198/296 (66%), Gaps = 5/296 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +H+   S++++S  + + E A  IK   +   +++PL+ + LAMIFEK STRTRVSFE  
Sbjct: 28  RHYLQFSDLNASEYAYLFERAAVIKKKFKAYEKHQPLADRTLAMIFEKASTRTRVSFEAG 87

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  + L+  + QLGRAE I D+AKV+SR VD +++RT   +++    E++ VPVI
Sbjct: 88  MYQLGGSVVHLTTGDSQLGRAEPIEDSAKVISRMVDLVMIRTFEQTKIDRFAEHSRVPVI 147

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI T+ EHRGS+ GK  +W GDGNN+ ++ ++ +    + ++++TP
Sbjct: 148 NGLTNEFHPCQILADIFTYIEHRGSILGKTVAWVGDGNNMANTWLQASEILGFKVHVSTP 207

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF--KAREEHVFQP 243
            G E  ++ +   R+   S  +F D +QA  GA  V TD W SM  E   +AR++  F  
Sbjct: 208 GGYEV-DQSIAGIRS-AESYQVFKDPMQACAGADLVTTDVWTSMGYEAENEARKK-AFAD 264

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + V+  +M  A PDALFMHCLPAHRGEEV  +V+DGPQSVV+DEAENR+H QKA++
Sbjct: 265 WCVDADMMRAAKPDALFMHCLPAHRGEEVEADVIDGPQSVVWDEAENRMHVQKALM 320


>gi|329766353|ref|ZP_08257899.1| ornithine carbamoyltransferase [Candidatus Nitrosoarchaeum limnia
           SFB1]
 gi|329137122|gb|EGG41412.1| ornithine carbamoyltransferase [Candidatus Nitrosoarchaeum limnia
           SFB1]
          Length = 303

 Score =  272 bits (696), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 144/296 (48%), Positives = 195/296 (65%), Gaps = 15/296 (5%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPL-SGKVLAMIFEKPSTRTRVSFE 63
           PK F  L + S       I++ K++K+       NKPL   K L MIF+KPSTRTRVSFE
Sbjct: 16  PKEFTGLIDYS-------IKLKKELKSG------NKPLLKNKTLTMIFQKPSTRTRVSFE 62

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VAM  LGG  + LS +EMQL R E+I DTAK LSRY + I+ R  +HS L +L++ +++P
Sbjct: 63  VAMYQLGGHAVNLSSNEMQLSRGESIEDTAKTLSRYTNCIMARVYDHSLLEKLSQSSSIP 122

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN L+D+ HPCQI+AD MT +E +GS+KG   +W GDGNN+ +S+I G +     ++IA
Sbjct: 123 VINGLSDSFHPCQIMADFMTIKEKKGSLKGLKIAWIGDGNNVCNSMIYGCSLSGVSISIA 182

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQP 243
           TP G EP  + +  ++ +  S+ L  D + A+K A  V TDT+ S++     R +     
Sbjct: 183 TPKGFEPDAKVIAESK-KSTSIELTSDPLIAIKNADVVITDTFTSIHTNDPKRIKKFLPK 241

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           FQVN  L+S A  +A+FMHCLPA R  EV + V+DGPQSVV+DEAENRLHTQKA+L
Sbjct: 242 FQVNEKLLSHAKKNAIFMHCLPAKRDHEVTSSVIDGPQSVVWDEAENRLHTQKALL 297


>gi|294339521|emb|CAZ87880.1| ornithine carbamoyltransferase [Thiomonas sp. 3As]
          Length = 311

 Score =  272 bits (696), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 138/302 (45%), Positives = 185/302 (61%), Gaps = 3/302 (0%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M T  +H+   S+++      +   A  IK   +    ++PL  + LAMIFEK STRTR+
Sbjct: 1   MKTTLRHYLQFSDLNREEYDYVFARAALIKAKFKRYEPHQPLVDRTLAMIFEKHSTRTRL 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFE  M  LGG  I+++  + QLGR E I D A+V SR VD +++RT     +     Y+
Sbjct: 61  SFEAGMHQLGGAAIYINTRDSQLGRGEPIEDAAQVFSRMVDLVMIRTYGQEIVERFAAYS 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
            VPVIN LT+  HPCQI+AD+MT+ EHRG ++GK  +W GD NN+ ++ ++ A    + L
Sbjct: 121 RVPVINGLTNEFHPCQILADVMTYIEHRGPIQGKTVAWIGDANNMFYTWLQAAEVLGFTL 180

Query: 181 NIATP--IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KARE 237
           + A P   G E        +  Q A +  F D  QA +GAH + TD W SM  E  K   
Sbjct: 181 HFAGPKGYGVEKNRPGYPLSAAQIAHLREFDDPRQACEGAHLITTDVWTSMGYEAEKLAR 240

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
           E  F+ F V+  +M+ AHPDALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA
Sbjct: 241 EQAFKGFMVDGEMMARAHPDALFMHCLPAHRGEEVAAEVIDGPQSVVWDEAENRLHGQKA 300

Query: 298 IL 299
           ++
Sbjct: 301 LM 302


>gi|71065517|ref|YP_264244.1| ornithine carbamoyltransferase [Psychrobacter arcticus 273-4]
 gi|123648901|sp|Q4FT48|OTC_PSYA2 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|71038502|gb|AAZ18810.1| ornithine carbamoyltransferase [Psychrobacter arcticus 273-4]
          Length = 307

 Score =  272 bits (696), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 132/298 (44%), Positives = 193/298 (64%), Gaps = 10/298 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  LS+ +   L  +I+ A +++         +P  G+ L MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLSDFTKQELENLIKRASELRKMQHAGEIYQPFVGRTLGMIFEKSSTRTRISFETG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M   GG+ IFLS ++ QLGR E + D+A+V+S  VD I++RT  H ++    +Y++VP+I
Sbjct: 64  MGQFGGNAIFLSPNDTQLGRGEPLEDSARVISSMVDIIMIRTFGHEKVETFAKYSSVPII 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD  HPCQ++AD+ T+ EHRGS++ K+ +W GDGNN+  S ++ A +F + L +A P
Sbjct: 124 NALTDEFHPCQLLADMQTYYEHRGSIENKIVTWVGDGNNMCASFMQAAHQFGFELRVAAP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQE----FKAREEHVF 241
            G EP +  +    +    V+L  +   A K ++ + TD W SM QE     +AR    F
Sbjct: 184 YGFEPDSALMERFSH---CVSLVENVQDAAKDSNLIVTDVWASMGQESEQNTRARR---F 237

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            P+QV  SL+  A P+ +FMHCLPAHRGEE+ +++LD P+SVV+DEAENRLH QKA++
Sbjct: 238 APYQVTPSLLDKADPEVVFMHCLPAHRGEEISHDMLDDPRSVVWDEAENRLHAQKALM 295


>gi|284047968|ref|YP_003398307.1| ornithine carbamoyltransferase [Acidaminococcus fermentans DSM
           20731]
 gi|283952189|gb|ADB46992.1| ornithine carbamoyltransferase [Acidaminococcus fermentans DSM
           20731]
          Length = 313

 Score =  272 bits (695), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 132/299 (44%), Positives = 191/299 (63%), Gaps = 5/299 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    + ++S   ++ I++V++K+K   +    ++ L GK LAMIF K STRTRVSFE  
Sbjct: 6   KDLISIHDLSVGEVATILDVSRKLKKKQKLGEPHEYLKGKTLAMIFSKASTRTRVSFETG 65

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
              LGG  I++S +  Q+GR E + DTA+VLSR+VD I++RT +H  + EL +YATVPVI
Sbjct: 66  FHQLGGHPIYMSEATSQIGRGEPVKDTARVLSRFVDGIMIRTFSHDAVKELADYATVPVI 125

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ + D+ T  E++  +KG+   + GDGNN+ HSL+   A+    +  A+P
Sbjct: 126 NGLTDLLHPCQALTDMFTVLEYKDVLKGRKLVYVGDGNNMAHSLMFACAKVGMNMVCASP 185

Query: 186 IGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EHV 240
            G +P    +  AR      G ++ +  D   A KGA  ++TD W SM +E +  E +  
Sbjct: 186 KGYQPDPHIVAQARMDAAITGCTITVQEDMEDAAKGADVLYTDVWASMGEEAQREERKKA 245

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
              +Q+N  L+ +A PDA+ +HCLPAHRGEE+ ++V++GPQS VFDEAENRLH QKAI+
Sbjct: 246 LHDYQINQHLLDLARPDAMVLHCLPAHRGEEITDDVIEGPQSAVFDEAENRLHVQKAIM 304


>gi|121595318|ref|YP_987214.1| ornithine carbamoyltransferase [Acidovorax sp. JS42]
 gi|222111602|ref|YP_002553866.1| ornithine carbamoyltransferase [Acidovorax ebreus TPSY]
 gi|120607398|gb|ABM43138.1| ornithine carbamoyltransferase [Acidovorax sp. JS42]
 gi|221731046|gb|ACM33866.1| ornithine carbamoyltransferase [Acidovorax ebreus TPSY]
          Length = 305

 Score =  272 bits (695), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 134/298 (44%), Positives = 196/298 (65%), Gaps = 6/298 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH+   ++ ++   + +   A  IK   ++  +  PL+ + LAMIFEK STRTRVSFE  
Sbjct: 2   KHYLQFTDFTADEYNYLFSRAAIIKGKFKSYEKYHPLADRTLAMIFEKASTRTRVSFEAG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  + L+  + QLGRAE I D+A+V+SR  D +++RT  H ++    EY+ VPVI
Sbjct: 62  MYQLGGSVVHLTTGDSQLGRAEPIEDSARVISRMTDLVMIRTFGHDKIERFAEYSRVPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+AD+ T+ EHRGS+ GK+ +W GDGNN+ ++ ++ A    + ++++TP
Sbjct: 122 NGLTNEFHPCQIMADLFTYIEHRGSIAGKVVAWVGDGNNMANTWLQAADLLGFTVHVSTP 181

Query: 186 IGSEPRNEYLNWAR--NQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF--KAREEHVF 241
            G E  +E L +    ++     +F D + A +GA  V TD W SM  E   +AR +  F
Sbjct: 182 GGYEV-DEKLAFGGKPHRAGCYKVFADPMDACRGADLVTTDVWTSMGYEAENEARRK-AF 239

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             + V+  +M++A PDALFMHCLPAHRGEEV+ +V+DGPQSVV+DEAENR+H QKA++
Sbjct: 240 ADWCVDAEMMAVAKPDALFMHCLPAHRGEEVMADVIDGPQSVVWDEAENRMHVQKALM 297


>gi|291533644|emb|CBL06757.1| ornithine carbamoyltransferase [Megamonas hypermegale ART12/1]
          Length = 309

 Score =  271 bits (694), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 135/309 (43%), Positives = 196/309 (63%), Gaps = 6/309 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M   K    + +++S  +  I+ +A ++K   +   E+  L GK L MIFEK STRTRVS
Sbjct: 1   MLKGKDLLSIHDLTSDEVMEILNLAHELKAKQKAGIEHHILKGKTLGMIFEKSSTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FEV M  LGG  +FLS  ++Q+GR E I DTA+VLSRY+D +++RT  H  + E  +YA+
Sbjct: 61  FEVGMYQLGGQALFLSNRDLQIGRGEPIKDTARVLSRYLDGVMIRTFGHEIVEEFAQYAS 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRG-SVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +PVINALTD  HPCQ + D++T +EH+G  +KG   ++ GDGNN+ HSL+   A+     
Sbjct: 121 IPVINALTDLLHPCQALTDLLTAQEHKGKDLKGLKMAYIGDGNNMTHSLMYACAKVGMNF 180

Query: 181 NIATPIGSEPRNEYLNWAR----NQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR 236
             A+P G EP  + +  A+      G+++ + +D  +A K A  ++TD W SM QE +  
Sbjct: 181 ASASPKGYEPNAQVVANAKLDAAQSGSTIEILNDPFEAAKDADILYTDVWASMGQEAEHD 240

Query: 237 EE-HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
           E   +F+ +Q+N  L+ +A   A+ MHCLPAHRGEE+  +VL+   +V+FDEAENRLHTQ
Sbjct: 241 ERVKIFKDYQINNELLRVADKRAIVMHCLPAHRGEEIAEDVLEKNANVIFDEAENRLHTQ 300

Query: 296 KAILLWCFG 304
           KAI+    G
Sbjct: 301 KAIMALLMG 309


>gi|93006287|ref|YP_580724.1| ornithine carbamoyltransferase [Psychrobacter cryohalolentis K5]
 gi|122415260|sp|Q1QAR3|OTC_PSYCK RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|92393965|gb|ABE75240.1| ornithine carbamoyltransferase [Psychrobacter cryohalolentis K5]
          Length = 305

 Score =  271 bits (694), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 132/298 (44%), Positives = 193/298 (64%), Gaps = 10/298 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  LS+++   L  +I+ A ++++        +P  G+ L MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLSDLTKQELENLIKRASELRHMQHAGEIYQPFVGRTLGMIFEKSSTRTRISFETG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M   GG  IFLS ++ QLGR E I D+A+V+S  VD I++RT  H ++    +Y++VP+I
Sbjct: 64  MGQFGGSAIFLSPNDTQLGRGEPIEDSARVISSMVDIIMIRTFGHEKVETFAKYSSVPII 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD  HPCQ++AD+ T+ EHRGS++ K+ +W GDGNN+  S ++ A +F + L +A P
Sbjct: 124 NALTDEFHPCQLLADMQTYYEHRGSIENKIVTWVGDGNNMCASYMQAANQFGFELRVAAP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQE----FKAREEHVF 241
            G EP  E +   +     V++  +  +A K +H + TD W SM QE     +AR    F
Sbjct: 184 YGFEPDPELM---KRFSHCVSIVENVQEAAKDSHLIVTDVWASMGQESEQNTRARR---F 237

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             +QV  SL+  A  + +FMHCLPAHRGEE+ +++LD P+SVV+DEAENRLH QKA++
Sbjct: 238 SSYQVTPSLLDKADSEVVFMHCLPAHRGEEISHDMLDDPRSVVWDEAENRLHAQKALM 295


>gi|297584254|ref|YP_003700034.1| ornithine carbamoyltransferase [Bacillus selenitireducens MLS10]
 gi|297142711|gb|ADH99468.1| ornithine carbamoyltransferase [Bacillus selenitireducens MLS10]
          Length = 308

 Score =  271 bits (694), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 137/304 (45%), Positives = 196/304 (64%), Gaps = 6/304 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M+ P HF  + +   + +  +++ A+ +K   +    +  L GK LAMIFEK STRTRVS
Sbjct: 1   MSNPNHFLTMLDYDQATVYDLLKDAQTMKKEVKEGIPHPHLKGKTLAMIFEKSSTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FEV M  LGG  +FLS  ++QLGR E + DTAKVLS YVD I++RT  H R+ EL+ +A+
Sbjct: 61  FEVGMLQLGGHALFLSSDDIQLGRGEPVSDTAKVLSGYVDGIMIRTFGHDRIEELSAHAS 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLL 180
           +PVIN LT+  HPCQ++AD+MT +E +G ++G   ++ GDG NN+ HSLI+G +     +
Sbjct: 121 IPVINGLTNEHHPCQVLADLMTIQEQKGKLEGLTAAYIGDGFNNMAHSLIQGLSLMGMHV 180

Query: 181 NIATPIGSEPRNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR 236
            +A+P G EP +  +  A++       S++  +   +AV+ A  + TD W SM  E +  
Sbjct: 181 QVASPEGYEPDSVIMEEAKDVADKHNGSLSFSYSPERAVQQADVIITDVWASMGNEAEQE 240

Query: 237 EE-HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
           +    F+ FQVN +L + A  D +F+HCLPAHR EEV   ++DGP SVVF+EAENRLH Q
Sbjct: 241 QRLSDFKDFQVNEALTAHAKDDYIFLHCLPAHREEEVTAAIIDGPHSVVFEEAENRLHAQ 300

Query: 296 KAIL 299
           KAIL
Sbjct: 301 KAIL 304


>gi|118575527|ref|YP_875270.1| ornithine carbamoyltransferase [Cenarchaeum symbiosum A]
 gi|226739194|sp|A0RUE9|OTC_CENSY RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|118194048|gb|ABK76966.1| ornithine carbamoyltransferase [Cenarchaeum symbiosum A]
          Length = 301

 Score =  271 bits (694), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 138/279 (49%), Positives = 180/279 (64%), Gaps = 3/279 (1%)

Query: 22  IIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEM 81
           IIE A ++K    +  +  PL G+ LAM+F+KPSTRTRVSF   M  LGG+ I+L   +M
Sbjct: 22  IIESAIRLKKGGRS--KAHPLDGRTLAMVFQKPSTRTRVSFAAGMFQLGGEAIYLPPGDM 79

Query: 82  QLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADI 141
           QL R ETI DTA+ LS YVD IV R   H  + E+   A+VPVIN L+D  HPCQI+AD+
Sbjct: 80  QLSRGETIPDTARALSGYVDVIVARVFGHETIEEIAASASVPVINGLSDTFHPCQILADL 139

Query: 142 MTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQ 201
           MT +E +G +KG   +W GDGNN+ +SL+ G A     +++ATP    P    ++  R +
Sbjct: 140 MTIKERKGRLKGLRAAWIGDGNNVCNSLLYGCAAVGIDISVATPAVFRPIPGVVDKCR-E 198

Query: 202 GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFM 261
              V L  D  +A  GA  VFTDT+ S++   K RE      ++VN  LM  A  DA+FM
Sbjct: 199 SIDVKLTTDPAEAAAGADIVFTDTFASIHNMDKERERKFLPKYRVNAPLMKKAADDAIFM 258

Query: 262 HCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           HCLPA RG+EV  EV+DGPQS V+DEAENRLH+QKA+LL
Sbjct: 259 HCLPAKRGQEVDGEVIDGPQSAVWDEAENRLHSQKALLL 297


>gi|150400787|ref|YP_001324553.1| ornithine carbamoyltransferase [Methanococcus aeolicus Nankai-3]
 gi|189036328|sp|A6UTW9|OTC_META3 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|150013490|gb|ABR55941.1| ornithine carbamoyltransferase [Methanococcus aeolicus Nankai-3]
          Length = 304

 Score =  271 bits (693), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 138/306 (45%), Positives = 197/306 (64%), Gaps = 14/306 (4%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNS--SENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           H   L N+   ++  I+  A   K +  SENI     L  K +A+IFE PSTRTR+SF++
Sbjct: 2   HLLTLENLERKDIENILNDAIYFKKNRKSENI-----LKEKTVALIFESPSTRTRISFDI 56

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           A+  LGG ++ L+  E  + + E+  DTAKVLSR+VD IV R   HS L + T+Y  VPV
Sbjct: 57  AVNELGGHSLTLNTGETHVSKKESTKDTAKVLSRFVDVIVARVKEHSTLEDFTKYGNVPV 116

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INAL+D +HPCQI+AD++T +EH+  + G  F++ GDGNN+ +SLI G A     + +AT
Sbjct: 117 INALSDLSHPCQILADLLTIKEHKNKLSGLKFAYFGDGNNVCNSLILGCAIMGMDIFVAT 176

Query: 185 PIGSEPRNEYLNWARN----QG-ASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE- 238
           P G EP  +++  A+     QG  S+ +  DA+   K A  ++TD W+SM+ + K  +E 
Sbjct: 177 PEGYEPNEKFVKMAQQIIDKQGEGSITITDDAIICAKDADVLYTDVWVSMSDKNKNIDEV 236

Query: 239 -HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
             +F P+Q+N  L+S A  DA+ MHCLPA+RG E+ +EV+DG QSVV+DEAENRLH QKA
Sbjct: 237 LKIFPPYQINEKLLSYAKKDAIVMHCLPANRGMEITDEVIDGEQSVVYDEAENRLHAQKA 296

Query: 298 ILLWCF 303
           +  + F
Sbjct: 297 VFKYIF 302


>gi|260886356|ref|ZP_05897619.1| ornithine carbamoyltransferase [Selenomonas sputigena ATCC 35185]
 gi|330838872|ref|YP_004413452.1| ornithine carbamoyltransferase [Selenomonas sputigena ATCC 35185]
 gi|260863877|gb|EEX78377.1| ornithine carbamoyltransferase [Selenomonas sputigena ATCC 35185]
 gi|329746636|gb|AEB99992.1| ornithine carbamoyltransferase [Selenomonas sputigena ATCC 35185]
          Length = 310

 Score =  271 bits (693), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 136/304 (44%), Positives = 191/304 (62%), Gaps = 6/304 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M   +    + ++S   +  I+ +A+++K   +   E++ L+GK L MIFEK STRTRVS
Sbjct: 1   MLKGRDLLSIHDLSVEEVEAILALAEELKAMQKAGIEHRVLAGKTLGMIFEKSSTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  +FLS  ++Q+GR E I DTA+VLSRY+D +++RT  H ++ E  +YA 
Sbjct: 61  FETGMFQLGGQALFLSNRDLQIGRGEPIKDTARVLSRYLDGVMIRTFEHEKVEEFAKYAD 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRG-SVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +PVINALTD  HPCQ + D++T  EH+G ++KG   ++ GDGNN+ HSL+  AA+     
Sbjct: 121 IPVINALTDLLHPCQALTDLLTIREHKGKNLKGLKMAYVGDGNNMTHSLMYAAAKTGMNF 180

Query: 181 NIATPIGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR 236
             ATP    P           A+  GAS+ L  D   A K A  + TDTW SM QE +  
Sbjct: 181 VAATPADYAPDEGVTQRAQEDAKETGASITLVTDPFAAAKDADILVTDTWASMGQEAEHE 240

Query: 237 E-EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
           E + +F P+Q+N  L++ A   A+ MHCLPA+RGEE+  +V++    V+FDEAENRLHTQ
Sbjct: 241 ERKKIFAPYQINGDLLAAADKRAIVMHCLPAYRGEEITEDVMEAFSDVIFDEAENRLHTQ 300

Query: 296 KAIL 299
           KAIL
Sbjct: 301 KAIL 304


>gi|258405851|ref|YP_003198593.1| ornithine carbamoyltransferase [Desulfohalobium retbaense DSM 5692]
 gi|257798078|gb|ACV69015.1| ornithine carbamoyltransferase [Desulfohalobium retbaense DSM 5692]
          Length = 304

 Score =  271 bits (693), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 132/299 (44%), Positives = 193/299 (64%), Gaps = 4/299 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  + +I    +  +I+ A+++K       ++  L+GK + ++FEK STRTR+SFE+A
Sbjct: 3   RHFLRILDIPQQEMLPLIQRAQQLKAVRA---QSHLLAGKTILLVFEKASTRTRLSFEMA 59

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           ++ LGG TIF++  E QLGR+E + D+A+V SRYV  +V+RT    +L EL EY  +PV+
Sbjct: 60  VRELGGSTIFMTPMESQLGRSEPLKDSARVFSRYVHGLVVRTFGQEKLEELVEYGAIPVV 119

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+ HPCQ+++D++T  E   ++K ++ +W GDGNN+ HS I  AA+  + L +A P
Sbjct: 120 NALTDSYHPCQVMSDLLTMYERTPALKDQVVAWIGDGNNMAHSWINAAAQVGFHLQMAVP 179

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREEHVFQPF 244
            G EP    L  AR  GA ++L  D  +AV GA  V TD W SM ++         F  +
Sbjct: 180 AGYEPDAGLLEQARAAGARISLSQDPREAVTGADYVNTDVWASMGDEAEAEERARAFAGY 239

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
            V+  L+ +A+P    MHCLPAHRGEE+   V++GP S+V+D+AENRLH QKAIL W F
Sbjct: 240 LVDEELLRLANPGVKVMHCLPAHRGEEISEAVMEGPASIVWDQAENRLHMQKAILEWVF 298


>gi|302528035|ref|ZP_07280377.1| ornithine carbamoyltransferase [Streptomyces sp. AA4]
 gi|302436930|gb|EFL08746.1| ornithine carbamoyltransferase [Streptomyces sp. AA4]
          Length = 308

 Score =  271 bits (693), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 132/306 (43%), Positives = 194/306 (63%), Gaps = 9/306 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           P+HF    +++ +  + ++++A ++K    +    K L+G+ +A IFEK STRTR SFEV
Sbjct: 2   PRHFLRDDDVTPAEQAALLDLADQLK---ADPLGTKALTGRTVAAIFEKNSTRTRFSFEV 58

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG  + + G  MQLGR ETI DT++VLSRYVDA+V RT    R+  +   A++P+
Sbjct: 59  GISQLGGHPVIVDGRSMQLGREETIEDTSRVLSRYVDAVVWRTFAQKRIDSMASVASIPI 118

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLNIA 183
           INALTD  HPCQ++ D+MT  E +G + G   ++ GDG NN+ HSL+ G       + + 
Sbjct: 119 INALTDEFHPCQVLTDLMTIRERKGKLAGLTLTYLGDGANNMAHSLLLGGTTAGMNVRVV 178

Query: 184 TPIGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE- 238
           +P G +P  + +  A+ +    G S  ++ DA +AV+G+  + TDTW SM QE    +  
Sbjct: 179 SPEGFQPDQQVMLDAKQRGTETGGSATVYTDAHEAVEGSDVLVTDTWTSMGQENDGLDRV 238

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F+  Q+N  L+  A  +A+ +HCLPAHRG E+ +EVLDGP S V+DEAENRLH QKA+
Sbjct: 239 GPFRALQINAGLLKRAADEAIVLHCLPAHRGWEITDEVLDGPASAVWDEAENRLHAQKAL 298

Query: 299 LLWCFG 304
           L+W FG
Sbjct: 299 LVWLFG 304


>gi|88602403|ref|YP_502581.1| ornithine carbamoyltransferase [Methanospirillum hungatei JF-1]
 gi|121697661|sp|Q2FPP7|OTC_METHJ RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|88187865|gb|ABD40862.1| ornithine carbamoyltransferase [Methanospirillum hungatei JF-1]
          Length = 302

 Score =  271 bits (693), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 139/296 (46%), Positives = 183/296 (61%), Gaps = 1/296 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K F  + +IS   L+ +I  A+K+K       +   L+ K L MIFEK STRTR+SFE  
Sbjct: 3   KDFISILDISREELANLIAHARKLKEERRVGIQTPVLAHKTLGMIFEKSSTRTRISFEAG 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FL+  +MQLGR E I DTA+V+SR+V AI++R   H  +LEL  +A +PVI
Sbjct: 63  MFELGGHALFLNPKDMQLGRGEAIRDTARVMSRFVSAIMIRANRHDEVLELAAHADIPVI 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D  HPCQI+ADIMT EE     +G   +W GDGNN+  SLI         + +A+P
Sbjct: 123 NGLSDREHPCQILADIMTIEERLFRTEGVKVAWIGDGNNVCTSLILSTILTGMEVIVASP 182

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHVFQPF 244
               P  + ++ A   GA V +  D  +A  GA  V TDTWISM QE +  R   +F P+
Sbjct: 183 SEFAPGEDVVSEALRMGAKVRIVTDPREAATGADVVMTDTWISMGQEEEIDRRRQIFMPY 242

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           QVN  LM+ A P A+ MHCLPAHR  E+ +EVLD   S V+D+AENRLH QKA+L+
Sbjct: 243 QVNAELMACAKPGAIVMHCLPAHRNWEITDEVLDSKASAVWDQAENRLHAQKALLV 298


>gi|298674823|ref|YP_003726573.1| ornithine carbamoyltransferase [Methanohalobium evestigatum Z-7303]
 gi|298287811|gb|ADI73777.1| ornithine carbamoyltransferase [Methanohalobium evestigatum Z-7303]
          Length = 303

 Score =  271 bits (693), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 133/301 (44%), Positives = 193/301 (64%), Gaps = 3/301 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH   ++++S   +  +++ A+ +K         + L  K LAMIFEKPSTRTRVSFEVA
Sbjct: 2   KHLISMADLSDEVIHELLDSAQDLKEKRARDKVTELLKNKSLAMIFEKPSTRTRVSFEVA 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  ++L+  ++QL R E I DTA VLSRYV  I  R  +H  + ++ +Y+TVPVI
Sbjct: 62  MSDLGGHGLYLNYKDIQLDRGEPISDTAAVLSRYVHGIAGRVNSHDTIKQMAKYSTVPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NAL+D  HPCQI+AD++T +E++   K   F+W GDGNN+ +S I G A     + +A P
Sbjct: 122 NALSDMEHPCQILADLLTIQEYKNRTKNLKFAWVGDGNNVCNSAILGCAIVGMDIVVACP 181

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV--FQP 243
            G EP +  +   +  G +V + HD  +A + A  ++TD WISM  E + RE+ +     
Sbjct: 182 EGYEPNSYIVEQGKKIGGNVTITHDPAEAAENADILYTDVWISMGDE-EEREKRLNDLGG 240

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +Q+N +L+++A  D + MHCLPAHRGEE+  +VL+G  SV+FD+AENRLH QKA++L   
Sbjct: 241 YQINSNLVNLAKRDVIVMHCLPAHRGEEITEDVLNGSHSVIFDQAENRLHAQKALILKLM 300

Query: 304 G 304
           G
Sbjct: 301 G 301


>gi|77920009|ref|YP_357824.1| ornithine carbamoyltransferase [Pelobacter carbinolicus DSM 2380]
 gi|123573595|sp|Q3A1V3|OTC_PELCD RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|77546092|gb|ABA89654.1| ornithine carbamoyltransferase [Pelobacter carbinolicus DSM 2380]
          Length = 302

 Score =  271 bits (692), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 132/295 (44%), Positives = 186/295 (63%), Gaps = 1/295 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K F  L++ S   L  +  +A  +K   +   ++  L GK L M+FEK STRTRVSFEV 
Sbjct: 3   KDFLCLTDWSLEELENLFTLAADLKAKQKAGEQHHLLKGKTLGMLFEKSSTRTRVSFEVG 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLS    Q+GR E I DT +V+SRYVD I++RT +   + EL +++T+P+I
Sbjct: 63  MYQLGGHALFLSSGSTQMGRGEPIKDTGRVMSRYVDGIMIRTFSQEGVEELAQWSTIPII 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ++AD++T  EH+ + +   + W GDGNN+ +S I  AA F + L +ATP
Sbjct: 123 NGLTDMYHPCQVMADLLTVIEHKKNYRDLTYCWIGDGNNMANSWINAAAMFGFELRVATP 182

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQ-EFKAREEHVFQPF 244
            G EP    +  A+  GA V   +D ++A +GAH + TD W SM Q E +A+    F  F
Sbjct: 183 KGYEPHALVVERAKKLGARVTYLNDPLEAARGAHVLNTDVWASMGQEEEQAKRAAAFAGF 242

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           Q+N   ++ A P  + +HCLPAHR EE+ +E ++   +VVFDEAENRLH QKAI+
Sbjct: 243 QINAETIAAADPACILLHCLPAHRDEEITDEAIESSHAVVFDEAENRLHIQKAIM 297


>gi|120555229|ref|YP_959580.1| ornithine carbamoyltransferase [Marinobacter aquaeolei VT8]
 gi|166918656|sp|A1U324|OTC_MARAV RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|120325078|gb|ABM19393.1| ornithine carbamoyltransferase [Marinobacter aquaeolei VT8]
          Length = 304

 Score =  271 bits (692), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 136/296 (45%), Positives = 189/296 (63%), Gaps = 6/296 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L++++++ L  +++ A K++    +      L  +VLAMIFEK STRTRVSFE  
Sbjct: 4   RHFLTLNDMTTAELEDLLDHASKLRKEWRSGQTRDTLKNRVLAMIFEKSSTRTRVSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLS  + QLGR E I D+A V+S  VDA+++RT  H  +      ++ PVI
Sbjct: 64  MTQLGGSAMFLSPKDTQLGRGEPIEDSAIVISSMVDAVMIRTFAHETVERFATASSKPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD  HPCQ++AD+ T+ E RGS++G   +W GDGNN+ HS I  A RF++ LN+A P
Sbjct: 124 NALTDEFHPCQLLADMQTYRELRGSIRGATVAWIGDGNNMCHSYINAAERFDFRLNVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQ--EFKAREEHVFQP 243
            G EP  + +         V +     +A +GA  + TD W SM Q  E KARE+  F+ 
Sbjct: 184 EGYEPDQQLIE---QHADRVTVVRAPEEAARGAQLLVTDVWASMGQEDEQKAREK-AFRS 239

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           +Q+N +LM+ A  DALFMHCLPAHRGEE+  +++D   S V+ EAENRLH QKA+L
Sbjct: 240 YQINPALMAQADKDALFMHCLPAHRGEEISADMMDHESSAVWHEAENRLHAQKALL 295


>gi|148656527|ref|YP_001276732.1| ornithine carbamoyltransferase [Roseiflexus sp. RS-1]
 gi|148568637|gb|ABQ90782.1| ornithine carbamoyltransferase [Roseiflexus sp. RS-1]
          Length = 313

 Score =  271 bits (692), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 138/311 (44%), Positives = 190/311 (61%), Gaps = 11/311 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK------PLSGKVLAMIFEKPSTRTR 59
           +HF   ++++ +    +++ A+ +K    N    +      PL GK LA++FEKPS RTR
Sbjct: 3   RHFLSAADLTRTEAEALLDRAQALKAEWRNGGHARDANGALPLQGKTLALVFEKPSLRTR 62

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           V+FE  M  LGG   +LS +++ +G  E++ D A+ LSR+V AI  R   H+ +  L  Y
Sbjct: 63  VAFEAGMTQLGGHGSYLSANDIDMGGRESVPDVARNLSRWVHAIAARVFRHATVETLARY 122

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ATVPVINAL+D  HPCQ +AD++T  EH G + G   ++ GDGNN+ HSL+   A     
Sbjct: 123 ATVPVINALSDREHPCQALADMLTLREHYGRLAGLTLAYVGDGNNVAHSLMLLGATLGMN 182

Query: 180 LNIATPIGSEPRNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK- 234
           + I  P    P  E L  A        AS+ +    V+AV+GA  V+TD W SM QE + 
Sbjct: 183 IRIGCPPDYRPDPEILTLAERLAAEHNASIWITPSPVEAVEGADAVYTDVWASMGQEHEA 242

Query: 235 AREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHT 294
           AR   +FQP+QVN  LM+ A   ALFMHCLPAHRGEEV  +V+DG QSVVF++AENRLH 
Sbjct: 243 ARRRPIFQPYQVNALLMTHARSGALFMHCLPAHRGEEVTADVIDGSQSVVFEQAENRLHV 302

Query: 295 QKAILLWCFGI 305
           QKA++L   G+
Sbjct: 303 QKALILTLLGL 313


>gi|255019821|ref|ZP_05291897.1| Ornithine carbamoyltransferase [Acidithiobacillus caldus ATCC
           51756]
 gi|254970750|gb|EET28236.1| Ornithine carbamoyltransferase [Acidithiobacillus caldus ATCC
           51756]
          Length = 313

 Score =  271 bits (692), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 144/306 (47%), Positives = 193/306 (63%), Gaps = 7/306 (2%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT P+HF  L ++S + L+ ++  A ++K  +     + PL GK LAMIFEK STRTRVS
Sbjct: 1   MTTPRHFLRLQDLSRAELTALLHRAAELKRQTRAGEVHAPLRGKTLAMIFEKSSTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FEV M  LGG  +FLS  + QLGR E+I DTA+VLSR VD +++RT  H  LL     + 
Sbjct: 61  FEVGMAQLGGHALFLSPRDTQLGRGESIEDTARVLSRMVDLVMIRTFGHDNLLRFAAASR 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLL 180
           VPVIN L+D+ HPCQ++AD++T +E  G ++G+  ++ GDG NN+  S +E A   ++ L
Sbjct: 121 VPVINGLSDDHHPCQLLADLLTAQELWGDLRGRRIAFIGDGSNNMARSWMEAADLLDFEL 180

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVF-TDTWISMNQEF-KAREE 238
            I  P    P  E     R   A  + F D+  A      +  TD W SM QE  +A  +
Sbjct: 181 RIGAPRAFWPSAEL----RAAHAGHSHFFDSAAAAAEGAGMLVTDVWTSMGQEAEQAARK 236

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F PFQVN  LM+ A P A+FMHCLPAHRGEEV  EVL+GP+S+V+DEAENRLH QKA+
Sbjct: 237 ATFGPFQVNAELMAKAAPGAVFMHCLPAHRGEEVTAEVLEGPRSLVWDEAENRLHAQKAL 296

Query: 299 LLWCFG 304
           + +  G
Sbjct: 297 MEFLSG 302


>gi|317131147|ref|YP_004090461.1| ornithine carbamoyltransferase [Ethanoligenens harbinense YUAN-3]
 gi|315469126|gb|ADU25730.1| ornithine carbamoyltransferase [Ethanoligenens harbinense YUAN-3]
          Length = 300

 Score =  271 bits (692), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 132/300 (44%), Positives = 189/300 (63%), Gaps = 2/300 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH   L ++S+  +  I+ +  ++K   ++   +  L+GK L MIFEK STRTRVSFE  
Sbjct: 2   KHLLKLLDLSTQEILDILNLGDQLKYELKHGIPHPRLAGKSLGMIFEKASTRTRVSFETG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLS  E Q+GR E I DTA+VLSRY+  I++RT   + +  L ++A++P+I
Sbjct: 62  MYQLGGHALFLSSKESQIGRGEPIQDTARVLSRYLSGIMIRTFEQAEVQALADHASIPII 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ++AD+MT  EH+G ++G    + GDGNN+ +SLI G  +    + +ATP
Sbjct: 122 NGLTDFAHPCQVLADLMTVREHKGRLEGLKLCFIGDGNNMANSLIVGGLKVGMQVAVATP 181

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
              EP    L++A+ QG   +L    ++A  GA  V TD W SM QE + A+    F  +
Sbjct: 182 ENYEPDASVLDFAQKQGG-FSLVRSPLEAAAGADVVITDVWASMGQEEEAAKRRKAFAGY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QVN  LM++A PDA+  HCLPAHRGEE+  +V +     +F+EAENRLH QKA+++   G
Sbjct: 241 QVNKELMAVAKPDAMVQHCLPAHRGEEITADVFEAHADEIFEEAENRLHAQKAVMVQLMG 300


>gi|34497448|ref|NP_901663.1| ornithine carbamoyltransferase [Chromobacterium violaceum ATCC
           12472]
 gi|56404396|sp|Q7NWJ6|OTC_CHRVO RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|34103303|gb|AAQ59665.1| ornithine carbamoyltransferase [Chromobacterium violaceum ATCC
           12472]
          Length = 307

 Score =  271 bits (692), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 141/305 (46%), Positives = 192/305 (62%), Gaps = 7/305 (2%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT  +H+   S++S      + E ++ +K        ++PL GKV++M+FEK STRTRVS
Sbjct: 1   MTSVRHYLQFSDLSPDEYHHLFERSRVLKRRQSAGELHRPLVGKVMSMVFEKNSTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  +FL     Q+GR E I DTA+VLSR  D I++RT     +  L  ++ 
Sbjct: 61  FEAGMAQLGGHAMFLDTKSSQIGRGEPIEDTARVLSRMSDIIMIRTFEQGLVQRLAAHSR 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LT+  HPCQ++ADI T+ E  GS+KGK  +W GDGNN+  + ++ AA   + L 
Sbjct: 121 VPVINGLTNEYHPCQVLADIFTYVERHGSIKGKTVAWVGDGNNVCRTWLQAAAVLGFKLK 180

Query: 182 IATPIGSEPRNEYLNWARNQGASV-ALFHDAVQAVKGAHCVFTDTWISMN--QEFKAREE 238
           +A+P+G E +   L+  R+ G+ V  +  D  +AV GA  V TD + SM    E  AR E
Sbjct: 181 VASPLGYELQT--LD-GRHYGSDVLEMTRDPARAVHGADIVTTDVFTSMGFEAEQAARRE 237

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F+ +QV   LM  A P+ALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENR+H QKA+
Sbjct: 238 -AFEGYQVTAELMKQAKPEALFMHCLPAHRGEEVAAEVIDGPQSVVWDEAENRMHVQKAL 296

Query: 299 LLWCF 303
           + +  
Sbjct: 297 IEYLL 301


>gi|218883451|ref|YP_002427833.1| ornithine carbamoyltransferase [Desulfurococcus kamchatkensis
           1221n]
 gi|218765067|gb|ACL10466.1| ornithine carbamoyltransferase [Desulfurococcus kamchatkensis
           1221n]
          Length = 314

 Score =  270 bits (691), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 147/305 (48%), Positives = 195/305 (63%), Gaps = 14/305 (4%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKN---SSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           +HF  L+  S   L  +I  A + K    + E I     L G+ LAMIFEKPSTRTR+SF
Sbjct: 8   RHFLTLAEYSREELLFMIRTAMQFKQRYLAGERII--PLLVGRHLAMIFEKPSTRTRISF 65

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E AMK LGGD I+LS SE+QL R ETI DTA+VLSRYVD I+ R   H ++ +L +Y+ V
Sbjct: 66  ETAMKELGGDAIYLSASELQLARGETIEDTARVLSRYVDVIMARVYEHYKIEKLAQYSRV 125

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKL-FSWSGD-GNNILHSLIEGAARFNYLL 180
           PVIN L+D  HP Q ++D++T  E +G    +L   + GD G+N+LHSL+         +
Sbjct: 126 PVINGLSDLHHPAQALSDVLTIMEKKGGDITRLKIVFVGDGGDNVLHSLMLATGILGGKI 185

Query: 181 NIATPIGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR 236
            IA+P G EP    +      A   G S  +  D  +AV+ A  V+TD W+SM QE K +
Sbjct: 186 IIASPKGYEPHPSVVKLFNEHASPNGGSYEIERDPFKAVENADVVYTDVWVSMGQE-KEK 244

Query: 237 EEHV--FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHT 294
           E+ +   +P++V + LM+ A PDA+FMHCLPAHRGEEV+NEV+DG  SVV+D+AENR H 
Sbjct: 245 EKRIKDLEPYRVTVELMNHAKPDAIFMHCLPAHRGEEVVNEVIDGKWSVVWDQAENRKHA 304

Query: 295 QKAIL 299
           QKAIL
Sbjct: 305 QKAIL 309


>gi|33594409|ref|NP_882053.1| ornithine carbamoyltransferase [Bordetella pertussis Tohama I]
 gi|33597128|ref|NP_884771.1| ornithine carbamoyltransferase [Bordetella parapertussis 12822]
 gi|33600972|ref|NP_888532.1| ornithine carbamoyltransferase [Bordetella bronchiseptica RB50]
 gi|56404403|sp|Q7VTJ8|OTC_BORPE RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|56404404|sp|Q7W7H7|OTC_BORPA RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|56404405|sp|Q7WKW6|OTC_BORBR RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|33564484|emb|CAE43797.1| ornithine carbamoyltransferase [Bordetella pertussis Tohama I]
 gi|33566579|emb|CAE37836.1| ornithine carbamoyltransferase [Bordetella parapertussis]
 gi|33575407|emb|CAE32484.1| ornithine carbamoyltransferase [Bordetella bronchiseptica RB50]
 gi|332383820|gb|AEE68667.1| ornithine carbamoyltransferase [Bordetella pertussis CS]
          Length = 313

 Score =  270 bits (691), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 134/298 (44%), Positives = 190/298 (63%), Gaps = 9/298 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF    + S + ++ ++E  + IK+  +    + PL  + LAM+FEK STRTRVSFE  
Sbjct: 12  RHFLQFKDFSPAEIAYVLERTRIIKDKFKRYEPHMPLHDRTLAMVFEKASTRTRVSFEAG 71

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  +GG  I L+ ++ QLGR+E I DTA+V+SR VD +++RT   +R+     ++ VPVI
Sbjct: 72  MYQMGGSVINLTSNDSQLGRSEPIEDTARVISRMVDIVMIRTFEQTRIERFASHSRVPVI 131

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI T+ EHRG + GK  +W GD NN+ ++ ++ A    + L+++TP
Sbjct: 132 NGLTNEYHPCQILADIFTYIEHRGPIAGKTVAWIGDANNMSYTWLQAAEMLGFTLHVSTP 191

Query: 186 IGSEPRNEYLNWARNQGASVAL---FHDAVQAVKGAHCVFTDTWISMNQEFKAREEH-VF 241
            G E     L+ AR    +  +   F D +QA +GAH V TD W SM  E +  E    F
Sbjct: 192 AGYE-----LDPARIGAPAAGVLKQFKDPMQACQGAHLVTTDVWTSMGYEAENEERRAAF 246

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             + V+  +M+ A P A+FMHCLPAHRGEEV  EV+DG QSVV+DEAENRLH QKA++
Sbjct: 247 ADWCVDAEMMAAADPQAVFMHCLPAHRGEEVTGEVIDGAQSVVWDEAENRLHVQKALM 304


>gi|226314883|ref|YP_002774779.1| ornithine carbamoyltransferase [Brevibacillus brevis NBRC 100599]
 gi|226097833|dbj|BAH46275.1| ornithine carbamoyltransferase [Brevibacillus brevis NBRC 100599]
          Length = 311

 Score =  270 bits (691), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 142/299 (47%), Positives = 193/299 (64%), Gaps = 5/299 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K F  +   +   L  ++ ++  +K   +     +PL GK L MIF+K STRTRVSFEV 
Sbjct: 9   KDFLRVDEFNGEELMELLHLSAHVKQLQKLGQPFQPLQGKTLGMIFDKASTRTRVSFEVG 68

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +F+SG E+QLGR E I DTAKVLSRYVDAI++RT +HS + EL  +A++P+I
Sbjct: 69  MHQLGGLGMFMSGKELQLGRGEPISDTAKVLSRYVDAIMIRTFSHSYVEELALHASIPII 128

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ +AD++T  EH+G +KG   ++ GDGNN+ +SL+ GAA     + +ATP
Sbjct: 129 NGLTDLYHPCQALADLLTIWEHKGKLKGIKLAYVGDGNNVANSLVLGAALLGLDVRVATP 188

Query: 186 IGSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN-QEFKAREEHV 240
           +G E     +     +A+  G  + +  D ++AV GA  V+TD W SM  +E        
Sbjct: 189 VGYEMDTTIVAKATGYAKQSGGKMMVTTDPIEAVMGADAVYTDVWTSMGFEEENEVRLKA 248

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           F  +QVN  L++ A  D LF+HCLPAHRGEEV   V+DG +SV+FD+AENRLH QKAIL
Sbjct: 249 FADYQVNEKLVAAADRDYLFLHCLPAHRGEEVTTGVIDGSRSVIFDQAENRLHAQKAIL 307


>gi|168045637|ref|XP_001775283.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162673364|gb|EDQ59888.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 307

 Score =  270 bits (691), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 141/308 (45%), Positives = 189/308 (61%), Gaps = 7/308 (2%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIK---NSSENIFENKPLSGKVLAMIFEKPSTRT 58
           M  P HF  L +     L  I++ A ++K    S +  ++  PL G  +AMIF KPS RT
Sbjct: 1   MKGPTHFLHLDDFDKDTLLHILDRAVEVKARLKSGDKSYQ--PLKGMSMAMIFTKPSMRT 58

Query: 59  RVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTE 118
           RVSFE     LGG  I+L  +++QLG+ E   D A+VLS Y D I+ R   H  LL+L E
Sbjct: 59  RVSFETGFYQLGGHAIYLGPNDIQLGKREETRDIARVLSGYNDVIMARLFGHKDLLDLAE 118

Query: 119 YATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNY 178
           Y+ +PVIN LTD  HPCQI+AD++T  E  G+++G    + GDGNN++HS +  AA   +
Sbjct: 119 YSKIPVINGLTDYNHPCQIMADVLTINEFIGNIEGLKIVYVGDGNNMVHSWLRLAAVLPF 178

Query: 179 LLNIATPIGSEPRNEYLNWARNQGAS-VALFHDAVQAVKGAHCVFTDTWISMNQEFKA-R 236
               A P G EP    +  AR  G S + + HD V+AVKGA+ V+ D W SM Q+  A  
Sbjct: 179 HFICACPRGYEPDAATVERARRAGVSKIEIRHDPVEAVKGANVVYADVWASMGQKEDADN 238

Query: 237 EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
            + VFQ FQVN +LM  A P A FMHCLPA RG E+ + V++GP+S+VF +AENR+H Q 
Sbjct: 239 RKSVFQGFQVNEALMKAAGPQAYFMHCLPAERGVEITDGVIEGPKSIVFPQAENRMHAQN 298

Query: 297 AILLWCFG 304
           AI+L C G
Sbjct: 299 AIMLHCLG 306


>gi|86607419|ref|YP_476182.1| ornithine carbamoyltransferase [Synechococcus sp. JA-3-3Ab]
 gi|86555961|gb|ABD00919.1| ornithine carbamoyltransferase [Synechococcus sp. JA-3-3Ab]
          Length = 314

 Score =  270 bits (691), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 136/302 (45%), Positives = 189/302 (62%), Gaps = 7/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +    LS++S + L+ ++  A ++K     +     L G+VL ++F+K STRTRVSF  A
Sbjct: 15  RDLLKLSDLSPAELAALLVQAAQLKRDPYRV----DLRGRVLGLLFQKASTRTRVSFTAA 70

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M   GG T+ L  + MQ+ R E + DTA+VLSRY+DAI +RT N   L    EYA +PVI
Sbjct: 71  MAQCGGSTLDLVPTAMQMSRGEPLQDTARVLSRYLDAIAIRTYNQRELEIFAEYAEIPVI 130

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD  HPCQ++AD++T +E+ G + G   ++ GDGNN+ HSL+ G A     + +ATP
Sbjct: 131 NALTDQFHPCQVLADLLTIQENFGQLAGLTLAYCGDGNNVAHSLLLGCAMSGIHIRVATP 190

Query: 186 IGSEPRNEYLNWAR--NQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV-FQ 242
            G EP    +  A+   QG+ V +  D  +AV GA  V+TD W SM QE +A      F 
Sbjct: 191 PGYEPDAAVVAEAQALAQGSQVWVLRDPYEAVAGAQVVYTDVWASMGQEDQAEARKADFL 250

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           P+QVN  L+  A  +A+ +HCLPAHR EE+  EVL+G QS V+D+AENRLH QKA+L+  
Sbjct: 251 PYQVNAKLLKQAAREAIVLHCLPAHREEEITAEVLEGSQSRVWDQAENRLHVQKALLIQL 310

Query: 303 FG 304
            G
Sbjct: 311 LG 312


>gi|307152635|ref|YP_003888019.1| ornithine carbamoyltransferase [Cyanothece sp. PCC 7822]
 gi|306982863|gb|ADN14744.1| ornithine carbamoyltransferase [Cyanothece sp. PCC 7822]
          Length = 309

 Score =  270 bits (691), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 132/305 (43%), Positives = 196/305 (64%), Gaps = 10/305 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    ++++S+  +S ++++A+ +K       E KP+  K+L ++F K STRTRVSF  A
Sbjct: 9   KDILSIADLSTKEISALLQLARDLKKG-----EKKPICQKILGLLFYKASTRTRVSFTTA 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  I L+ S  Q+GR E I DTA+VL+RY+D + +RT     L     YA +P+I
Sbjct: 64  MYQLGGQVIDLNPSVTQVGRGEPISDTARVLARYLDILAIRTFKQEDLQTFAHYADIPII 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NAL+D  HPCQI+AD++T +E  G+++G   S+ GDGNN+ HS++ G A     + IATP
Sbjct: 124 NALSDLEHPCQILADLLTIQECFGTLEGITLSYFGDGNNVAHSILLGGALMGMKVCIATP 183

Query: 186 IGSEPRNEYLNWAR----NQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HV 240
              +P +  +  A+    + G  + L  D V+A KG+H ++TD W SM QE  A     V
Sbjct: 184 DDYKPDSGVVEQAQALAASHGGEIFLTKDPVEAAKGSHVLYTDVWASMGQEASADARIPV 243

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           FQP+Q+N  L+S A  +A+ +HCLPAHRGEE+ +EV++G QS V+D+AENR+H QKA+++
Sbjct: 244 FQPYQLNEKLLSYADKEAIVLHCLPAHRGEEITSEVIEGKQSRVWDQAENRMHAQKALMV 303

Query: 301 WCFGI 305
              GI
Sbjct: 304 SVLGI 308


>gi|302348105|ref|YP_003815743.1| Ornithine carbamoyltransferase [Acidilobus saccharovorans 345-15]
 gi|302328517|gb|ADL18712.1| Ornithine carbamoyltransferase [Acidilobus saccharovorans 345-15]
          Length = 315

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 145/312 (46%), Positives = 197/312 (63%), Gaps = 16/312 (5%)

Query: 2   MTYP-----KHFADLSNISSSNLSCIIEVAKKIKN---SSENIFENKPLSGKVLAMIFEK 53
           MT P     K F  L++ S+  ++ ++++++++K    + E + +   L G+ +AMIFEK
Sbjct: 1   MTSPHELKGKDFLCLTDYSTEQINFLLDLSRQMKERFYAGERMLDT--LRGRSVAMIFEK 58

Query: 54  PSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRL 113
           PSTRTRVS EVA   LG   I LS SE+QLGR E+I DTA+ LSR+VDAI  R  NH  L
Sbjct: 59  PSTRTRVSLEVAAYQLGALPIMLSSSELQLGRGESIPDTARTLSRFVDAIAARVRNHRDL 118

Query: 114 LELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEG 172
             L +YATVPVINAL+D +HP Q +AD +T  E +G   G   ++ GDG +N+LHSL+  
Sbjct: 119 EVLAQYATVPVINALSDLSHPLQALADYLTIYEKKGKFSGLKLAFVGDGSDNMLHSLMVV 178

Query: 173 AARFNYLLNIATPIGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWIS 228
            A+    + +A+P   +P    L  A       GA +       +AV GA  V+TD W+S
Sbjct: 179 GAKLGVSIYVASPASLKPNESILAAAMKDAEITGAEIKFTEKPEEAVDGADIVYTDVWVS 238

Query: 229 MNQEFKAR-EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDE 287
           M QE  A  +  +  P+QVN  LM  A   A+FMHCLPAHRGEEV ++V+DGP SVV+DE
Sbjct: 239 MGQESMAEAKRKLLAPYQVNAKLMERASSRAIFMHCLPAHRGEEVTDDVIDGPWSVVWDE 298

Query: 288 AENRLHTQKAIL 299
           AENRLHT+KA+L
Sbjct: 299 AENRLHTEKAVL 310


>gi|221065674|ref|ZP_03541779.1| ornithine carbamoyltransferase [Comamonas testosteroni KF-1]
 gi|220710697|gb|EED66065.1| ornithine carbamoyltransferase [Comamonas testosteroni KF-1]
          Length = 307

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 135/297 (45%), Positives = 191/297 (64%), Gaps = 4/297 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH+   S+ ++     ++E A  IK   +   ++  L+ + +AMIFEK STRTRVSFE  
Sbjct: 2   KHYLQFSDFTADEYDYLLERAALIKKKFKGYEKHHTLTDRTMAMIFEKASTRTRVSFEAG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  + L+  + QLGR+E I D+A+V+SR  D +++RT    ++    EY+ VPVI
Sbjct: 62  MYQLGGSVVHLTTGDSQLGRSEPIEDSARVISRMTDLVMIRTFGQDKIARFAEYSRVPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI TF EHRGS+KGK+ +W GDGNN+ ++ ++ A    + ++++TP
Sbjct: 122 NGLTNEFHPCQILADIFTFIEHRGSIKGKVVAWVGDGNNMANTWLQAADLLGFTVHVSTP 181

Query: 186 IGSEPRNEY-LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF--KAREEHVFQ 242
            G E   +   N          +F D ++A KGA  V TD W SM  E   +AR++  F 
Sbjct: 182 GGYEVDEQLAFNGKPVNPGCYKVFKDPLEACKGADLVTTDVWTSMGYEAENEARKK-AFA 240

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            + V+  +M+ A  DALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENR+H QKA++
Sbjct: 241 DWCVDAEMMASAKSDALFMHCLPAHRGEEVEAEVIDGPQSVVWDEAENRMHVQKALM 297


>gi|317052067|ref|YP_004113183.1| ornithine carbamoyltransferase [Desulfurispirillum indicum S5]
 gi|316947151|gb|ADU66627.1| ornithine carbamoyltransferase [Desulfurispirillum indicum S5]
          Length = 306

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 139/301 (46%), Positives = 193/301 (64%), Gaps = 6/301 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF  L +     L+ I+ +A  +K   +    +  L+GK LAMIFEK STRTRVSFE  
Sbjct: 2   KHFLALRDYHKDELTHILNLAFTLKRELKQNIAHPKLAGKTLAMIFEKSSTRTRVSFETG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  +FLS +++Q+GR E I DTA VLSRYVD I++RT  HS + EL  +++VPVI
Sbjct: 62  IFQLGGVGLFLSSNDLQMGRGEPIRDTAAVLSRYVDGIMIRTFAHSTVEELARHSSVPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKL-FSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           N L+D  HPCQ +AD+MT  EH      ++  ++ GDGNN+ +SLI GAA   Y ++IA+
Sbjct: 122 NGLSDLLHPCQAMADVMTMLEHSDKPLEEIKLAYVGDGNNVANSLIYGAASLGYSISIAS 181

Query: 185 PIGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-H 239
           P G E  +         AR+ GA +   HD  +A++GA  V+TD W SM QE + +E   
Sbjct: 182 PKGYEVADHVAQQASTIARSTGAPIHYTHDPAEAIRGADFVYTDVWASMGQEDQQQERLR 241

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ F V   LM +  P+  F+HCLPA+R +EV  EV DGP+S+++D+AENRLH QKAI+
Sbjct: 242 AFEGFTVTEKLMQLGTPNCKFLHCLPAYRDKEVSAEVCDGPRSIIYDQAENRLHAQKAIM 301

Query: 300 L 300
           +
Sbjct: 302 V 302


>gi|163847143|ref|YP_001635187.1| ornithine carbamoyltransferase [Chloroflexus aurantiacus J-10-fl]
 gi|222524980|ref|YP_002569451.1| ornithine carbamoyltransferase [Chloroflexus sp. Y-400-fl]
 gi|163668432|gb|ABY34798.1| ornithine carbamoyltransferase [Chloroflexus aurantiacus J-10-fl]
 gi|222448859|gb|ACM53125.1| ornithine carbamoyltransferase [Chloroflexus sp. Y-400-fl]
          Length = 309

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 135/305 (44%), Positives = 191/305 (62%), Gaps = 6/305 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNS-SENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           +HF   ++++ +    +++ A  +K +       ++PL G+ LA++FEKPS RTRV+FE 
Sbjct: 4   RHFLSAADLNRAEAEALLDRAAMLKAAWRAGQVNDRPLLGQTLALVFEKPSLRTRVAFEA 63

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG   +LS +++ +G  E++ D A+ LSR+V  I  R   H+ +  L  YATVPV
Sbjct: 64  GMTQLGGHPSYLSANDIDMGGRESVPDVARNLSRWVAIIAARVFKHATVETLARYATVPV 123

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INAL+D  HPCQ +AD++T  E  G ++G   ++ GDGNN+ HSL+   A     L I  
Sbjct: 124 INALSDREHPCQALADMLTLRERFGRLQGLTLAYVGDGNNVCHSLMLLGATLGLNLRIGC 183

Query: 185 PIGSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEH 239
           P    P  + +      A+   A++A+    V+AV GA  V+TD W SM QE + AR   
Sbjct: 184 PPDYRPAPDIIELTERLAQEHDATLAITASPVEAVSGADAVYTDVWASMGQEHEAARRRP 243

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           VF P+QVN +LM+ A P AL MHCLPAHRGEEV  EV+DGPQSVVF++AENRLH QKA++
Sbjct: 244 VFTPYQVNTALMAHAAPHALAMHCLPAHRGEEVTAEVIDGPQSVVFEQAENRLHVQKALI 303

Query: 300 LWCFG 304
           L+  G
Sbjct: 304 LFLLG 308


>gi|325674252|ref|ZP_08153941.1| ornithine carbamoyltransferase [Rhodococcus equi ATCC 33707]
 gi|325554932|gb|EGD24605.1| ornithine carbamoyltransferase [Rhodococcus equi ATCC 33707]
          Length = 312

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 137/305 (44%), Positives = 191/305 (62%), Gaps = 10/305 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRVSFEV 64
           +HF    +++ +  + ++ +A+++K    N F  KPL G + + +IF+K STRTR SFE+
Sbjct: 4   RHFLRDDDLTPAEQAEVLGLARELK---ANPFSRKPLEGPRGVGVIFDKNSTRTRFSFEM 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG  + + GS+ QLGR ET+ DT +VLSR+VDA+V RT    RL ++ E ATVP+
Sbjct: 61  GIAQLGGHAVVVDGSKTQLGRDETLQDTGRVLSRFVDAVVWRTFGQERLEQMAEGATVPI 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLNIA 183
           +NAL+D  HPCQ++AD+ T  E +G + G   ++ GDG NN+ HSL+ G       + IA
Sbjct: 121 VNALSDQFHPCQVLADLQTITERKGELAGLRLTYLGDGANNMAHSLLLGGVTAGMHVTIA 180

Query: 184 TPIG----SEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE- 238
            P+G              A   GA V L  D   AV GA  + TDTW SM QE    +  
Sbjct: 181 APLGFAPDPAVVAAARTRAEQTGAMVTLVDDPQAAVAGADVLVTDTWTSMGQEEDGLDRV 240

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F+PFQ+N  L++ A PDA+ +HCLPAHRGEE+ +EVLDGPQS  +DEAENRLH QKA+
Sbjct: 241 GPFRPFQINAELLAQAAPDAVVLHCLPAHRGEEITDEVLDGPQSAAWDEAENRLHAQKAL 300

Query: 299 LLWCF 303
           L+W  
Sbjct: 301 LVWLL 305


>gi|168048963|ref|XP_001776934.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162671635|gb|EDQ58183.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 348

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 141/305 (46%), Positives = 186/305 (60%), Gaps = 7/305 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIK---NSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           P HF  L +     L  I++ A ++K    S +  ++  PL G  ++MIF KPS RTRVS
Sbjct: 45  PIHFLHLDDFDKETLVHILDRAAEVKAKLKSGDRSYQ--PLKGMSMSMIFTKPSMRTRVS 102

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE     LGG  I+L   ++QLG+ E   D A+VLS Y D I+ R   H  LL+L EY+ 
Sbjct: 103 FETGFYQLGGHAIYLGPDDIQLGKREETRDIARVLSGYNDVIMARLFAHKDLLDLAEYSK 162

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD  HPCQI+AD++T  E  GS++G    + GDGNN++HS +  AA F +   
Sbjct: 163 VPVINGLTDYNHPCQIMADVLTINEFIGSIEGLKVVYVGDGNNMVHSWLRLAAVFPFHFV 222

Query: 182 IATPIGSEPRNEYLNWARNQGAS-VALFHDAVQAVKGAHCVFTDTWISMNQ-EFKAREEH 239
            A P G EP    +  AR  G S + + HD  +AVKGA+ ++ D W SM Q E     + 
Sbjct: 223 CACPKGYEPDAATVERARRAGVSRIEISHDPTEAVKGANVIYADVWASMGQKEDAGNRKK 282

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           VFQ FQVN +LM  A P A FMHCLPA RG EV + V++GP+S+VF +AENR+H Q AI+
Sbjct: 283 VFQGFQVNEALMKSAGPQAYFMHCLPAERGVEVTDGVIEGPKSIVFPQAENRMHAQNAIM 342

Query: 300 LWCFG 304
           L C G
Sbjct: 343 LHCLG 347


>gi|119898478|ref|YP_933691.1| ornithine carbamoyltransferase [Azoarcus sp. BH72]
 gi|189036316|sp|A1K7J9|OTC_AZOSB RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|119670891|emb|CAL94804.1| ArgF protein [Azoarcus sp. BH72]
          Length = 311

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 136/301 (45%), Positives = 188/301 (62%), Gaps = 7/301 (2%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M+ P+H+   S+ +++    + +  + IK   +      PL  + L MIFEK STRTR+S
Sbjct: 1   MSSPRHYLQFSDFTAAEYDHVFQRTRWIKEKFKQYEPYHPLFDRTLVMIFEKASTRTRLS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M+ LGG  I+L+  + QLGR E + D A+V+SR  D +++RT     +     Y+ 
Sbjct: 61  FEAGMQQLGGSAIYLNTRDSQLGRGEPVEDAAQVISRMSDLVMIRTFEQDIIERFAAYSR 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LT+  HPCQI+ADI TF EHRGS+KGK  +W GD NN+ ++ ++ A   ++ + 
Sbjct: 121 VPVINGLTNEYHPCQILADIYTFIEHRGSIKGKTVAWVGDSNNMCNTWLQAAEVLDFKVR 180

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE--- 238
           ++TP G E   E  +      A  A F D ++A +GA  V TD W SM   F+A  E   
Sbjct: 181 VSTPPGYEV--EPTDAGLRGTAHFAQFSDPLEACRGADLVTTDVWTSMG--FEAENEARM 236

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F  + V+  +MS+A PDALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA+
Sbjct: 237 KAFADWCVDAEMMSVAAPDALFMHCLPAHRGEEVTAEVIDGPQSVVWDEAENRLHVQKAL 296

Query: 299 L 299
           +
Sbjct: 297 M 297


>gi|325981797|ref|YP_004294199.1| ornithine carbamoyltransferase [Nitrosomonas sp. AL212]
 gi|325531316|gb|ADZ26037.1| ornithine carbamoyltransferase [Nitrosomonas sp. AL212]
          Length = 308

 Score =  270 bits (689), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 139/295 (47%), Positives = 187/295 (63%), Gaps = 3/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF   ++        + E A+ IK   +   +  PLS + LAMIF+K STRTR+SFE  
Sbjct: 4   KHFLQFNDFCRDEYEYLFERARWIKKEFKQYRQYWPLSDRTLAMIFDKNSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  I+LS  + QLGR E + D A+V+SR VD I++RT  H  +    E + VPVI
Sbjct: 64  MHQLGGAAIYLSTRDTQLGRGEPVEDAARVISRMVDLIMVRTYQHDTIKRFAENSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQI++DI T+ E RGS++ K  +W GD NN+ ++ ++ A  FN+ ++++TP
Sbjct: 124 NGLTDEYHPCQIMSDIFTYIEFRGSIEEKTVAWIGDSNNMCNTWLQAAEIFNFQVHVSTP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN-QEFKAREEHVFQPF 244
            G +   E +    N  A   ++ +  +AV  A  V TD W SM  +E   R ++ F  F
Sbjct: 184 PGYDIDPERI--GLNGTAHYEIYTNPREAVMNADLVTTDVWTSMGFEEEVERRKNDFAAF 241

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            VN  +MS+A  DALFMHCLPAHRGEEV  EVLDGPQSVV+DEAENRLHTQKA++
Sbjct: 242 CVNKEMMSLAKSDALFMHCLPAHRGEEVSAEVLDGPQSVVWDEAENRLHTQKALM 296


>gi|163857000|ref|YP_001631298.1| ornithine carbamoyltransferase [Bordetella petrii DSM 12804]
 gi|163260728|emb|CAP43030.1| argF [Bordetella petrii]
          Length = 313

 Score =  270 bits (689), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 136/299 (45%), Positives = 192/299 (64%), Gaps = 11/299 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF    + S + ++ ++E A+ IK+  +    + PL  + LAM+FEK STRTRVSFE  
Sbjct: 12  RHFLQFRDFSPAEIAYVLERARLIKDKFKRYEPHMPLHDRTLAMVFEKASTRTRVSFEAG 71

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  +GG  I L+ ++ QLGR+E I DTA+V+SR VD +++RT   +R+     ++ VPVI
Sbjct: 72  MYQMGGSVINLTSNDSQLGRSEPIEDTARVISRMVDIVMIRTFEQTRIERFASHSRVPVI 131

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI T+ EHRG + GK  +W GD NN+ ++ ++ A    + L+++TP
Sbjct: 132 NGLTNEFHPCQILADIFTYIEHRGPIAGKTVAWIGDANNMSYTWLQAAEMLGFSLHVSTP 191

Query: 186 IGSEPRNEYLNWARNQGASVAL---FHDAVQAVKGAHCVFTDTWISMNQEFK--AREEHV 240
            G E     L+ AR       +   F D ++A +GAH V TD W SM  E +  AR    
Sbjct: 192 RGYE-----LDPARVGTPPAGVLRQFDDPIEACRGAHLVTTDVWTSMGYEAENDARRA-A 245

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           F  + V+  +M+ A P A+FMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA++
Sbjct: 246 FADWCVDAEMMAAADPQAVFMHCLPAHRGEEVTGEVIDGPQSVVWDEAENRLHVQKALM 304


>gi|312139870|ref|YP_004007206.1| ornithine carbamoyltransferase [Rhodococcus equi 103S]
 gi|311889209|emb|CBH48523.1| ornithine carbamoyltransferase [Rhodococcus equi 103S]
          Length = 312

 Score =  270 bits (689), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 137/305 (44%), Positives = 191/305 (62%), Gaps = 10/305 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRVSFEV 64
           +HF    +++ +  + ++ +A+++K    N F  KPL G + + +IF+K STRTR SFE+
Sbjct: 4   RHFLRDDDLTPAEQAEVLGLARELK---ANPFSRKPLEGPRGVGVIFDKNSTRTRFSFEM 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG  + + GS+ QLGR ET+ DT +VLSR+VDA+V RT    RL ++ E ATVP+
Sbjct: 61  GIAQLGGHAVVVDGSKTQLGRDETLQDTGRVLSRFVDAVVWRTFGQERLEQMAEGATVPI 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLNIA 183
           +NAL+D  HPCQ++AD+ T  E +G + G   ++ GDG NN+ HSL+ G       + IA
Sbjct: 121 VNALSDQFHPCQVLADLQTIAERKGELAGLRLTYLGDGANNMAHSLLLGGVTAGMHVTIA 180

Query: 184 TPIG----SEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE- 238
            P+G              A   GA V L  D   AV GA  + TDTW SM QE    +  
Sbjct: 181 APLGFAPDPAVVAAARTRAEQTGAMVTLVDDPQAAVAGADVLVTDTWTSMGQEEDGLDRV 240

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F+PFQ+N  L++ A PDA+ +HCLPAHRGEE+ +EVLDGPQS  +DEAENRLH QKA+
Sbjct: 241 GPFRPFQINAELLAKAAPDAVVLHCLPAHRGEEITDEVLDGPQSAAWDEAENRLHAQKAL 300

Query: 299 LLWCF 303
           L+W  
Sbjct: 301 LVWLL 305


>gi|126435562|ref|YP_001071253.1| ornithine carbamoyltransferase [Mycobacterium sp. JLS]
 gi|126235362|gb|ABN98762.1| ornithine carbamoyltransferase [Mycobacterium sp. JLS]
          Length = 307

 Score =  270 bits (689), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 141/305 (46%), Positives = 194/305 (63%), Gaps = 10/305 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRVSFEV 64
           +HF    +++    + ++ +A ++K   ++   ++PL+G + +A+IF+K STRTR SFEV
Sbjct: 2   RHFLRDDDLTPEEQAEVLALAAELK---KDPLLHRPLAGPRGVAVIFDKNSTRTRFSFEV 58

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG  + + G   QLGR ET+ DT KVLSRYVDAIV RT    RL  +   ATVPV
Sbjct: 59  GIAQLGGHAVVVDGRSTQLGREETLEDTGKVLSRYVDAIVWRTFAQERLTSMAAGATVPV 118

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLNIA 183
           INAL+D  HPCQ++AD+ T  E RG++ G   ++ GDG NN+ HSL+ G A     + IA
Sbjct: 119 INALSDEFHPCQVLADLQTLIERRGALPGLRMAYFGDGANNMAHSLMLGGATAGMHVTIA 178

Query: 184 TPIGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE- 238
            P G EP   ++  A+ +    GASV +  D  QA  GA  + TDTW SM QE    +  
Sbjct: 179 APQGFEPHPMFVAAAQERAALTGASVTVTADPHQAADGADVLVTDTWTSMGQENDGLDRV 238

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F+PFQVN  L+  AH +A+ +HCLPAHRG E+ +EV+DGP S V+DEAENRLH QKA+
Sbjct: 239 RPFRPFQVNTGLLDRAHAEAVVLHCLPAHRGHEITDEVIDGPHSAVWDEAENRLHAQKAL 298

Query: 299 LLWCF 303
           L+W  
Sbjct: 299 LVWLL 303


>gi|224824998|ref|ZP_03698104.1| ornithine carbamoyltransferase [Lutiella nitroferrum 2002]
 gi|224602669|gb|EEG08846.1| ornithine carbamoyltransferase [Lutiella nitroferrum 2002]
          Length = 307

 Score =  270 bits (689), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 142/304 (46%), Positives = 190/304 (62%), Gaps = 5/304 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT  +H+   S+++  +   + + A+ +K    +    +PL GKV++M+FEK STRTRVS
Sbjct: 1   MTQVRHYLQFSDLNRDDYQYLFQRAQVLKRRHGSGELYRPLVGKVMSMVFEKNSTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  +FL  +  QLGR E I DTA+VLSR  D I++RT   S +  L   + 
Sbjct: 61  FEAGMSQLGGHAMFLDANTSQLGRGEPIEDTARVLSRMSDIIMIRTFEQSNVERLAANSR 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LT+  HPCQI+ADI+TF EHRG +KGK  +W GDGNN+  + ++ A   ++ L 
Sbjct: 121 VPVINGLTNEYHPCQILADILTFIEHRGPIKGKTVAWVGDGNNMCRTWLQAAKLLDFKLK 180

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK--AREEH 239
            ATP+G E +   L+            H A  AV GA  V TD + SM  E +  AR E 
Sbjct: 181 AATPVGYELKA--LDGQHYGPEHFEPSHSAEHAVAGADLVTTDVFTSMGFEAESVARME- 237

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ +Q+   LM  A PDALFMHCLPAHRGEEV  +V+DGPQSVV+DEAENR+H QKA++
Sbjct: 238 AFRNYQITADLMKHAKPDALFMHCLPAHRGEEVAADVIDGPQSVVWDEAENRMHGQKALI 297

Query: 300 LWCF 303
            +  
Sbjct: 298 EYLL 301


>gi|312195582|ref|YP_004015643.1| ornithine carbamoyltransferase [Frankia sp. EuI1c]
 gi|311226918|gb|ADP79773.1| ornithine carbamoyltransferase [Frankia sp. EuI1c]
          Length = 313

 Score =  270 bits (689), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 134/303 (44%), Positives = 188/303 (62%), Gaps = 5/303 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF   ++++ +  + +++ A ++K +       +PL+G+ +A+IFEKPS RTRVSFEV 
Sbjct: 4   RHFRLDTDLTPAEQAAVLDTADRLKAARRTSAHPRPLAGRSVALIFEKPSARTRVSFEVG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  I L  + + LG+ E+I D A+VLSRYVDAIV+RT    R+  L    TVPV+
Sbjct: 64  VTELGGHPIVLDANTIGLGKRESIEDIAQVLSRYVDAIVIRTFGQDRVDRLAAAGTVPVV 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NAL+D THPCQ +AD+ T  +H G+ +G   ++ GDGNN+ HSL+   A     + I  P
Sbjct: 124 NALSDFTHPCQALADLQTVRDHLGTTRGVTLTYVGDGNNVAHSLLYAGAMAGAHVRICAP 183

Query: 186 IGSEPR----NEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HV 240
            G EP           A   G SV + HD   A  GA  ++TD W SM QE  A     V
Sbjct: 184 KGYEPDAGVVTRSARLAAGTGGSVEMLHDPAAAADGADVLYTDVWASMGQEADAANRVDV 243

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+P+Q+N +L++ A P    MHCLPAHRG+E+ +  +DGP SVVFD+AENRLH QKA+L 
Sbjct: 244 FRPYQLNEALIAAAKPTVKVMHCLPAHRGDEITDGAMDGPASVVFDQAENRLHAQKALLA 303

Query: 301 WCF 303
           + F
Sbjct: 304 FLF 306


>gi|219849220|ref|YP_002463653.1| ornithine carbamoyltransferase [Chloroflexus aggregans DSM 9485]
 gi|219543479|gb|ACL25217.1| ornithine carbamoyltransferase [Chloroflexus aggregans DSM 9485]
          Length = 309

 Score =  269 bits (688), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 132/305 (43%), Positives = 191/305 (62%), Gaps = 6/305 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNS-SENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           +HF   +++S +    +++ A ++K +    +  ++PL G+ LA++FEKPS RTRV+FE 
Sbjct: 4   RHFLSAADLSRAEAEALLDRAAELKAAWRAGVTNDRPLLGQTLALVFEKPSLRTRVAFEA 63

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG   +LS +++ +G  E++ D A+ LSR+V  I  R   H+ +  L  YATVPV
Sbjct: 64  GMTQLGGHPSYLSANDIDMGGRESVPDVARNLSRWVAIIAARVFKHATVETLARYATVPV 123

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INAL+D  HPCQ +AD++T  E  G ++G   ++ GDGNN+ HSL+   A     + +  
Sbjct: 124 INALSDREHPCQALADMLTLRERFGRLQGLTLAYVGDGNNVCHSLMLLGATLGVNVRVGC 183

Query: 185 PIGSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEH 239
           P+   P  +        A    A++ +    V+AV GA  V+TD W SM QE + AR   
Sbjct: 184 PVDYRPAPDITELTEQLANQHDATLTITTSPVEAVSGADAVYTDVWASMGQEHEAARRRP 243

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           VF P+QVN +LM+ A P AL MHCLPAHRGEEV  +V+DGPQSVVF++AENRLH QKA++
Sbjct: 244 VFTPYQVNAALMAHAAPHALAMHCLPAHRGEEVTADVIDGPQSVVFEQAENRLHVQKALI 303

Query: 300 LWCFG 304
           L+  G
Sbjct: 304 LFLLG 308


>gi|225175993|ref|ZP_03729985.1| ornithine carbamoyltransferase [Dethiobacter alkaliphilus AHT 1]
 gi|225168581|gb|EEG77383.1| ornithine carbamoyltransferase [Dethiobacter alkaliphilus AHT 1]
          Length = 309

 Score =  269 bits (688), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 135/303 (44%), Positives = 197/303 (65%), Gaps = 13/303 (4%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F  +++     L+ I++ A ++K   +   E+  L GK L MIF+K STRTRVSFEV 
Sbjct: 7   RDFLAVNDFFREELAEILDFAIQLKAQHKEGKEHHLLRGKTLGMIFQKASTRTRVSFEVG 66

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLS +++Q+GR E I DTA+VLSRY+D I++RT +H  + +L  +A +PVI
Sbjct: 67  MYQLGGTALFLSANDLQIGRGEPIKDTARVLSRYLDGIMIRTFDHGEVEQLASFADIPVI 126

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ +AD+MT  E +GS+K    ++ GDGNN+ +SL+   ++F   + +A+P
Sbjct: 127 NGLTDLLHPCQAMADLMTVMERKGSLKKLKLAYVGDGNNVANSLLLACSKFGMNVAVASP 186

Query: 186 IGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH-- 239
            G E   + +  A+      G +V L  +  +AVK A  V+TD W SM QE    +EH  
Sbjct: 187 KGYECPKDIVAAAQTNAKIGGTTVTLTDNPQEAVKNADVVYTDVWASMGQE----DEHIS 242

Query: 240 ---VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
              +F+P+QVN  L+ +A+ +A+ +HCLPAHRGEE+   V++G QS VFD+AENRLH QK
Sbjct: 243 RIRIFKPYQVNDELLKVANDEAMVLHCLPAHRGEEITESVMEGEQSAVFDQAENRLHVQK 302

Query: 297 AIL 299
           AI+
Sbjct: 303 AIM 305


>gi|124028062|ref|YP_001013382.1| ornithine carbamoyltransferase [Hyperthermus butylicus DSM 5456]
 gi|189036326|sp|A2BM26|OTC_HYPBU RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|123978756|gb|ABM81037.1| Ornithine carbamoyltransferase [Hyperthermus butylicus DSM 5456]
          Length = 314

 Score =  269 bits (688), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 143/305 (46%), Positives = 191/305 (62%), Gaps = 11/305 (3%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIK---NSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           Y +    + ++SS  +  +IE A+++K    + E I     L GK +A+IFEKPSTRTRV
Sbjct: 6   YGRDLLSIRDLSSEEVWLVIETARQMKLRYYAGERIIPM--LKGKTIALIFEKPSTRTRV 63

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           S EVA   LG   +     E+QL R E I DTA+VLSRYVDAI  R   H  L E+  YA
Sbjct: 64  SMEVAALQLGATPLTFRRDELQLARGEPIKDTARVLSRYVDAIAARVFKHESLEEMAAYA 123

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYL 179
           +VPVIN L+D  HP Q +AD +T  E +G +KG    + GDG NN+ HSL+   A+    
Sbjct: 124 SVPVINMLSDLEHPLQALADALTIYEKKGHIKGIKVVYVGDGRNNVAHSLLLVIAKLGGH 183

Query: 180 LNIATPIGSEPRNEYLN----WARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA 235
           + I++P    PR + L      A+  GA++ L  D  +AV+GA  V+TD W+SM +E  A
Sbjct: 184 IVISSPKELTPRKDILEAAQLAAKETGATIELIEDPAEAVRGADVVYTDVWVSMGEESLA 243

Query: 236 RE-EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHT 294
            E   + Q +QVN  LMS+A  +A+FMHCLPAHRGEEV  EV++GP SVV+D+AENRLH 
Sbjct: 244 EERRRLLQRYQVNEKLMSLASNNAIFMHCLPAHRGEEVTEEVIEGPWSVVWDQAENRLHA 303

Query: 295 QKAIL 299
           QKA+L
Sbjct: 304 QKAVL 308


>gi|317056741|ref|YP_004105208.1| ornithine carbamoyltransferase [Ruminococcus albus 7]
 gi|315449010|gb|ADU22574.1| ornithine carbamoyltransferase [Ruminococcus albus 7]
          Length = 304

 Score =  269 bits (687), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 126/299 (42%), Positives = 187/299 (62%), Gaps = 1/299 (0%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAM 66
           H   + ++S   +  I+ +A ++K  ++N  E+K L GK L MIF+K STRTRVSFE  M
Sbjct: 3   HLLKMLDLSKEEIIDILNLADQLKYENKNGIEHKVLKGKTLGMIFQKSSTRTRVSFETGM 62

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
             LGG  +FLS  ++Q+GR E + DTA+VLSRY+D I++RT     + +L +Y ++P+IN
Sbjct: 63  YQLGGQALFLSNRDLQIGRGEPVQDTARVLSRYLDGIMIRTFEQKEVEDLAQYGSIPIIN 122

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI 186
            LTD  HPCQ++AD+MT  E +G  +G    + GDGNN+ +SLI G  +    ++IA P 
Sbjct: 123 GLTDFCHPCQVLADLMTIREFKGQFEGLKMCYIGDGNNMANSLIVGGLKVGMSVSIACPE 182

Query: 187 GSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV-FQPFQ 245
           G  P  E L +A+  G    +    ++A K A  +FTD W SM +E +  +  V F  +Q
Sbjct: 183 GYRPDPEVLEFAKQYGDKFFMTDKPIEAAKDADVLFTDVWTSMGEEAETEKRKVAFAGYQ 242

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           +N  +M+ A PDA+  HCLPAHR EE+  +V +   + +F+EAENRLH QKA+++   G
Sbjct: 243 INDDIMAAAKPDAMVQHCLPAHREEEITEKVFEAHANEIFEEAENRLHAQKAVMVKVMG 301


>gi|296135415|ref|YP_003642657.1| ornithine carbamoyltransferase [Thiomonas intermedia K12]
 gi|295795537|gb|ADG30327.1| ornithine carbamoyltransferase [Thiomonas intermedia K12]
          Length = 311

 Score =  269 bits (687), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 137/302 (45%), Positives = 184/302 (60%), Gaps = 3/302 (0%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M T  +H+   S+++      +   A  IK   +    ++PL  + LAMIFEK STRTR+
Sbjct: 1   MKTTLRHYLQFSDLNREEYDYVFARAALIKAKFKRYEPHQPLVDRTLAMIFEKHSTRTRL 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFE  M  LGG  I+++  + QLGR E I D A+V SR VD +++RT     +     Y+
Sbjct: 61  SFEAGMHQLGGAAIYINTRDSQLGRGEPIEDAAQVFSRMVDLVMIRTYGQEIVERFAAYS 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
            VPVIN LT+  HPCQI+AD+MT+ EHRG ++GK  +W GD NN+ ++ ++ A    + L
Sbjct: 121 RVPVINGLTNEFHPCQILADVMTYIEHRGPIQGKTVAWIGDANNMFYTWLQAAEVLGFTL 180

Query: 181 NIATP--IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KARE 237
           + A P   G E        +  Q A +  F D  QA +GAH + TD W SM  E  K   
Sbjct: 181 HFAGPKGYGVEKNRPGYPLSAAQIAHLREFDDPRQACEGAHLITTDVWTSMGYEAEKLAR 240

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
           E  F+ F V+  +M+ AH DALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA
Sbjct: 241 EQAFKGFMVDGEMMARAHSDALFMHCLPAHRGEEVAAEVIDGPQSVVWDEAENRLHGQKA 300

Query: 298 IL 299
           ++
Sbjct: 301 LM 302


>gi|108799934|ref|YP_640131.1| ornithine carbamoyltransferase [Mycobacterium sp. MCS]
 gi|119869044|ref|YP_938996.1| ornithine carbamoyltransferase [Mycobacterium sp. KMS]
 gi|108770353|gb|ABG09075.1| ornithine carbamoyltransferase [Mycobacterium sp. MCS]
 gi|119695133|gb|ABL92206.1| ornithine carbamoyltransferase [Mycobacterium sp. KMS]
          Length = 307

 Score =  269 bits (687), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 140/305 (45%), Positives = 195/305 (63%), Gaps = 10/305 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRVSFEV 64
           +HF    +++ +  + ++ +A ++K   ++   ++PL+G + +A+IF+K STRTR SFEV
Sbjct: 2   RHFLRDDDLTPAEQAEVLALAAELK---KDPLLHRPLAGPRGVAVIFDKNSTRTRFSFEV 58

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG  + + G   QLGR ET+ DT KVLSRYVDAIV RT    RL  +   ATVPV
Sbjct: 59  GIAQLGGHAVVVDGRSTQLGREETLEDTGKVLSRYVDAIVWRTFAQERLTSMAAGATVPV 118

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLNIA 183
           INAL+D  HPCQ++AD+ T  E RG++ G   ++ GDG NN+ HSL+ G A     + IA
Sbjct: 119 INALSDEFHPCQVLADLQTLIERRGALPGLRMAYFGDGANNMAHSLMLGGATAGMHVTIA 178

Query: 184 TPIGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE- 238
            P G EP   ++  A+ +    GASV +  D  +A  GA  + TDTW SM QE    +  
Sbjct: 179 APQGFEPHPMFVAAAQERAAQTGASVTVTADPHRAADGADVLVTDTWTSMGQENDGLDRV 238

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F+PFQVN  L+  AH +A+ +HCLPAHRG E+ +EV+DGP S V+DEAENRLH QKA+
Sbjct: 239 RPFRPFQVNTGLLDRAHAEAVVLHCLPAHRGHEITDEVIDGPHSAVWDEAENRLHAQKAL 298

Query: 299 LLWCF 303
           L+W  
Sbjct: 299 LVWLL 303


>gi|229544084|ref|ZP_04433143.1| ornithine carbamoyltransferase [Bacillus coagulans 36D1]
 gi|229325223|gb|EEN90899.1| ornithine carbamoyltransferase [Bacillus coagulans 36D1]
          Length = 317

 Score =  269 bits (687), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 140/303 (46%), Positives = 187/303 (61%), Gaps = 6/303 (1%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           T  K F  +  +    L+ +++ A  +K + +   E   L GKVL MIFEK STRTRVSF
Sbjct: 7   TKKKDFLTIGALQEEELNDLLQEAAALKKAHKEGKETPYLKGKVLGMIFEKSSTRTRVSF 66

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E  M  LGG  +FLS  ++QLGR ETI DTAKVLSRYVD +++RT  H  +     +A V
Sbjct: 67  EAGMLQLGGHALFLSSRDIQLGRGETIHDTAKVLSRYVDCLMIRTFAHETIESFARHADV 126

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLN 181
           PVIN LTD  HP Q++AD++T +E++G + G    + GDG NN+ HSL+EGAA+    ++
Sbjct: 127 PVINGLTDLHHPTQVLADLLTIQEYKGQLAGLKICYLGDGNNNMCHSLLEGAAKAGMHMS 186

Query: 182 IATPIGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE 237
           +A P G  P    L  A+ +    G  + +  +  + ++ A  V TD W SM QE + ++
Sbjct: 187 VAAPEGYLPNAGILAGAQKEAAKKGVCIEMGQNPEEMIRNADVVITDVWASMGQEDETKK 246

Query: 238 E-HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
                Q +QVN SL  +A  D LF+HCLPAHRGEEV   V+DGP S VFDEAENRLH  K
Sbjct: 247 RLEDLQDYQVNESLCKLAKKDFLFLHCLPAHRGEEVTEAVIDGPHSAVFDEAENRLHAHK 306

Query: 297 AIL 299
           AIL
Sbjct: 307 AIL 309


>gi|304407669|ref|ZP_07389320.1| ornithine carbamoyltransferase [Paenibacillus curdlanolyticus YK9]
 gi|304343152|gb|EFM08995.1| ornithine carbamoyltransferase [Paenibacillus curdlanolyticus YK9]
          Length = 318

 Score =  269 bits (687), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 133/299 (44%), Positives = 191/299 (63%), Gaps = 5/299 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F  L++ S   +  +I++A  IK   +     +PL GK L M+FEK STRTRVSFEV 
Sbjct: 16  RDFLALADYSPEEVRYLIDLAIDIKKKQKAGEVYQPLKGKTLGMVFEKSSTRTRVSFEVG 75

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  +FLS +++Q+GR E I DT +VLSRY+D I++RT  H  +++L   +TVPVI
Sbjct: 76  IYQLGGQGLFLSRNDLQIGRGEPIWDTGQVLSRYLDGIMIRTFAHKIVIDLARSSTVPVI 135

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ + D  T  EH+G ++G   ++ GDGNN+ HSL+ GAA+    +++A+P
Sbjct: 136 NGLTDAAHPCQALCDYQTVLEHKGRLEGLKIAYIGDGNNMTHSLLMGAAKLGMNMSVASP 195

Query: 186 IGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV- 240
            G E   + +      A   G+ + +  D  +A++GA  V++D W SM  E + +E  + 
Sbjct: 196 EGYEADPDIVAQTKAVAAGTGSQIHVCRDPREAIEGADIVYSDVWASMGFEAEQKEREIA 255

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           F  +QVN  L+  A  D LFMHCLPAHRGEEV   V+DG  S+++D+AENRLH QKAI+
Sbjct: 256 FANYQVNEELVKYAKSDYLFMHCLPAHRGEEVSEGVIDGKHSIIYDQAENRLHAQKAIM 314


>gi|237749186|ref|ZP_04579666.1| ornithine carbamoyltransferase [Oxalobacter formigenes OXCC13]
 gi|229380548|gb|EEO30639.1| ornithine carbamoyltransferase [Oxalobacter formigenes OXCC13]
          Length = 305

 Score =  268 bits (686), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 137/295 (46%), Positives = 185/295 (62%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH+   S+++ +    +I+ A  IK   +N     PL  + L M+FEK STRTR+SFE  
Sbjct: 4   KHYLQFSDLTLAEYEHLIKRAHVIKRKFKNYEPYHPLLDRTLVMVFEKSSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  I+L+  + QLGR E I D A+V+SR  D I++RT  H  +     Y+ VPVI
Sbjct: 64  MHQLGGTAIYLNTRDSQLGRGEPIEDAAQVMSRMSDVIMVRTFGHEIIERFAAYSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQ++AD+ TF EHRGS+KGK  +W GD NN+L+S ++ A  F + +N++TP
Sbjct: 124 NGLTNEHHPCQVLADVFTFIEHRGSIKGKTVTWIGDANNMLYSWLQAAEVFGFHVNVSTP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN-QEFKAREEHVFQPF 244
            G +   + ++      +    F +   A +GAH V TD W SM  +E  A  +  F  +
Sbjct: 184 RGYDIDFKLVS---PDHSHFTQFDNPADACEGAHLVTTDVWTSMGFEEENAVRKKAFANW 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            V+   M  A PDALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA+L
Sbjct: 241 NVDAEKMRHAAPDALFMHCLPAHRGEEVTAEVIDGPQSVVWDEAENRLHVQKALL 295


>gi|82702171|ref|YP_411737.1| ornithine carbamoyltransferase [Nitrosospira multiformis ATCC
           25196]
 gi|82410236|gb|ABB74345.1| ornithine carbamoyltransferase [Nitrosospira multiformis ATCC
           25196]
          Length = 329

 Score =  268 bits (686), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 141/296 (47%), Positives = 183/296 (61%), Gaps = 5/296 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF   ++ S      + E  + IK   +      PL  + LAMIF+K STRTR+SFE  
Sbjct: 26  KHFLQFNDFSREEFEYLFERTRWIKQEFKQYRRYWPLEDRTLAMIFDKHSTRTRLSFEAG 85

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  I+LS  + QLGR E + D A+V+SR VD +++RT  H  +     ++ VPVI
Sbjct: 86  MHQLGGAAIYLSTRDTQLGRGEPVEDAARVISRMVDIVMIRTHEHDIVRRFAAHSRVPVI 145

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQII DI TF EH GS+ GK  +W GD NN+ ++ ++ A  F++ ++++TP
Sbjct: 146 NGLTDEYHPCQIIGDIFTFIEHHGSITGKTVAWIGDSNNVCNTWLQAAEVFDFNVHVSTP 205

Query: 186 IGSEPRNEYLNWARNQGAS-VALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EHVFQP 243
            G E   E    A   G S    F D  +AVKGA  V TD W SM  E +  E +  F  
Sbjct: 206 RGYEVEPER---AGLYGTSHYEEFADPHEAVKGADLVTTDVWTSMGFEAETEERKRDFAD 262

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           F+V+  +MS    DALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLHTQKA++
Sbjct: 263 FRVDAEMMSHTRKDALFMHCLPAHRGEEVAAEVIDGPQSVVWDEAENRLHTQKALI 318


>gi|299532015|ref|ZP_07045411.1| ornithine carbamoyltransferase [Comamonas testosteroni S44]
 gi|298720002|gb|EFI60963.1| ornithine carbamoyltransferase [Comamonas testosteroni S44]
          Length = 307

 Score =  268 bits (686), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 134/297 (45%), Positives = 191/297 (64%), Gaps = 4/297 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH+   S+ ++     ++E A  IK   +   ++  L+ + +AMIFEK STRTRVSFE  
Sbjct: 2   KHYLQFSDFTADEYDYLLERAALIKKKFKGYEKHHTLTDRTMAMIFEKASTRTRVSFEAG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  + L+  + QLGR+E I D+A+V+SR  D +++RT    ++    +Y+ VPVI
Sbjct: 62  MYQLGGSVVHLTTGDSQLGRSEPIEDSARVISRMTDLVMIRTFGQDKIERFAQYSRVPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI TF EHRGS+KGK+ +W GDGNN+ ++ ++ A    + ++++TP
Sbjct: 122 NGLTNEFHPCQILADIFTFIEHRGSIKGKVVAWVGDGNNMANTWLQAADLLGFTVHVSTP 181

Query: 186 IGSEPRNEY-LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF--KAREEHVFQ 242
            G E   +   N          +F D ++A KGA  V TD W SM  E   +AR++  F 
Sbjct: 182 GGYEVDEQLAFNGKPVNPGCYKVFKDPLEACKGADLVTTDVWTSMGYEAENEARKK-AFA 240

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            + V+  +M+ A  DALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENR+H QKA++
Sbjct: 241 DWCVDAEMMASAKADALFMHCLPAHRGEEVEAEVIDGPQSVVWDEAENRMHVQKALM 297


>gi|239814458|ref|YP_002943368.1| ornithine carbamoyltransferase [Variovorax paradoxus S110]
 gi|239801035|gb|ACS18102.1| ornithine carbamoyltransferase [Variovorax paradoxus S110]
          Length = 311

 Score =  268 bits (685), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 132/296 (44%), Positives = 191/296 (64%), Gaps = 5/296 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +H+   S+ ++   + + +    IK   +   +++PL+ + LAMIFEK STRTRVSFE  
Sbjct: 11  RHYLQFSDFTADEYAYLFDRMAIIKKKFKTYEKHQPLTDRTLAMIFEKASTRTRVSFEAG 70

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  + L+  + QLGRAE I D+AKV+SR VD +++RT   +++     ++ VPVI
Sbjct: 71  MYQLGGSVVHLTTGDSQLGRAEPIEDSAKVISRMVDLVMIRTYEQTKIDTFAAHSRVPVI 130

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI T+ EHRGS++GK  +W GDGNN+ ++ ++ +    + ++++TP
Sbjct: 131 NGLTNEFHPCQILADIFTYIEHRGSIQGKTVAWVGDGNNMANTWLQASEILGFKVHVSTP 190

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKAREEHVFQP 243
            G E              S  +F D ++A +GA  V TD W SM    E +AR +  F  
Sbjct: 191 SGYEVDQSVAGL--RSADSYQVFKDPMEACRGADLVTTDVWTSMGYESENEARRK-AFAD 247

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + V+  +M +A PD+LFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA++
Sbjct: 248 WCVDEDMMRIAQPDSLFMHCLPAHRGEEVQAEVIDGPQSVVWDEAENRLHAQKALM 303


>gi|256811405|ref|YP_003128774.1| ornithine carbamoyltransferase [Methanocaldococcus fervens AG86]
 gi|256794605|gb|ACV25274.1| ornithine carbamoyltransferase [Methanocaldococcus fervens AG86]
          Length = 306

 Score =  268 bits (685), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 137/307 (44%), Positives = 197/307 (64%), Gaps = 16/307 (5%)

Query: 7   HFADLSNISSSNLSCIIEVA---KKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
           H  DL  +S  ++  IIE     KK +   E I     L GK +A++FEKPSTRTR+SF+
Sbjct: 2   HLLDLDVLSREDVLKIIEYGLYFKKNRRKHERI-----LDGKSVAILFEKPSTRTRMSFD 56

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           +A+  LGG  + ++  E+ LG+ E+I DTAKV+SRYVDAIV R   H  L E+ +Y+TVP
Sbjct: 57  IAVYELGGHPLIMNQDEIHLGKKESIKDTAKVMSRYVDAIVARVYKHRHLEEMAKYSTVP 116

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINAL+D  HPCQI+AD+MT +E++G + G   ++ GDGNN+ +SLI G+A     + + 
Sbjct: 117 VINALSDLAHPCQILADLMTIKEYKGKLNGLKIAYLGDGNNVCNSLILGSALVGMDIYVG 176

Query: 184 TPIGSEPRNEYLNWARN-----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE 238
           TP G EP  + +  A+         S+ L ++ ++A + A  ++TD WISM  + K +EE
Sbjct: 177 TPRGYEPNAKTILKAKEIIEKYGEGSITLTNNPIEAAEDADVLYTDVWISMGDD-KDKEE 235

Query: 239 --HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
              +F PFQ+N  L+  A  D + MHCLPA+RG E+ ++V+DG  SVV+DEAENRLH QK
Sbjct: 236 VLKIFPPFQINSKLLDYAKDDVIVMHCLPANRGFEITDDVIDGEHSVVYDEAENRLHVQK 295

Query: 297 AILLWCF 303
            +  + F
Sbjct: 296 GVFKFIF 302


>gi|305662519|ref|YP_003858807.1| ornithine carbamoyltransferase [Ignisphaera aggregans DSM 17230]
 gi|304377088|gb|ADM26927.1| ornithine carbamoyltransferase [Ignisphaera aggregans DSM 17230]
          Length = 316

 Score =  268 bits (684), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 140/303 (46%), Positives = 193/303 (63%), Gaps = 11/303 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKN---SSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           +    +S+++   L  +IE++ ++K    S E +     +SGK+LA+IFEK STRTRVS 
Sbjct: 11  RDLISISDLTIEELRSLIEISMELKRKYYSGERML--NIISGKILALIFEKHSTRTRVSL 68

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           EVAM+ LGG +I+LS  E+QL R E I DTA+VL RYVD +  R   HS L+E  EYA +
Sbjct: 69  EVAMRQLGGTSIYLSSQELQLARGEPIKDTARVLERYVDGVAARVYRHSFLIEFAEYAKI 128

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLN 181
           PVINAL+D  HP Q +ADI+T  E + S+ G    + GDG +N+LHSL+   A     L 
Sbjct: 129 PVINALSDIEHPLQALADIVTILEFKKSLSGIKIGFFGDGRDNVLHSLMLAVAMLGGTLY 188

Query: 182 IATPIGSEPRNEYLN----WARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE 237
           IATP G EP  +       ++R  GA + +  D V+A   A  ++TD W+SM QE +A +
Sbjct: 189 IATPQGYEPLGDIWKKAQEYSRETGAEIHIVRDPVEAAMNADVIYTDVWVSMGQEKEAEK 248

Query: 238 E-HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
                +P+QVN  L+S A  D +FMHCLPAHRGEEV ++V++   SVV+ +AENRLHT K
Sbjct: 249 RIRDLRPYQVNNELISYAKKDYIFMHCLPAHRGEEVTDDVIESRNSVVWIQAENRLHTAK 308

Query: 297 AIL 299
           A+L
Sbjct: 309 AVL 311


>gi|15669071|ref|NP_247876.1| ornithine carbamoyltransferase [Methanocaldococcus jannaschii DSM
           2661]
 gi|2499395|sp|Q58291|OTC_METJA RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|1592314|gb|AAB98885.1| ornithine carbamoyltransferase (argF) [Methanocaldococcus
           jannaschii DSM 2661]
          Length = 305

 Score =  268 bits (684), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 138/307 (44%), Positives = 197/307 (64%), Gaps = 16/307 (5%)

Query: 7   HFADLSNISSSNLSCIIEVA---KKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
           H  DL  +S  ++  IIE     KK +   E I E     GK +A++FEKPSTRTR+SF+
Sbjct: 2   HLLDLDVLSREDVLKIIEYGIYFKKNRRKHEKILE-----GKSVAILFEKPSTRTRMSFD 56

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           +A+  LGG  + ++ +E+ LG+ E+I DTAKV+ RYVD IV R   H  L E+ +Y++VP
Sbjct: 57  IAVYELGGHPLIMNQNEIHLGKKESIKDTAKVMGRYVDTIVARVYKHRHLEEMAKYSSVP 116

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINAL+D  HPCQI+AD+MT +E++G  KG   ++ GDGNN+ +SLI G+A       + 
Sbjct: 117 VINALSDLAHPCQILADLMTIKEYKGKFKGLKIAYLGDGNNVCNSLILGSALVGMDTYVG 176

Query: 184 TPIGSEPRNEYLNWAR----NQG-ASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE 238
           TP G EP  + +  A+    N G  S+ L +D ++A + A  ++TD WISM  + K +EE
Sbjct: 177 TPKGYEPNAKVVLKAKEIINNYGEGSLTLTNDPIEAAEDADVLYTDVWISMGDD-KDKEE 235

Query: 239 --HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
              +F PFQ+N  L+  A  D + MHCLPA+RG E+ ++V+DG  SVV+DEAENRLH QK
Sbjct: 236 VLKIFPPFQINSKLLEYAKDDVIVMHCLPANRGYEITDDVIDGEHSVVYDEAENRLHVQK 295

Query: 297 AILLWCF 303
            +  + F
Sbjct: 296 GVFKFIF 302


>gi|330813143|ref|YP_004357382.1| ornithine carbamoyltransferase [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486238|gb|AEA80643.1| ornithine carbamoyltransferase [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 258

 Score =  268 bits (684), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 123/257 (47%), Positives = 181/257 (70%), Gaps = 2/257 (0%)

Query: 49  MIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAE-TIGDTAKVLSRYVDAIVMRT 107
           MIFEKPSTRTR+SF++AM+ LGG TI ++ ++M LG+ E +I DTAKV+S + D ++ RT
Sbjct: 1   MIFEKPSTRTRLSFDLAMRQLGGQTIVMNANDMHLGKGEESIEDTAKVISSFSDIVMFRT 60

Query: 108 TNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILH 167
            +H  LLEL+    +P+IN LTD++HPCQ+++D++TFEE++GS+KG   +W GDGNN+ +
Sbjct: 61  FSHKSLLELSNLLNIPLINGLTDHSHPCQLLSDVLTFEENKGSIKGAKVAWIGDGNNVTN 120

Query: 168 SLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWI 227
           S IE A +F++ LNI+ P G  P  + L+WA  +   + +  D  +AV G   + +D WI
Sbjct: 121 SAIEAAVQFDFQLNISCPKGYMPSKKTLDWADKKNGKINIIQDPKKAVAGVDAIMSDKWI 180

Query: 228 SMNQEFKARE-EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFD 286
           SM  +   ++ +   + +Q N  +M++A  DA+FMH LPA RGEEV  E++DG QSVV+ 
Sbjct: 181 SMGDKVNVKQKKKALKDYQANKKMMNLASKDAIFMHVLPAARGEEVSAEIIDGKQSVVWH 240

Query: 287 EAENRLHTQKAILLWCF 303
           +AENRLH QKAI+ WC 
Sbjct: 241 QAENRLHGQKAIIDWCL 257


>gi|149923925|ref|ZP_01912312.1| ArgF [Plesiocystis pacifica SIR-1]
 gi|149815213|gb|EDM74761.1| ArgF [Plesiocystis pacifica SIR-1]
          Length = 296

 Score =  268 bits (684), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 141/292 (48%), Positives = 188/292 (64%), Gaps = 12/292 (4%)

Query: 22  IIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLS---G 78
           ++E+A +IK  ++       L+GK +AMIF K STRTR+SFEV +  LG   + LS   G
Sbjct: 3   VVELAAQIK--ADPSLAAGSLAGKSIAMIFAKQSTRTRISFEVGIHQLGAQALALSSGGG 60

Query: 79  SEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQII 138
           + MQ+GR E+I DTAKVLSRY+DAIV+RT   +++  L E+ +VPVINALTD  HPCQ +
Sbjct: 61  TGMQMGRGESIHDTAKVLSRYIDAIVIRTYGQAQVDGLAEHGSVPVINALTDLYHPCQGL 120

Query: 139 ADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYL--- 195
           AD++T  EH G  KGK   W G GNN+ H+L+    R    +    P  S P N ++   
Sbjct: 121 ADLLTIHEHCGGTKGKKLVWVGAGNNVAHTLLLAGPRAGMDVVCCVP-ESLPPNAFVVER 179

Query: 196 --NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHVFQPFQVNLSLMS 252
               A   G ++ L  D V AV GA+ ++ DTW+SM +E +A R   +  P+QVN +LM+
Sbjct: 180 ARRDAAAAGTTIELSSDPVAAVAGANVIYADTWVSMGEEEEAKRLLQLLAPYQVNDALMA 239

Query: 253 MAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
            A   A FMHCLPAHR EEV + V+DGPQSVVFD+AENRLH QKA+L+   G
Sbjct: 240 AAGEQARFMHCLPAHRNEEVTDSVMDGPQSVVFDQAENRLHAQKALLMLLLG 291


>gi|319792287|ref|YP_004153927.1| ornithine carbamoyltransferase [Variovorax paradoxus EPS]
 gi|315594750|gb|ADU35816.1| ornithine carbamoyltransferase [Variovorax paradoxus EPS]
          Length = 311

 Score =  268 bits (684), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 134/296 (45%), Positives = 195/296 (65%), Gaps = 5/296 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +H+   +++++     + +    IK   +   +++PL  + LAMIFEK STRTRVSFE  
Sbjct: 11  RHYLQFADLTADEYVYLFDRMAIIKKKFKTYEKHQPLVDRTLAMIFEKASTRTRVSFEAG 70

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  + L+  + QLGRAE I D+AKV+SR VD +++RT   +++     ++ VPVI
Sbjct: 71  MYQLGGSVVHLTTGDSQLGRAEPIEDSAKVISRMVDLVMIRTYEQTKIDAFAAHSRVPVI 130

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI T+ EHRGS++GK  +W GDGNN+ ++ ++ A    + ++++TP
Sbjct: 131 NGLTNEFHPCQILADIFTYIEHRGSIQGKTVAWVGDGNNMANTWLQAAEILGFTVHVSTP 190

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF--KAREEHVFQP 243
            G E  ++ +   R+ G S  +F D ++A +GA  V TD W SM  E   +AR +  F  
Sbjct: 191 SGYEV-DQSIAGIRS-GDSYKVFKDPMEACRGADLVTTDVWTSMGYEAENEARRK-AFAD 247

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + V+  +M +A P ALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA++
Sbjct: 248 WCVDEDMMRIAQPGALFMHCLPAHRGEEVQAEVIDGPQSVVWDEAENRLHAQKALM 303


>gi|254516737|ref|ZP_05128796.1| ornithine carbamoyltransferase [gamma proteobacterium NOR5-3]
 gi|219675160|gb|EED31527.1| ornithine carbamoyltransferase [gamma proteobacterium NOR5-3]
          Length = 702

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 138/293 (47%), Positives = 194/293 (66%), Gaps = 4/293 (1%)

Query: 8   FADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMK 67
           F++ S++S   L  +I+ A ++K +      +    G V+AMIF K STRTRVSFE  M 
Sbjct: 403 FSNPSDLSPQELDALIDRAMELKVAHRAGEPSPQFPGSVMAMIFAKSSTRTRVSFESGMA 462

Query: 68  HLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINA 127
            +GG  +FLS  + QLGR E + D+A+V+S  VD +++RT  H  +     +++VPVINA
Sbjct: 463 QMGGHAMFLSPGDTQLGRGEPVEDSARVISSMVDIVMIRTFGHDIVERFAAHSSVPVINA 522

Query: 128 LTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIG 187
           LTD+ HPCQ++AD+ T+ EHRGS++GK   W GDGNN+ HS I  A +F++ L IA P G
Sbjct: 523 LTDDFHPCQLLADMQTYREHRGSIQGKTVCWLGDGNNMCHSYINAARQFDFQLRIACPKG 582

Query: 188 SEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQ-EFKAREEHVFQPFQV 246
            EPR + ++   ++   V + HDA  AVK A  + TD W SM Q E +AR      PFQ+
Sbjct: 583 FEPRADLVSANSDR---VTVLHDAQDAVKDAALLVTDVWASMGQEEEQARRAAAMAPFQL 639

Query: 247 NLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           N SL++ A PDAL+MHCLPAHRGEE+  E++D   +V++DEAENRLH QKA++
Sbjct: 640 NSSLLAAAAPDALYMHCLPAHRGEEISAELMDAADTVIWDEAENRLHAQKALI 692


>gi|225848625|ref|YP_002728788.1| ornithine carbamoyltransferase [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225644074|gb|ACN99124.1| ornithine carbamoyltransferase [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 303

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 127/302 (42%), Positives = 198/302 (65%), Gaps = 7/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F   ++++   +  IIE  KK+K   +N F ++ L GK + +IF K STRTR+SFEV 
Sbjct: 3   RSFVSFTDLNKEEVLNIIEYGKKLK---KNKFLDQSLKGKSIGLIFMKQSTRTRLSFEVG 59

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  +GG  I++SGS  QL R E I DTA+V++RY+D IV+RT +H  + +L +Y+ +PVI
Sbjct: 60  VYQMGGQPIYISGSSTQLARGEDIKDTARVMARYLDGIVIRTFSHQEVEDLAKYSGIPVI 119

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD  HPCQ++AD+MT  E  GS++GK  ++ GDGNN+ ++L+   A     +++ATP
Sbjct: 120 NALTDYQHPCQVLADLMTITEVFGSLEGKKVAYVGDGNNMANTLLLACAVMGMDISVATP 179

Query: 186 IGSEPRN----EYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
              EP      E +N A+  G+ V L ++  +AV  A  ++TD W+SM QE +  ++  F
Sbjct: 180 PNYEPNAKAILEAVNIAKETGSKVELTNNPKEAVLDADVIYTDVWVSMGQEGEKEKKKAF 239

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           + F +N  L+ +A P+A+ MHCLPAH+GEE+  +V +    V+F++AENRLH QK+++ +
Sbjct: 240 EGFTINKDLVVLAKPNAIVMHCLPAHKGEEISEDVFEQYADVIFNQAENRLHVQKSLMSY 299

Query: 302 CF 303
            F
Sbjct: 300 LF 301


>gi|320100502|ref|YP_004176094.1| ornithine carbamoyltransferase [Desulfurococcus mucosus DSM 2162]
 gi|319752854|gb|ADV64612.1| ornithine carbamoyltransferase [Desulfurococcus mucosus DSM 2162]
          Length = 314

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 142/305 (46%), Positives = 196/305 (64%), Gaps = 14/305 (4%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKN---SSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           +HF  L+  S   L  I+E A ++K    + E +     L G+ LAMIFEKPSTRTR+SF
Sbjct: 8   RHFLTLAEYSREELLFILETAMQLKQRYLAGERVI--PLLVGRHLAMIFEKPSTRTRISF 65

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E AM+ LGG+ I+LS SE+QL R ETI DTA+VLSRYVDA++ R   H ++  L +Y+ V
Sbjct: 66  ETAMRELGGNAIYLSASELQLARGETIEDTARVLSRYVDAVMARVYEHYKIERLAQYSRV 125

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKL-FSWSGD-GNNILHSLIEGAARFNYLL 180
           PVIN L+D  HP Q ++D++T  E +G    +L   + GD G+N+LHSL+         +
Sbjct: 126 PVINGLSDLHHPAQALSDVLTIMEKKGRDITRLKIVFVGDGGDNVLHSLMLAVGILGGRI 185

Query: 181 NIATPIGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR 236
            IA+P G EP    +      A   G S  +  D  +AV+ A  V+TD W+SM Q+ K R
Sbjct: 186 VIASPKGYEPHPSVVKLFNEHAAPNGGSYEIERDPFKAVENADVVYTDVWVSMGQD-KER 244

Query: 237 EEHV--FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHT 294
           E+ +   +P++V + LM  A PDA+FMHCLPAHRGEEV++EV+DG  S+V+D+AENR H 
Sbjct: 245 EKRLRDLEPYRVTVELMERAKPDAVFMHCLPAHRGEEVVDEVIDGRWSIVWDQAENRKHA 304

Query: 295 QKAIL 299
           QKA+L
Sbjct: 305 QKAVL 309


>gi|159465437|ref|XP_001690929.1| ornithine carbamoyltransferase [Chlamydomonas reinhardtii]
 gi|158279615|gb|EDP05375.1| ornithine carbamoyltransferase [Chlamydomonas reinhardtii]
          Length = 364

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 139/301 (46%), Positives = 180/301 (59%), Gaps = 2/301 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFEN-KPLSGKVLAMIFEKPSTRTRVSFEV 64
           KHF  L + S   L  ++E AK  K       E+ KP +G+ +AMIF KPS RTRVSFE 
Sbjct: 59  KHFLHLDDFSRDELLDMLEKAKLCKAKFYTRDESFKPFAGQTMAMIFTKPSARTRVSFET 118

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
               LGG  ++L  + +QLG+ E   D A+VLS Y D I+ R   H+ LLEL EY++VP+
Sbjct: 119 GFFRLGGHALYLDPNTIQLGKREPTKDIARVLSGYNDVIMARLFAHADLLELAEYSSVPI 178

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD  HPCQI+AD +T  E +G V+G    + GDGNNI+HS +  A R ++   +  
Sbjct: 179 INGLTDYNHPCQIMADALTLLERKGRVEGTKVVYVGDGNNIVHSWLRLATRLSFEFVVVC 238

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV-FQP 243
           P G EP    +  AR  G S       + AVKGA  ++TD W SM Q+    E  + F P
Sbjct: 239 PPGYEPCQSTVEGARAAGLSSITVTSDINAVKGADVIYTDVWASMGQKETIDERKIAFAP 298

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +QVN  LM++A   ALFMHCLPA RG E  + V++ PQSVVF EAENR+H Q  ILL C 
Sbjct: 299 YQVNEKLMALAGAQALFMHCLPAERGLETTDGVMESPQSVVFQEAENRMHAQNGILLHCL 358

Query: 304 G 304
            
Sbjct: 359 A 359


>gi|89900904|ref|YP_523375.1| ornithine carbamoyltransferase [Rhodoferax ferrireducens T118]
 gi|89345641|gb|ABD69844.1| ornithine carbamoyltransferase [Rhodoferax ferrireducens T118]
          Length = 302

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 134/295 (45%), Positives = 194/295 (65%), Gaps = 3/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH+   S++++ + + + E A  IK   +   ++ PL+ + LAMIFEK STRTRVSFE  
Sbjct: 2   KHYLQFSDLTALDYAYLFERAALIKKKFKAYEKHHPLADRTLAMIFEKASTRTRVSFEAG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  +GG  + L+  + QLGRAE I D+AKV+SR VD +++RT   +++    +++ VPVI
Sbjct: 62  MYQMGGSVVHLTTGDSQLGRAEPIEDSAKVISRMVDLVMIRTFEQTKIERFAQHSRVPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI T+ EHRGS+ GK  +W GDGNN+ ++ ++ +    + ++++TP
Sbjct: 122 NGLTNEFHPCQILADIFTYIEHRGSIAGKTVAWVGDGNNMANTWLQASEILGFKVHVSTP 181

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV-FQPF 244
            G E  ++ +   R+   S  +F D +QA  GA  V TD W SM  E +     V F  +
Sbjct: 182 GGYEV-DQSIAGLRSSD-SYRVFQDPMQACAGADLVTTDVWTSMGFEAENEARKVAFADW 239

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            V+L +M  A PDALFMHCLPAHRGEEV  EV+DG QSVV++EAENR+H QKA++
Sbjct: 240 CVDLDMMHAAKPDALFMHCLPAHRGEEVQAEVIDGAQSVVWEEAENRMHVQKALM 294


>gi|296270000|ref|YP_003652632.1| ornithine carbamoyltransferase [Thermobispora bispora DSM 43833]
 gi|296092787|gb|ADG88739.1| ornithine carbamoyltransferase [Thermobispora bispora DSM 43833]
          Length = 322

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 142/306 (46%), Positives = 191/306 (62%), Gaps = 8/306 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKN--SSENIFENKPLSG-KVLAMIFEKPSTRTRVSF 62
           +HF    +++    + ++++A  +K   ++   F ++PL G K +A++F+K STRTRVSF
Sbjct: 11  RHFLRDDDLTPQEQARVLDLAAAMKKERAAGAGFTHRPLEGPKTVAVLFDKHSTRTRVSF 70

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
            VA+  LGG  + L     QLGR E I DTA+VL R V AIV RT    R+  +   +TV
Sbjct: 71  AVAITELGGAPLILDAGTSQLGRGEPIEDTARVLCRQVAAIVWRTAGQERIEAMASASTV 130

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLN 181
           PVINALTD  HPCQ++AD++T  EHRGS+ G+  ++ GDG NN+ HS + G A     + 
Sbjct: 131 PVINALTDEFHPCQVLADLLTIREHRGSLAGQTLTYLGDGANNMAHSYLLGGATAGMHVR 190

Query: 182 IATPIGSEPRNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE 237
           IA P G  P    L  A       G SVA+  D V A  GA  + TDTW+SM QE K + 
Sbjct: 191 IAAPAGYRPDPAVLRRAEEIAAATGGSVAVLDDPVAAAAGAGVIATDTWVSMGQEGKEQR 250

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
              F+P+QVN  L+  A PDA+ +HCLPA+RG E+  EV+DGPQSVV+DEAENRLH QKA
Sbjct: 251 IAAFRPYQVNAELLRHAAPDAIVLHCLPAYRGMEITAEVIDGPQSVVWDEAENRLHAQKA 310

Query: 298 ILLWCF 303
           +L W  
Sbjct: 311 LLHWLL 316


>gi|73670947|ref|YP_306962.1| ornithine carbamoyltransferase [Methanosarcina barkeri str. Fusaro]
 gi|121718442|sp|Q465R0|OTC_METBF RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|72398109|gb|AAZ72382.1| ornithine carbamoyltransferase [Methanosarcina barkeri str. Fusaro]
          Length = 302

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 129/296 (43%), Positives = 186/296 (62%), Gaps = 1/296 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    ++++S   +  ++E A  +K   +     + L  K L MIFEK STRTRVSFEVA
Sbjct: 3   KDVLSITDLSKEEIYELLESAMDLKEKRKAGEPTEYLKNKSLGMIFEKASTRTRVSFEVA 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M   GG +++L+  ++Q+GR ETI DTA+ LS Y+  I+ R  +H  + +L +Y+T+PVI
Sbjct: 63  MTDFGGHSLYLNSRDIQIGRGETIEDTARTLSGYLHGIMARVMSHETVEKLAKYSTIPVI 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NAL+D  HPCQI+ D MT  E++   +   F+W GDGNN+ +S + G+A       +A P
Sbjct: 123 NALSDREHPCQILGDFMTIMEYKDKFEDLKFAWVGDGNNVCNSALLGSAIVGMEFAVACP 182

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQPF 244
            G EP+ E+L  A++ G    +  D   AVK A  ++TD W+SM  E +  +    F  F
Sbjct: 183 KGYEPKPEFLEKAKSLGGKFTVTDDPKVAVKDADIIYTDVWVSMGDEAEQEKRLKEFATF 242

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           QVN  L+ +A PD + MHCLPA RG E+ +EV+DGP SV+F+EAENRLH QKA++L
Sbjct: 243 QVNTELLGVAKPDVIVMHCLPARRGLEITDEVMDGPNSVIFEEAENRLHAQKALIL 298


>gi|78221429|ref|YP_383176.1| ornithine carbamoyltransferase [Geobacter metallireducens GS-15]
 gi|123572912|sp|Q39Z73|OTC_GEOMG RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|78192684|gb|ABB30451.1| ornithine carbamoyltransferase [Geobacter metallireducens GS-15]
          Length = 303

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 126/296 (42%), Positives = 190/296 (64%), Gaps = 2/296 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L+  +   L  +  + +++K   +    ++ L GK +A+IFEK STRTR+SFEV 
Sbjct: 3   RHFLALNQYTKEALDALFALTRELKEEQKKGIPHRILEGKSVALIFEKSSTRTRISFEVG 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LG   +F+S +  Q+GR E + DTA+V++RY D +++RT     + E   Y++VPVI
Sbjct: 63  VHQLGAHPLFISSATSQMGRGEPVRDTARVMARYCDGVMIRTYGQEIVEEFARYSSVPVI 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQI+AD+ T  EH+G   G  F+W GDGNN+ ++ IE AA   + L +A P
Sbjct: 123 NGLTDLFHPCQIMADLFTVIEHKGKYDGLKFAWVGDGNNMANTWIEAAAILGFDLALACP 182

Query: 186 IGSEPRNEYLNWARNQG-ASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQP 243
            G EP     +WA+ +  +S+ +  D  +AV+ A  V TD W SM QE + +  E  F+ 
Sbjct: 183 EGYEPDRTVWDWAQKKATSSITITRDPKEAVRDADVVNTDVWASMGQEQEQKVREVAFKG 242

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + ++  L+++A PD + +HCLPAHRGEE+ + V++GP+S V+DEAENRLH QKAI+
Sbjct: 243 YCLDDDLVALAKPDCMVLHCLPAHRGEEITDSVIEGPRSAVWDEAENRLHVQKAIM 298


>gi|289192749|ref|YP_003458690.1| ornithine carbamoyltransferase [Methanocaldococcus sp. FS406-22]
 gi|288939199|gb|ADC69954.1| ornithine carbamoyltransferase [Methanocaldococcus sp. FS406-22]
          Length = 305

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 134/304 (44%), Positives = 197/304 (64%), Gaps = 10/304 (3%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAM 66
           H  DL  +S  ++  IIE     K +       K L GK +A++FEKPSTRTR+SF++A+
Sbjct: 2   HLLDLDVLSREDVLKIIEYGMYFKKNRRK--HEKILEGKSVAILFEKPSTRTRMSFDIAV 59

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
             LGG  + ++ +E+ LG+ E+  DTA+V+SRYVDAIV R   H  L E+ +Y++VPVIN
Sbjct: 60  YELGGHPLIMNQNEIHLGKKESTKDTARVMSRYVDAIVARVYKHRDLEEMAKYSSVPVIN 119

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI 186
           AL+D  HPCQI+AD+MT +E++G  KG   ++ GDGNN+ +SLI G+A     + +ATP 
Sbjct: 120 ALSDLAHPCQILADLMTIKEYKGKFKGLKIAYLGDGNNVCNSLILGSALVGMDIYVATPR 179

Query: 187 GSEPRNEYLNWARN-----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE--H 239
           G EP  + +  A+         S+ L ++ ++A + A  ++TD WISM  + K++EE   
Sbjct: 180 GYEPNAKVVLKAKEIIDSYGEGSLTLTNNPIEAAEDADILYTDVWISMGDD-KSKEEVLK 238

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           +F PFQ+N  L+  A  D + MHCLPA+RG E+ ++V+DG  SVV+DEAENRLH QK + 
Sbjct: 239 IFPPFQINNKLLEYAKDDVIVMHCLPANRGYEITDDVIDGEHSVVYDEAENRLHVQKGVF 298

Query: 300 LWCF 303
            + F
Sbjct: 299 KFIF 302


>gi|118431681|ref|NP_148311.2| ornithine carbamoyltransferase [Aeropyrum pernix K1]
 gi|32699488|sp|Q9YAE7|OTC_AERPE RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|116063004|dbj|BAA81002.2| ornithine carbamoyltransferase [Aeropyrum pernix K1]
          Length = 314

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 133/303 (43%), Positives = 194/303 (64%), Gaps = 11/303 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKN---SSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           +H   L++ +   +  ++E+  ++K    + E +     L G+ + ++FEKPSTRTR+S 
Sbjct: 9   RHLLWLADYTGEEIRHMVELTLEMKRRYYAGERVI--PVLRGRSVGLLFEKPSTRTRISL 66

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           EVA+  LGG T++++ SE QLGR ET+ DTA+VLSRY+DAIV R  +H  L E+  +A++
Sbjct: 67  EVAVAQLGGHTVYMTPSETQLGRGETVADTARVLSRYLDAIVARVRSHKTLEEMARHASI 126

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLN 181
           PVIN L+D THP Q IAD+ T  E +G ++G   ++ GDG +N+LHSL+   ++    + 
Sbjct: 127 PVINGLSDLTHPLQAIADMATILEKKGRLEGVKLAFVGDGADNVLHSLLLAGSKLGLHIT 186

Query: 182 IATPIGSEPRNEYLN----WARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE 237
           +ATP    P    L+     A   G SV +  D  +AV+GA  V+TD W+SM QE  A E
Sbjct: 187 VATPPQIRPDERILSIALKAAEESGGSVEIVSDPYEAVRGADVVYTDVWVSMGQESMAEE 246

Query: 238 E-HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
           +  + +P+QVN  LM      A+FMHCLPA RG+EV +EV+DGP S V+D+AENRLH  K
Sbjct: 247 KVQLLKPYQVNAKLMEATGGRAIFMHCLPAKRGQEVTDEVIDGPWSAVWDQAENRLHAHK 306

Query: 297 AIL 299
           A+L
Sbjct: 307 AVL 309


>gi|320107263|ref|YP_004182853.1| ornithine carbamoyltransferase [Terriglobus saanensis SP1PR4]
 gi|319925784|gb|ADV82859.1| ornithine carbamoyltransferase [Terriglobus saanensis SP1PR4]
          Length = 368

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 133/304 (43%), Positives = 192/304 (63%), Gaps = 7/304 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +    ++++S   L+ I+E+A  +K   E+      L  + + +IFEK S RTR++FE A
Sbjct: 47  RDLCSIADLSVQELAAIMELAHAVKAHPEDF--RHALDAQQMVLIFEKASLRTRLTFEAA 104

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +   GG+ IF+  ++  LG  E++GD A  L R+++ IV+RT +H  +LE+   + VPVI
Sbjct: 105 VNTCGGNAIFVDQTQSPLGERESLGDMAHNLERWMNIIVLRTYSHDTVLEMAATSKVPVI 164

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NAL+D  HPCQ IAD  T EE  GS +G  F++ GDGNN+ HSLI   A       +ATP
Sbjct: 165 NALSDYEHPCQAIADFFTLEEKFGSCEGLKFTYVGDGNNVCHSLILAGALLGAHCTVATP 224

Query: 186 IGSEPRNEYLNWA----RNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHV 240
              EP+ E ++ A       G S+ L HDA++A  GA  ++TD  ISM QE +A +   +
Sbjct: 225 RNYEPKLEIIHKAIAICEETGGSLQLTHDAIKAATGADAIYTDVCISMGQEHEATKRAPI 284

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+P+QVN +LM+ A   A+FMHCLPAHRG EV + V+D PQ+V+FD+AENRLH QKA++L
Sbjct: 285 FKPYQVNEALMAQASEHAVFMHCLPAHRGAEVTDAVMDSPQAVIFDQAENRLHAQKALML 344

Query: 301 WCFG 304
              G
Sbjct: 345 MLLG 348


>gi|149928236|ref|ZP_01916480.1| ornithine carbamoyltransferase [Limnobacter sp. MED105]
 gi|149823042|gb|EDM82283.1| ornithine carbamoyltransferase [Limnobacter sp. MED105]
          Length = 303

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 137/299 (45%), Positives = 189/299 (63%), Gaps = 12/299 (4%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF   ++IS      +++ ++ +K   +      PL  + L MIFEK STRTR+SFE  
Sbjct: 4   KHFLQFNDISKDEFEYLMQSSRDVKARFKRYEPYYPLQDRTLVMIFEKASTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  I+L+  + QLGR E + D A+V+SR  D +++RT     +      + VPVI
Sbjct: 64  MHQLGGSAIYLNTKDSQLGRGEPVEDAAQVISRMCDIVMIRTYEQEIIERFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI TF EHRGS++GK  +W GDGNN+  + ++ A   ++ +NI+TP
Sbjct: 124 NGLTNEYHPCQILADIFTFIEHRGSIQGKTVAWVGDGNNMCATWLQAAELLDFKVNISTP 183

Query: 186 IGSEPRNEY-LNWARN--QGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKAREEHV 240
                 ++Y ++ A+   +G     F D + A KGA  V TD W SM    E KAR    
Sbjct: 184 ------SDYNIDPAKTNIKGTHHEWFEDPMDACKGADLVTTDVWTSMGFENENKAR-RRA 236

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           F  FQV+  +M +A+P+ALFMHCLPAHRGEEV  EV+DGP+SVV+DEAENRLHTQKA++
Sbjct: 237 FADFQVDTEMMDVANPEALFMHCLPAHRGEEVAAEVIDGPKSVVWDEAENRLHTQKALM 295


>gi|264679773|ref|YP_003279682.1| ornithine carbamoyltransferase [Comamonas testosteroni CNB-2]
 gi|262210288|gb|ACY34386.1| ornithine carbamoyltransferase [Comamonas testosteroni CNB-2]
          Length = 306

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 134/297 (45%), Positives = 190/297 (63%), Gaps = 4/297 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH+   S+ ++     ++E A  IK   +   ++  L  + +AMIFEK STRTRVSFE  
Sbjct: 2   KHYLQFSDFTADEYDYLLERAALIKKKFKGYEKHHTLIDRTMAMIFEKASTRTRVSFEAG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  + L+  + QLGR+E I D+A+V+SR  D +++RT    ++    +Y+ VPVI
Sbjct: 62  MYQLGGSVVHLTTGDSQLGRSEPIEDSARVISRMTDLVMIRTFGQDKIERFAQYSRVPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI TF EHRGS+KGK+ +W GDGNN+ ++ ++ A    + ++++TP
Sbjct: 122 NGLTNEFHPCQILADIFTFIEHRGSIKGKVVAWVGDGNNMANTWLQAADLLGFTVHVSTP 181

Query: 186 IGSEPRNEY-LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF--KAREEHVFQ 242
            G E   +   N          +F D ++A KGA  V TD W SM  E   +AR++  F 
Sbjct: 182 GGYEVDEQLAFNGKPVNPGCYKVFKDPLEACKGADLVTTDVWTSMGYEAENEARKK-AFA 240

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            + V+  +M+ A  DALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENR+H QKA++
Sbjct: 241 DWCVDAEMMASAKADALFMHCLPAHRGEEVEAEVIDGPQSVVWDEAENRMHVQKALM 297


>gi|300787892|ref|YP_003768183.1| ornithine carbamoyltransferase [Amycolatopsis mediterranei U32]
 gi|299797406|gb|ADJ47781.1| ornithine carbamoyltransferase [Amycolatopsis mediterranei U32]
          Length = 308

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 134/304 (44%), Positives = 186/304 (61%), Gaps = 9/304 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF    ++S +    I+++A  +K    +   NK L+GK +  IFEK STRTR SFEV 
Sbjct: 3   RHFLRDDDVSPAEQKAILDLADALK---ADPLGNKTLAGKSITAIFEKNSTRTRFSFEVG 59

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  + + G  MQLGR ETI DT++VLSRYVD IV RT    R+  +   A++PV+
Sbjct: 60  ISQLGGHPVIVDGRSMQLGREETIEDTSRVLSRYVDGIVWRTFAQKRIETMASAASIPVV 119

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLNIAT 184
           NALTD  HPCQ++ D+MT  E +G + G    + GDG NN+ HSL+ G       + + +
Sbjct: 120 NALTDEFHPCQVLTDLMTIRERKGELAGLTLVYLGDGANNMAHSLLLGGITAGMHVRVVS 179

Query: 185 PIGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-H 239
           P+G +P  + +  A+ +    G +   F D  +AV GA  + TDTW SM QE    +   
Sbjct: 180 PLGFQPDQQVMVDAKKRGEETGGTATAFTDPYEAVSGADVLVTDTWTSMGQENDGLDRVG 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+  QVN  L+  A  DA+ +HCLPAHRG E+ +EV+DGP S V+DEAENRLH QKA+L
Sbjct: 240 PFRALQVNAELLKKAADDAIVLHCLPAHRGWEITDEVIDGPASAVWDEAENRLHAQKALL 299

Query: 300 LWCF 303
           +W F
Sbjct: 300 VWLF 303


>gi|124516706|gb|EAY58214.1| Ornithine carbamoyltransferase [Leptospirillum rubarum]
          Length = 309

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 131/302 (43%), Positives = 192/302 (63%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  +S+  +S +  I E+ + I+ +    F+++  + K + ++FEK STRTR+SFE  
Sbjct: 7   RHFLKVSDFQASEVREIFELTEDIRKNPGQ-FDHR-FARKTVCLLFEKSSTRTRLSFEAG 64

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  +GGDT+FL G + QL R ETI DTA+V+S Y+D +++RT  H R+    + A +PVI
Sbjct: 65  VHQMGGDTVFLGG-DSQLARGETIEDTARVMSGYLDMVIIRTFGHDRIERFAKSAEIPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ ++D     +  G +KG   ++ GDGNN+ HSL+E AA     L +ATP
Sbjct: 124 NGLTDGHHPCQALSDFSFIGKEFGEIKGIRMAYVGDGNNMAHSLMEAAALLGVHLIVATP 183

Query: 186 IGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHV 240
            G  P  + L W    AR  G S+    D ++A +GA  ++TD W SM QE ++   E  
Sbjct: 184 PGYAPDRDVLRWSTEQARKTGGSITWMSDPMEAARGARVLYTDVWTSMGQEAESSIREQS 243

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F  FQ+N  ++S A  DA+ +HCLPA+RG+EV  EVL+GP+S VF +AENRLH QKA++L
Sbjct: 244 FAGFQINREMLSRAESDAIVLHCLPAYRGKEVTEEVLEGPRSRVFPQAENRLHLQKALML 303

Query: 301 WC 302
           +C
Sbjct: 304 FC 305


>gi|241766170|ref|ZP_04764075.1| ornithine carbamoyltransferase [Acidovorax delafieldii 2AN]
 gi|241363775|gb|EER59124.1| ornithine carbamoyltransferase [Acidovorax delafieldii 2AN]
          Length = 306

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 135/297 (45%), Positives = 193/297 (64%), Gaps = 4/297 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH+   +++++   + + E A  IK   +   ++ PL+ + LAMIFEK STRTRVSFE  
Sbjct: 2   KHYLQFNDLTADEYAYLFERAALIKKKFKAYEKHHPLADRTLAMIFEKASTRTRVSFEAG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  + L+  + QLGRAE I D+AKV+SR VD +++RT   +++      + VPVI
Sbjct: 62  MYQLGGSVVHLTTGDSQLGRAEPIEDSAKVISRMVDLVMIRTFEQTKIERFAADSRVPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI T+ EHRGS++GK  +W GDGNN+ ++ ++ A+   + ++++TP
Sbjct: 122 NGLTNEFHPCQILADIFTYIEHRGSIQGKTVAWVGDGNNMANTWLQAASLLGFKVHVSTP 181

Query: 186 IGSEPRNEYLNWARNQGA-SVALFHDAVQAVKGAHCVFTDTWISMNQEF--KAREEHVFQ 242
            G E   +    A    A S   F + ++A KGA  V TD W SM  E   +AR+   F 
Sbjct: 182 RGYEVDEKLAAGASGISAGSYQFFSNPLEACKGADLVTTDVWTSMGYEAENEARKA-AFA 240

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            + V+  +M+ A  DALFMHCLPAHRGEEV  +V+DGPQSVV+DEAENR+H QKA++
Sbjct: 241 DWCVDAEMMAAAKADALFMHCLPAHRGEEVEADVIDGPQSVVWDEAENRMHVQKALM 297


>gi|317507385|ref|ZP_07965120.1| ornithine carbamoyltransferase [Segniliparus rugosus ATCC BAA-974]
 gi|316254333|gb|EFV13668.1| ornithine carbamoyltransferase [Segniliparus rugosus ATCC BAA-974]
          Length = 322

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 139/305 (45%), Positives = 195/305 (63%), Gaps = 10/305 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRVSFEV 64
           +HF    ++S +  + ++ +A ++K      F  + L+G + + ++FEKPS RTR SFEV
Sbjct: 6   RHFLRDDDLSPAEQAEVLALAAELKREP---FAKRTLAGPRSVGVVFEKPSIRTRFSFEV 62

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           A+  LGG  I + G+ +QLG  E++ D+A+V+SRY  A+V RT  H RL EL  YATVPV
Sbjct: 63  AITQLGGHPIVVDGNSVQLGVRESVPDSARVMSRYTSAVVWRTHGHDRLDELAAYATVPV 122

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLNIA 183
           +NAL D  HPCQ++AD++T  E +GS+KG    + GDG NN+ HSL+   A     + +A
Sbjct: 123 VNALDDVFHPCQVLADLLTISERKGSLKGLRLVFLGDGANNMAHSLLLAGATAGIDVVVA 182

Query: 184 TPIGSEPRNEYL--NWARNQ--GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
            P G  P         AR +  GA   +  D V+AV+GA  V TD W+SM QE   R+  
Sbjct: 183 APEGFHPDPAVFADAVARGELTGARPQIVADPVKAVEGADVVVTDAWVSMGQESDPRDRA 242

Query: 240 -VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
            + +P+QVN +L+S A PDA+ +HCLPAHR EE+ +EVLDG QS V+DEAENRLH QKA+
Sbjct: 243 TLMRPYQVNKALLSHAKPDAIVLHCLPAHREEEITSEVLDGAQSAVWDEAENRLHAQKAL 302

Query: 299 LLWCF 303
           L+W  
Sbjct: 303 LVWLL 307


>gi|227833172|ref|YP_002834879.1| Ornithine carbamoyltransferase [Corynebacterium aurimucosum ATCC
           700975]
 gi|262184157|ref|ZP_06043578.1| ornithine carbamoyltransferase [Corynebacterium aurimucosum ATCC
           700975]
 gi|227454188|gb|ACP32941.1| Ornithine carbamoyltransferase [Corynebacterium aurimucosum ATCC
           700975]
          Length = 305

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 136/302 (45%), Positives = 193/302 (63%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRVSFEV 64
           +HF    +++    + ++++A K+K      F  +PL G K +A++F+K STRTR SFE 
Sbjct: 4   RHFLADDDLTPQEQAEVLDLALKLKKEP---FAERPLEGPKSVAVLFDKTSTRTRFSFEA 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            + HLGG  I       Q+G+ ET  DTA VLSR+V+AIV RT  H  LLE+ E ATVP+
Sbjct: 61  GIAHLGGHAIVTETKSTQMGKGETYQDTAAVLSRFVEAIVWRTYAHQNLLEMAETATVPI 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLNIA 183
           +NAL+++ HPCQI+AD++T  E+ G + G+   + GDG NN+ +S + G A     + I 
Sbjct: 121 VNALSEDLHPCQILADLVTCRENFGDLAGRKAVYLGDGNNNMANSYMLGFATAGMEMTII 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV-FQ 242
            P G +P+ E++  AR +G       D+++AV GA  V TDTW+SM QE   ++    F 
Sbjct: 181 APEGFQPQPEFVERARKRG--TVTVTDSLEAVDGADVVITDTWVSMGQEDDGKDRRTPFL 238

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           P+QV   +MS A  +A+F+HCLPA+RG EV  EV+DGPQS VFDEAENRLH QKA+L+W 
Sbjct: 239 PYQVTPEVMSRAKEEAIFLHCLPAYRGNEVTAEVIDGPQSRVFDEAENRLHAQKALLVWL 298

Query: 303 FG 304
             
Sbjct: 299 LA 300


>gi|282164719|ref|YP_003357104.1| ornithine carbamoyltransferase [Methanocella paludicola SANAE]
 gi|282157033|dbj|BAI62121.1| ornithine carbamoyltransferase [Methanocella paludicola SANAE]
          Length = 305

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 125/299 (41%), Positives = 186/299 (62%), Gaps = 1/299 (0%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAM 66
           H   ++++S  +++ I+++A+ +K   ++      L  K L MIFEK STRTRVSFEV M
Sbjct: 2   HIISIADLSVDDINGILDLAEDLKKKRKDGVVTDYLKNKSLVMIFEKSSTRTRVSFEVGM 61

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
             LGG  ++L     Q+GR ETI DTAK+LSRY   I++R  +H  + E+ + AT+PVIN
Sbjct: 62  TDLGGHALYLDPGTTQIGRGETIADTAKILSRYAHCIMIRAKSHYMITEMAKNATIPVIN 121

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI 186
            L D+ HPCQ++AD+MT  E +G +KG   +W GDGNN+ +SLI  +A     +  A P 
Sbjct: 122 GLDDHEHPCQVLADLMTIRERKGPLKGLKLAWIGDGNNVCNSLILASAMTGMKMVAACPK 181

Query: 187 GSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPFQ 245
           G EP    +  AR+ G  + +  +  +A K A  ++TD W+SM  E +  R     + +Q
Sbjct: 182 GYEPDKGVIEKARSMGGDIKVLRNPKEAAKDADVLYTDVWVSMGDESEMERRYKDLRDYQ 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           +N+ L+ +A    + +HCLPAHRG+E+ +EV++   S VFDEAENRLH QKA+L+   G
Sbjct: 242 INIGLVKLASKGCIVLHCLPAHRGQEITDEVINSENSAVFDEAENRLHAQKALLIKLIG 300


>gi|121605903|ref|YP_983232.1| ornithine carbamoyltransferase [Polaromonas naphthalenivorans CJ2]
 gi|120594872|gb|ABM38311.1| ornithine carbamoyltransferase [Polaromonas naphthalenivorans CJ2]
          Length = 309

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 135/296 (45%), Positives = 192/296 (64%), Gaps = 5/296 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH+   S++++ + + + E A  IK   +    ++PL  + + MIFEK STRTRVSFE  
Sbjct: 9   KHYLQFSDLNADDYAYLFERAALIKKKFKAYERHQPLIDRTMVMIFEKASTRTRVSFEAG 68

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  + L+    QLGRAE I D+AKV+SR VD +++RT   +++    E++ VPVI
Sbjct: 69  MYQLGGTVVNLTTEGSQLGRAEPIEDSAKVISRMVDLVMIRTFEQTKINRFAEHSRVPVI 128

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI T+ EHRGS++GK  +W GDGNN+ ++ ++ +    + ++++TP
Sbjct: 129 NGLTNEFHPCQILADIFTYIEHRGSIQGKTVAWVGDGNNMANTWLQASEILGFKVHLSTP 188

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF--KAREEHVFQP 243
            G E          ++  S  +F D +QA  GA  V TD W SM  E   +AR++  F  
Sbjct: 189 GGYEVDQSIAGIRSSE--SYQVFKDPMQACAGADLVTTDVWTSMGYEAENEARKK-AFAD 245

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + V+  +M  A PDALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENR+H QKA++
Sbjct: 246 WCVDSEMMRAAKPDALFMHCLPAHRGEEVEAEVIDGPQSVVWDEAENRMHVQKALM 301


>gi|237747033|ref|ZP_04577513.1| ornithine carbamoyltransferase [Oxalobacter formigenes HOxBLS]
 gi|229378384|gb|EEO28475.1| ornithine carbamoyltransferase [Oxalobacter formigenes HOxBLS]
          Length = 303

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 137/295 (46%), Positives = 183/295 (62%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH+   S+ S S    +IE A+ IK   +N     PL  + L M+FEK STRTR+SFE  
Sbjct: 4   KHYLQFSDFSLSEYEYLIERARIIKQKFKNYEPYHPLQDRTLVMVFEKSSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  I+L+  + QLGR E I D A+V+SR  D I++RT  H  +      + VPVI
Sbjct: 64  MHQLGGTAIYLNTRDSQLGRGEPIEDAAQVMSRMSDIIMVRTFGHDIIERFAACSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQ+ AD+ TF EHRGS++GK  +W GD NN+L+S ++ A  F++ +N++TP
Sbjct: 124 NGLTNEHHPCQVFADVFTFIEHRGSIQGKTVTWIGDANNMLYSWLQAAEVFDFHVNVSTP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN-QEFKAREEHVFQPF 244
            G +   + ++      +    F +   A +GAH V TD W SM  +E  A  +  F  +
Sbjct: 184 KGYDIDFKLVS---PDHSHFTRFDNPADACEGAHLVTTDVWTSMGFEEENAARKKAFANW 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            V+   M  A  DALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA+L
Sbjct: 241 NVDSDKMRRAASDALFMHCLPAHRGEEVTAEVIDGPQSVVWDEAENRLHVQKALL 295


>gi|23097915|ref|NP_691381.1| ornithine carbamoyltransferase [Oceanobacillus iheyensis HTE831]
 gi|32699447|sp|Q8ET05|OTC_OCEIH RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|22776139|dbj|BAC12416.1| ornithine carbamoyltransferase [Oceanobacillus iheyensis HTE831]
          Length = 322

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 143/301 (47%), Positives = 194/301 (64%), Gaps = 9/301 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSEN--IFENKPLSGKVLAMIFEKPSTRTRVSFE 63
           + F  L++ +   ++ +I++A  +K   ++  IFE  PL GK L MIFEK STRTRVSFE
Sbjct: 18  RDFLTLADYTKDEINYLIDLADYLKKQHKDGVIFE--PLKGKTLGMIFEKSSTRTRVSFE 75

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
             +  LGG  IFLS  ++Q+GR ETI DTAKVLS Y+D I++RT     + EL ++A++P
Sbjct: 76  TGIYQLGGLGIFLSSKDIQIGRGETIADTAKVLSGYLDGIMIRTFAQEDVEELAKHASIP 135

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQ++AD+ T +E +G + G    + GDGNN+ HSL+ GAA+    +   
Sbjct: 136 VINGLTDLYHPCQVLADLQTIKEVKGKLHGVKLVYIGDGNNMTHSLMLGAAKTGMHMVAV 195

Query: 184 TPIGSEPRNEYLNWAR---NQ-GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           TP G  P  E L  A+   NQ GA +    D   AV+ A  ++TD W SM QE + ++  
Sbjct: 196 TPDGYTPNKEVLTKAKSIANQHGAIIEWTSDIATAVQEADVIYTDVWASMGQEEEQQQRE 255

Query: 240 V-FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F+ +QVN SL+  A  D +FMHCLPAHRGEEV   V+DG QSVVF +AENRLH QKA+
Sbjct: 256 KDFENYQVNESLLEKAKTDVIFMHCLPAHRGEEVTAGVIDGKQSVVFQQAENRLHAQKAL 315

Query: 299 L 299
           +
Sbjct: 316 M 316


>gi|325680874|ref|ZP_08160412.1| ornithine carbamoyltransferase [Ruminococcus albus 8]
 gi|324107654|gb|EGC01932.1| ornithine carbamoyltransferase [Ruminococcus albus 8]
          Length = 305

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 125/299 (41%), Positives = 187/299 (62%), Gaps = 1/299 (0%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAM 66
           H   + ++S   +  I+ +A ++K  ++N  E+K L GK L MIF+K STRTRVSFE  M
Sbjct: 3   HLLKMLDLSKEEIIDILNLADQLKYENKNGIEHKVLKGKTLGMIFQKSSTRTRVSFETGM 62

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
             LGG  +FLS  ++Q+GR E + DTA+VLSRY+D I++RT     + +L EY ++P+IN
Sbjct: 63  YQLGGQALFLSNRDLQIGRGEPVQDTARVLSRYLDGIMIRTFEQKEVEDLAEYGSIPIIN 122

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI 186
            LTD  HPCQ++AD+MT  E +G  +G    + GDGNN+ +SLI G  +    ++IA P 
Sbjct: 123 GLTDFCHPCQVLADLMTIREFKGQFEGLKMCYIGDGNNMANSLIVGGLKVGMSVSIACPE 182

Query: 187 GSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV-FQPFQ 245
           G  P  + L +A+  G    +     +A K A  +FTD W SM +E +  +  V F  +Q
Sbjct: 183 GYRPDPKVLEFAKQYGDKFFMTDKPAEAAKDADVLFTDVWTSMGEEAETEKRKVAFAGYQ 242

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           +N  ++++A PDA+  HCLPAHR EE+  +V +   + +F+EAENRLH QKA+++   G
Sbjct: 243 INDDIIAVAKPDAMVQHCLPAHREEEITEKVFEAHANEIFEEAENRLHAQKAVMVKVMG 301


>gi|218516855|ref|ZP_03513695.1| ornithine carbamoyltransferase [Rhizobium etli 8C-3]
          Length = 173

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 124/171 (72%), Positives = 149/171 (87%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           PKHF DLS ++S++L  I+  A   K + +    +KPL+GK+LAMIFEKPSTRTRVSF+V
Sbjct: 3   PKHFLDLSAVTSADLRTIMNDALVRKQAFKAGQGDKPLAGKMLAMIFEKPSTRTRVSFDV 62

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M+ LGG+T+FLSG+EMQLGRAETIGDTAKVLSRYVDAI++RTT HSRLLEL E+ATVPV
Sbjct: 63  GMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTEHSRLLELAEHATVPV 122

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAAR 175
           INALTD+THPCQI+ADIMTFEEHRG +KGK  +W+GDGNN+LHSL+EGAAR
Sbjct: 123 INALTDDTHPCQIMADIMTFEEHRGPIKGKTIAWTGDGNNVLHSLVEGAAR 173


>gi|161760537|ref|NP_394786.2| ornithine carbamoyltransferase [Thermoplasma acidophilum DSM 1728]
          Length = 307

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 137/287 (47%), Positives = 191/287 (66%), Gaps = 7/287 (2%)

Query: 18  NLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLS 77
           +LS II+++ ++K +    +E+  L  KVL +IFEKPSTRTR S EVA+  LGG  ++L+
Sbjct: 17  DLSEIIDLSIELKKNRYRSYES--LRNKVLGLIFEKPSTRTRTSLEVAIDQLGGHAVYLN 74

Query: 78  GSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQI 137
            SEMQLGR ETI DT  VLSR++DAI  R  +H  ++EL    ++PVINAL D  HP QI
Sbjct: 75  PSEMQLGRGETISDTGHVLSRFLDAIAYRAYDHRNVVELARSTSIPVINALDDVEHPLQI 134

Query: 138 IADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNW 197
           +AD MT +E +G      FS+ GDGNN+ +SL+ GAA     + +A+P G EP+ E++  
Sbjct: 135 VADFMTIKEKKGRFTNLKFSYIGDGNNMANSLMLGAAILGTDMYVASPKGFEPKQEFVEK 194

Query: 198 ARN----QGASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREEHVFQPFQVNLSLMS 252
           AR+     G+S+ + +D V+A + A  ++TD WISM  +  K  +E  F+ FQ+N  L+S
Sbjct: 195 ARSIAKQHGSSITITNDPVEAARDADVIYTDVWISMGEESKKGEKEKAFKDFQINEKLVS 254

Query: 253 MAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            A  D +FMHCLPAHRG EV + V D   SV+FDEAENRLH++K +L
Sbjct: 255 NAKRDYIFMHCLPAHRGLEVTDGVADSINSVIFDEAENRLHSEKGVL 301


>gi|30249409|ref|NP_841479.1| ornithine carbamoyltransferase [Nitrosomonas europaea ATCC 19718]
 gi|32699432|sp|Q82UP4|OTC_NITEU RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|30138772|emb|CAD85349.1| argF; ornithine carbamoyltransferase protein [Nitrosomonas europaea
           ATCC 19718]
          Length = 307

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 138/296 (46%), Positives = 183/296 (61%), Gaps = 5/296 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF    +        + +  + IKN  +      PL+ + LAMIFEK STRTR+SFE  
Sbjct: 4   RHFLQFKDFDRQEYEYLFDRTRWIKNEFKQYRRYWPLTDRTLAMIFEKHSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  I+LS  + QLGR E + D A+V+SR VD I +RT  H  +    E + VPVI
Sbjct: 64  MHQLGGSAIYLSTRDTQLGRGEPVEDAARVISRMVDIITLRTHEHGVIERFAENSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQI+ADI TF EHRGS+ GK  +W GD NN+ ++ ++ A  F++ ++++TP
Sbjct: 124 NGLTDEYHPCQILADIFTFMEHRGSIAGKTVAWIGDSNNVCNTWLQAAEVFDFNVHVSTP 183

Query: 186 IGSEPRNEYLN-WARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHVFQP 243
            G E   E    +  +        HD   AVK A  V TD W SM  E +A   ++ F  
Sbjct: 184 PGYEVEPERAGLYGTDHYEQFVSPHD---AVKDADLVTTDVWTSMGFEDEADTRKNDFAD 240

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           F+V+  +M+ A  +ALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLHTQKA++
Sbjct: 241 FRVDAEMMACAKEEALFMHCLPAHRGEEVDAEVIDGPQSVVWDEAENRLHTQKALM 296


>gi|32699617|sp|Q9HIK9|OTCC_THEAC RecName: Full=Ornithine carbamoyltransferase, catabolic;
           Short=OTCase
          Length = 305

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 137/287 (47%), Positives = 191/287 (66%), Gaps = 7/287 (2%)

Query: 18  NLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLS 77
           +LS II+++ ++K +    +E+  L  KVL +IFEKPSTRTR S EVA+  LGG  ++L+
Sbjct: 15  DLSEIIDLSIELKKNRYRSYES--LRNKVLGLIFEKPSTRTRTSLEVAIDQLGGHAVYLN 72

Query: 78  GSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQI 137
            SEMQLGR ETI DT  VLSR++DAI  R  +H  ++EL    ++PVINAL D  HP QI
Sbjct: 73  PSEMQLGRGETISDTGHVLSRFLDAIAYRAYDHRNVVELARSTSIPVINALDDVEHPLQI 132

Query: 138 IADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNW 197
           +AD MT +E +G      FS+ GDGNN+ +SL+ GAA     + +A+P G EP+ E++  
Sbjct: 133 VADFMTIKEKKGRFTNLKFSYIGDGNNMANSLMLGAAILGTDMYVASPKGFEPKQEFVEK 192

Query: 198 ARN----QGASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREEHVFQPFQVNLSLMS 252
           AR+     G+S+ + +D V+A + A  ++TD WISM  +  K  +E  F+ FQ+N  L+S
Sbjct: 193 ARSIAKQHGSSITITNDPVEAARDADVIYTDVWISMGEESKKGEKEKAFKDFQINEKLVS 252

Query: 253 MAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            A  D +FMHCLPAHRG EV + V D   SV+FDEAENRLH++K +L
Sbjct: 253 NAKRDYIFMHCLPAHRGLEVTDGVADSINSVIFDEAENRLHSEKGVL 299


>gi|291286257|ref|YP_003503073.1| ornithine carbamoyltransferase [Denitrovibrio acetiphilus DSM
           12809]
 gi|290883417|gb|ADD67117.1| ornithine carbamoyltransferase [Denitrovibrio acetiphilus DSM
           12809]
          Length = 306

 Score =  266 bits (679), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 138/304 (45%), Positives = 190/304 (62%), Gaps = 6/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F  L + S+  L  +I+ A ++K  ++N   +  L+GK LAMIFEKPSTRTRVSFEV 
Sbjct: 3   RDFLTLKDWSTDELKSMIQTAIRLKAENKNGITHHHLAGKKLAMIFEKPSTRTRVSFEVG 62

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  ++LS  ++QLGR ET+ DTA+ LSR+VD I++RT  H  + EL E A VPVI
Sbjct: 63  MYELGGHALYLSSDDIQLGRGETVKDTARTLSRFVDGIMIRTKGHDIIEELAENADVPVI 122

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ++AD+ T  EH  +   K+ ++ GDGNN+  S + GAA+F   +++A+P
Sbjct: 123 NGLTDDFHPCQVMADVQTIYEHMNTFDVKV-AYIGDGNNMAQSWLYGAAKFGMDISVASP 181

Query: 186 IGSEPR----NEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EHV 240
              E         +  A+  GA + L  D   AVK A  ++TD W SM QE +  E + +
Sbjct: 182 ENYECDPAVVKSAVEAAKQTGAKIELCRDPFDAVKNADIIYTDVWASMGQESEKEERKKI 241

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F  +QVN  LM       LFMHCLPA+ G EV  +V +   S+V+DEAENRLH QKA++L
Sbjct: 242 FAGYQVNKKLMEATGRKTLFMHCLPAYMGLEVTEDVYESDISIVWDEAENRLHAQKAVML 301

Query: 301 WCFG 304
              G
Sbjct: 302 KVMG 305


>gi|10640673|emb|CAC12451.1| probable ornithine carbamoyltransferase [Thermoplasma acidophilum]
          Length = 297

 Score =  266 bits (679), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 137/287 (47%), Positives = 191/287 (66%), Gaps = 7/287 (2%)

Query: 18  NLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLS 77
           +LS II+++ ++K +    +E+  L  KVL +IFEKPSTRTR S EVA+  LGG  ++L+
Sbjct: 7   DLSEIIDLSIELKKNRYRSYES--LRNKVLGLIFEKPSTRTRTSLEVAIDQLGGHAVYLN 64

Query: 78  GSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQI 137
            SEMQLGR ETI DT  VLSR++DAI  R  +H  ++EL    ++PVINAL D  HP QI
Sbjct: 65  PSEMQLGRGETISDTGHVLSRFLDAIAYRAYDHRNVVELARSTSIPVINALDDVEHPLQI 124

Query: 138 IADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNW 197
           +AD MT +E +G      FS+ GDGNN+ +SL+ GAA     + +A+P G EP+ E++  
Sbjct: 125 VADFMTIKEKKGRFTNLKFSYIGDGNNMANSLMLGAAILGTDMYVASPKGFEPKQEFVEK 184

Query: 198 ARN----QGASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREEHVFQPFQVNLSLMS 252
           AR+     G+S+ + +D V+A + A  ++TD WISM  +  K  +E  F+ FQ+N  L+S
Sbjct: 185 ARSIAKQHGSSITITNDPVEAARDADVIYTDVWISMGEESKKGEKEKAFKDFQINEKLVS 244

Query: 253 MAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            A  D +FMHCLPAHRG EV + V D   SV+FDEAENRLH++K +L
Sbjct: 245 NAKRDYIFMHCLPAHRGLEVTDGVADSINSVIFDEAENRLHSEKGVL 291


>gi|126665083|ref|ZP_01736066.1| ornithine carbamoyltransferase [Marinobacter sp. ELB17]
 gi|126630453|gb|EBA01068.1| ornithine carbamoyltransferase [Marinobacter sp. ELB17]
          Length = 304

 Score =  266 bits (679), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 134/296 (45%), Positives = 185/296 (62%), Gaps = 6/296 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L++++   L  +++   +++           L  +VLAMIFEK STRTRVSFE  
Sbjct: 4   RHFLTLNDLTPDELEALLDHGSRLRREWHQGVTRDTLKNRVLAMIFEKSSTRTRVSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLS  + QLGR E I D+A V+S  VDA+++RT  H+ +      ++ PVI
Sbjct: 64  MMQLGGSALFLSPRDTQLGRGEPIEDSAIVISSMVDAVMIRTFAHNTVERFAAASSAPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+ HPCQ++AD+ T+ E+RGS++G   +W GDGNN+ HS I  A  F + LN+A P
Sbjct: 124 NALTDDFHPCQLLADMQTYRENRGSIRGATVAWIGDGNNMCHSYINAAVMFGFHLNVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF--KAREEHVFQP 243
            G EP        +     V + H+   A + A+ + TD W SM QE   KARE   F  
Sbjct: 184 KGYEPDAAVFEAHKEH---VTVMHEPADAARDANLLVTDVWASMGQESEQKAREL-AFSS 239

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           +Q+N  LMS+A  DALFMHCLPAHRGEE+  ++++   SVV+ EAENRLH QKA+L
Sbjct: 240 YQINPQLMSLAAKDALFMHCLPAHRGEEISQDMMEHSGSVVWQEAENRLHAQKALL 295


>gi|32266476|ref|NP_860508.1| ornithine carbamoyltransferase [Helicobacter hepaticus ATCC 51449]
 gi|56404401|sp|Q7VHJ0|OTC_HELHP RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|32262527|gb|AAP77574.1| ornithine carbamoyltransferase [Helicobacter hepaticus ATCC 51449]
          Length = 329

 Score =  266 bits (679), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 149/316 (47%), Positives = 202/316 (63%), Gaps = 21/316 (6%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKP-LSGKVLAMIFEKPSTRTRVSFEV 64
           KHF  L++ +   +  +++VA ++K  S +I  NKP L GKVLAMIFEK STRTRVSFE 
Sbjct: 2   KHFLTLNDFNRDEILAMVDVALELKYESLHI-GNKPYLKGKVLAMIFEKSSTRTRVSFES 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG  IFLS  ++QLGR E I DTA+V+S  VD I+MRT+ HSRL E   Y++VPV
Sbjct: 61  GIFQLGGQGIFLSHKDIQLGRGEPIKDTARVISSMVDMIMMRTSEHSRLEEFASYSSVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEE------HRGSV---KGK-----LFSWSGDGNNILHSLI 170
           IN L+D+ HP Q+IAD +T  E      H   +   KGK     + ++ GDGNN+ HS I
Sbjct: 121 INGLSDDFHPVQLIADYLTMIECGIYLTHHNPLYPTKGKGGRNPIVAYIGDGNNMAHSWI 180

Query: 171 EGAARFNYLLNIATPIGSEPRNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTW 226
             A    + L IA+PIG  P+ + +  A++     G  + + +DA +AV  A+ V TDTW
Sbjct: 181 NLAGILGFELRIASPIGYAPKADIITKAQDMCIQSGGKIKILNDAKEAVSNANVVVTDTW 240

Query: 227 ISMNQ-EFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVF 285
            SM Q E K + +  F  F V+ ++MS A  DA+F+HCLPA+RG+EV   VL+G QS VF
Sbjct: 241 ASMGQEEQKEQRKCAFANFCVDEAMMSYAQKDAIFLHCLPAYRGQEVSEGVLEGAQSKVF 300

Query: 286 DEAENRLHTQKAILLW 301
            EA+NRLH QK I+L+
Sbjct: 301 QEAQNRLHAQKGIMLY 316


>gi|158338712|ref|YP_001519889.1| ornithine carbamoyltransferase [Acaryochloris marina MBIC11017]
 gi|158308953|gb|ABW30570.1| ornithine carbamoyltransferase [Acaryochloris marina MBIC11017]
          Length = 312

 Score =  266 bits (679), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 132/303 (43%), Positives = 192/303 (63%), Gaps = 9/303 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +    L++++S  +  ++E+A +IK     + + KP   KVL ++F K STRTRVSF V 
Sbjct: 11  RDLLSLADLTSPEIDGLLELAAQIK-----VGQVKPHCPKVLGLLFTKASTRTRVSFSVG 65

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  I L     Q+GR E + DTA+VL RY+D + +RT     L    +YA++PVI
Sbjct: 66  MYRLGGQVIDLRPDATQVGRGEPLEDTARVLDRYLDVLAIRTYEQQDLNIFAQYASIPVI 125

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD  HPCQI AD++T  E  G ++G   ++ GDGNN+ HSL+ G A     + +ATP
Sbjct: 126 NALTDLEHPCQIFADLLTLREAFGQLEGLTLTYLGDGNNVAHSLLLGCALVGVNIRVATP 185

Query: 186 IGSEPRNEYLNWAR---NQGASVALFHDAVQAVKGAHCVFTDTWISMNQ-EFKAREEHVF 241
           +  +P  +++  A+      +SV +  D  +AV GAH ++TD W SM Q E  +    +F
Sbjct: 186 LDYQPLPDFVEKAKILAGDRSSVLITTDPQKAVDGAHALYTDVWASMGQEELASNRIPIF 245

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+QVN SL++ A P+A+ +HCLPAHRGEE+  +V++G QS V+D+AENRLHTQ+A+L  
Sbjct: 246 QPYQVNESLLTKADPNAIVLHCLPAHRGEEITADVMEGAQSRVWDQAENRLHTQQALLAS 305

Query: 302 CFG 304
             G
Sbjct: 306 VLG 308


>gi|32699489|sp|Q9ZB62|OTC_BACST RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|3912936|gb|AAC78720.1| ornithine carbamoyltransferase [Geobacillus stearothermophilus]
          Length = 311

 Score =  266 bits (679), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 139/265 (52%), Positives = 181/265 (68%), Gaps = 6/265 (2%)

Query: 41  PLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYV 100
           PLSGK +AMIFEKPS  TRVSFEV M  LGG  ++L+G+ +QLGR ETI DTA+VLS+YV
Sbjct: 45  PLSGKTMAMIFEKPSG-TRVSFEVGMIQLGGQAMYLNGNHLQLGRGETIADTARVLSQYV 103

Query: 101 DAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSG 160
             I++RT  H ++ EL EYA+    N LTD+ HPCQ +AD++T  E + + +G   ++ G
Sbjct: 104 RVIMIRTFAHQKVEELAEYASFRSSNGLTDDDHPCQALADLLTIYEVKKTFQGVKLAYVG 163

Query: 161 DGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWA----RNQGASVALFHDAVQAVK 216
           DGNN+ ++L+  AA+    + IA P G EP+ EY+  A       G  V + HD + AV 
Sbjct: 164 DGNNVANALLVAAAKVGMDVAIACPPGYEPKKEYVEAACRVGEQTGRRVTVTHDPLVAVA 223

Query: 217 GAHCVFTDTWISMNQEFKAREE-HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINE 275
           GA  ++TD W SM QE ++ E   VFQP+QVN  L+  A PD LF+HCLPAHRGEEV   
Sbjct: 224 GADRIYTDVWTSMGQESESSERLQVFQPYQVNEELVKAAKPDYLFLHCLPAHRGEEVTAG 283

Query: 276 VLDGPQSVVFDEAENRLHTQKAILL 300
           V+DGP SVVF++A NRLH QKAILL
Sbjct: 284 VMDGPNSVVFEQAGNRLHAQKAILL 308


>gi|303243630|ref|ZP_07329971.1| ornithine carbamoyltransferase [Methanothermococcus okinawensis
           IH1]
 gi|302485872|gb|EFL48795.1| ornithine carbamoyltransferase [Methanothermococcus okinawensis
           IH1]
          Length = 317

 Score =  266 bits (679), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 133/304 (43%), Positives = 194/304 (63%), Gaps = 10/304 (3%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAM 66
           H   L ++  +++  II+ A   K + + +     L  K +A+IFE PSTRTR+SF++A+
Sbjct: 14  HLLTLGDLERNDVENIIKDAIYFKQNRKTM---DILKDKNIALIFESPSTRTRISFDIAV 70

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
             LGG ++ L+  E  LG+ E+I DTA+V+SRYVD IV R  NH  L EL +Y  VPVIN
Sbjct: 71  NELGGHSLMLNTGETHLGKKESIKDTARVMSRYVDGIVARVKNHKTLEELAKYGNVPVIN 130

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI 186
           AL++  HPCQI+ADI+T +EH+  +KG   S+ GDGNN+ +SL+ G A     +  ATP 
Sbjct: 131 ALSNLAHPCQILADILTIKEHKNKLKGLKLSYFGDGNNVCNSLLIGGALLGMDVYAATPK 190

Query: 187 GSEPRNEYLNWA-----RNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE--H 239
           G EP   ++  A     +    S+ L +D  +  + A  ++TD WISM+ + K  +E   
Sbjct: 191 GYEPNAMFVKKALEIVDKYGEGSITLTNDPKEGAEDADVLYTDVWISMSDKNKDLDEVNK 250

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           +F P+Q+N  L+S A  +A+ MHCLPA+RG E+ ++V+DG QSVV+DEAENRLH QKA+ 
Sbjct: 251 IFPPYQINEKLLSYAKNNAIVMHCLPANRGMEITDDVIDGKQSVVYDEAENRLHAQKAVF 310

Query: 300 LWCF 303
            + F
Sbjct: 311 KYIF 314


>gi|20092125|ref|NP_618200.1| ornithine carbamoyltransferase [Methanosarcina acetivorans C2A]
 gi|32699458|sp|Q8TKT5|OTC_METAC RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|19917346|gb|AAM06680.1| ornithine carbamoyltransferase [Methanosarcina acetivorans C2A]
          Length = 302

 Score =  265 bits (678), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 130/294 (44%), Positives = 184/294 (62%), Gaps = 7/294 (2%)

Query: 11  LSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLG 70
           ++++S   +  ++E A  +K   +     + L  K L MIFEK STRTRVSFEVAM   G
Sbjct: 8   ITDLSKEEIYELLESAADLKAKRKAGESTEYLKNKSLGMIFEKSSTRTRVSFEVAMTDFG 67

Query: 71  GDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTD 130
           G  ++L+  ++Q+GR ETI DTA+ LS Y+  ++ R  +H  + +L +Y+T+PVINAL+D
Sbjct: 68  GHALYLNSRDIQVGRGETIEDTARTLSGYLHGLMARVMSHDTVEKLAKYSTMPVINALSD 127

Query: 131 NTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEP 190
             HPCQI+ D MT  E +   +G  F+W GDGNN+ +S + G+A       +A P G EP
Sbjct: 128 REHPCQILGDFMTIMEFKKKFEGLKFAWVGDGNNVCNSALLGSAIMGMEFAVACPKGYEP 187

Query: 191 RNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN----QEFKAREEHVFQPFQV 246
           + E+L  A+  G    +  D   A K A  ++TD W+SM     QE + RE   F  FQV
Sbjct: 188 KAEFLEQAKALGGKFTITDDPKVAAKDADIIYTDVWVSMGDEAEQEKRLRE---FASFQV 244

Query: 247 NLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           N  L+ +A PD + MHCLPA RG E+ +EV+DGP SV+F+EAENRLH QKA++L
Sbjct: 245 NTELLGVAKPDVIVMHCLPARRGLEITDEVMDGPNSVIFEEAENRLHAQKALIL 298


>gi|121608866|ref|YP_996673.1| ornithine carbamoyltransferase [Verminephrobacter eiseniae EF01-2]
 gi|121553506|gb|ABM57655.1| ornithine carbamoyltransferase [Verminephrobacter eiseniae EF01-2]
          Length = 306

 Score =  265 bits (678), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 134/296 (45%), Positives = 191/296 (64%), Gaps = 4/296 (1%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAM 66
           H+    ++ +   + + E A  +K+  +   ++ PL+ + LAMIFEK STRTRVSFE  M
Sbjct: 3   HYLQFGDLDADTYAYLFERAALLKHKFKAYEKHHPLADRTLAMIFEKASTRTRVSFEAGM 62

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
             LGG  + L+  + Q GRAE I D+A+V+SR VD +++RT   ++L     ++ VPVIN
Sbjct: 63  YQLGGSVVHLTTGDSQWGRAEPIEDSARVISRMVDLVMIRTYEQAKLERFAAHSRVPVIN 122

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI 186
            LT+  HPCQI+ADI TF E RGS++GK  +W GDGNN+ ++ ++ AA   + ++++TP 
Sbjct: 123 GLTNEFHPCQILADIFTFIERRGSIRGKTVAWVGDGNNMANTWLQAAALLGFTVHVSTPR 182

Query: 187 GSEPRNEYLNWARNQGASVALFH-DAVQAVKGAHCVFTDTWISMNQEF--KAREEHVFQP 243
           G E   + +  A    A    FH D   A +GA  V TD W SM  E   +ARE+  F  
Sbjct: 183 GYEIDAKLVAGAGKTCAESYKFHSDPRAACEGADLVTTDVWTSMGYEAENEAREK-AFAH 241

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + V+  +M+ A PDALFMHCLPAHRG+EV  +V+DGPQSVV+DEAENR+H QKA++
Sbjct: 242 WCVDAEMMAAAKPDALFMHCLPAHRGQEVHADVIDGPQSVVWDEAENRMHVQKALM 297


>gi|323527175|ref|YP_004229328.1| ornithine carbamoyltransferase [Burkholderia sp. CCGE1001]
 gi|323384177|gb|ADX56268.1| ornithine carbamoyltransferase [Burkholderia sp. CCGE1001]
          Length = 309

 Score =  265 bits (678), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 137/296 (46%), Positives = 184/296 (62%), Gaps = 5/296 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +H+    + S  +   ++E A+ +K   +N     PL  + LAMIFEK STRTR+SFE  
Sbjct: 7   RHYLQFKDFSLDDYEYVLERARILKRKFKNYETYHPLHDRTLAMIFEKNSTRTRLSFEAG 66

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  +F+S  + QLGR E I D A+V+SR VD I++RT     +    E + VPVI
Sbjct: 67  IFQLGGHAVFMSTRDTQLGRGEPIEDAAQVISRMVDIIMIRTFGQDIIQRFAENSRVPVI 126

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQ++ADI T+ EHRG ++GK  +W GD NN+L++ IE A    + L ++TP
Sbjct: 127 NGLTNEYHPCQVLADIFTYFEHRGPIRGKTVAWVGDANNMLYTWIEAAQILGFRLRLSTP 186

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKAREEHVFQP 243
            G +     +  A         F D  +A  GA  V TD W SM    E +AR++  F  
Sbjct: 187 PGYKLDRALV--AAESAPFFEEFDDPNEACAGADLVTTDVWTSMGFEAENEARKK-AFAD 243

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + V+  +MS AHPDALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA++
Sbjct: 244 WCVDAEMMSRAHPDALFMHCLPAHRGEEVSAEVIDGPQSVVWDEAENRLHVQKALM 299


>gi|326382711|ref|ZP_08204402.1| ornithine carbamoyltransferase [Gordonia neofelifaecis NRRL
           B-59395]
 gi|326198830|gb|EGD56013.1| ornithine carbamoyltransferase [Gordonia neofelifaecis NRRL
           B-59395]
          Length = 310

 Score =  265 bits (677), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 131/303 (43%), Positives = 188/303 (62%), Gaps = 10/303 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRVSFEV 64
           +HF    +++ +  + ++ +A ++K      F  +PL G + + +IF+K STRTR SFEV
Sbjct: 7   RHFLRDDDLTPAEQAEVLSLAAQMKRDR---FAFRPLEGPRAVGVIFDKNSTRTRFSFEV 63

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG  + + G+  Q+GR E+  DT +VLSR+VDAIV RT    RL  + EYATVPV
Sbjct: 64  GISQLGGHAVVVDGANTQMGRDESFADTGRVLSRFVDAIVWRTFGQDRLEAVAEYATVPV 123

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGD-GNNILHSLIEGAARFNYLLNIA 183
           +NAL+D+ HPCQ++AD+ T  E +G   G   ++ GD  NN+ HSL+ G       + I+
Sbjct: 124 VNALSDSFHPCQVLADLQTIIERKGKAAGLTLTYFGDAANNMAHSLMLGGVTAGMHVRIS 183

Query: 184 TPIGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE- 238
            P   +P    +  A+ +    G SV +  D + A  G   + TDTW+SM QE    +  
Sbjct: 184 GPTAFQPDPAVVEAAKQRAAETGGSVEIIGDPIVAATGTDVLVTDTWVSMGQEADGLDRI 243

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F+P+Q+N  L+  A PDA+ +HCLPAHRGEE+ +EV+DGP SVVFDEAENRLH QKA+
Sbjct: 244 GPFRPYQINAELLGHAAPDAMVLHCLPAHRGEEITDEVIDGPASVVFDEAENRLHAQKAL 303

Query: 299 LLW 301
           L W
Sbjct: 304 LAW 306


>gi|206901864|ref|YP_002251492.1| ornithine carbamoyltransferase [Dictyoglomus thermophilum H-6-12]
 gi|206740967|gb|ACI20025.1| ornithine carbamoyltransferase [Dictyoglomus thermophilum H-6-12]
          Length = 309

 Score =  265 bits (677), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 138/295 (46%), Positives = 186/295 (63%), Gaps = 11/295 (3%)

Query: 13  NISSSNLSCIIEVAKKIK---NSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHL 69
           ++S   +  I  +AK +K    + + I +   L GK +A+ FEKPSTRTR+SFEV +  L
Sbjct: 14  DLSREEIEQIFHLAKNLKLEYYAGKRIHDY--LKGKTVALFFEKPSTRTRISFEVGVHQL 71

Query: 70  GGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALT 129
           GG  ++L+  EMQL R ETI DTA+VL RYVD I+ R  +H  L+EL +Y+ +PVIN L+
Sbjct: 72  GGYPLYLNAQEMQLKRGETIADTARVLERYVDGIMARVYSHDTLVELAQYSRIPVINGLS 131

Query: 130 DNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSE 189
           D  HPCQ+IAD  T  E +G  K K+  + GDGNN+ +SLI         +  ++P    
Sbjct: 132 DLEHPCQVIADYFTIIEKKGFKKLKVV-YLGDGNNVANSLILAGVMLGMNVVCSSPKEFM 190

Query: 190 PRN----EYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQE-FKAREEHVFQPF 244
           P      E L  A+  G S+ +  D  +AVK A  ++TD W+SM QE  K     V  P+
Sbjct: 191 PPKKVLEEALVLAKRYGGSIEIIEDPKEAVKDADVLYTDVWVSMGQEDEKEIRRRVLPPY 250

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           Q+N  L+S+A  DA+ MHCLPAHRGEE+ +EV+DGP SVVFDEAENRLH QKAI+
Sbjct: 251 QLNKELLSLAKEDAIVMHCLPAHRGEEITDEVMDGPNSVVFDEAENRLHVQKAIM 305


>gi|15606793|ref|NP_214173.1| ornithine carbamoyltransferase [Aquifex aeolicus VF5]
 gi|32699416|sp|O67607|OTC_AQUAE RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|2984023|gb|AAC07566.1| ornithine carbamoyltransferase [Aquifex aeolicus VF5]
          Length = 306

 Score =  265 bits (677), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 132/303 (43%), Positives = 193/303 (63%), Gaps = 9/303 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F DL ++S      I++   K+K   E +   KPLSGK +A++F KPSTRTRVSFEV 
Sbjct: 3   RDFVDLWDLSPKEAWEIVKKTLKVKKGEEEL--GKPLSGKTIALLFTKPSTRTRVSFEVG 60

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG+++F    E+Q+ R E + DTA+ LS+YVD +++R  +H+ L E   +A+VPVI
Sbjct: 61  IYQLGGNSLFFQEKELQVSRGEDVRDTARTLSKYVDGVIVRNHSHTWLKEFANFASVPVI 120

Query: 126 NALTDNTHPCQIIADIMTFEEHRG-SVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           NALT+ +HPCQI++D+ T  EH G  +K    ++ GDGNN+ ++L+ GA  F   L +AT
Sbjct: 121 NALTNMSHPCQILSDVFTLYEHYGEELKNLKVAYVGDGNNVCNTLMVGAGMFGLKLFVAT 180

Query: 185 PIGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
           P G EP + Y    L +++  G SV L ++ V++VK A  V+TD W+SM +E K  E   
Sbjct: 181 PEGYEPNSYYYKKALEFSKENGGSVELTNNPVESVKDADVVYTDVWVSMGEENKNIE--A 238

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F P+QVN  L+S A      MHCLPA +G+E+  EV +     +F +AENRLHTQK ++ 
Sbjct: 239 FLPYQVNEKLLSFAKSSVKVMHCLPAKKGQEITEEVFEKNADFIFTQAENRLHTQKTLME 298

Query: 301 WCF 303
           + F
Sbjct: 299 FLF 301


>gi|218296387|ref|ZP_03497130.1| ornithine carbamoyltransferase [Thermus aquaticus Y51MC23]
 gi|218243181|gb|EED09712.1| ornithine carbamoyltransferase [Thermus aquaticus Y51MC23]
          Length = 301

 Score =  265 bits (677), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 136/301 (45%), Positives = 187/301 (62%), Gaps = 11/301 (3%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           +T PK   D S  +   L  ++++A+ +K      +  + L GK LA++FEKPS RTR +
Sbjct: 6   LTLPKDLLDFSGYTKEALKRLLDLAEALKRER---YRGEDLKGKSLALLFEKPSLRTRTT 62

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
            EVAM HLGG  ++L   ++ +G  E + D AK L R+V+ I  R   H  + EL  +A 
Sbjct: 63  LEVAMVHLGGHALYLDQKQVGIGEREPVRDIAKNLERFVEGIAARVYRHRTVEELARHAR 122

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           +PVINAL+D  HP Q +AD++T +E  G ++G   +W GDGNN+L SL+E A      + 
Sbjct: 123 IPVINALSDRAHPLQALADLLTLKEAFGGLEGLEVAWVGDGNNVLASLLEVAPLVGLKVR 182

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV- 240
           +ATP G EP    L  AR   A   L HD  +AV GAH ++TD W SM QE + RE+ + 
Sbjct: 183 VATPRGYEPEAALL--AR---AGAFLTHDPKEAVLGAHALYTDVWTSMGQEAE-REKRLR 236

Query: 241 -FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            FQ FQVN +L+ + HPD +F+HCLPAH GEE   E + GP+S VFD+AENRLHT KA+L
Sbjct: 237 DFQGFQVNGTLLDLLHPDGVFLHCLPAHYGEETTEEAVFGPRSRVFDQAENRLHTAKAVL 296

Query: 300 L 300
           L
Sbjct: 297 L 297


>gi|258654249|ref|YP_003203405.1| ornithine carbamoyltransferase [Nakamurella multipartita DSM 44233]
 gi|258557474|gb|ACV80416.1| ornithine carbamoyltransferase [Nakamurella multipartita DSM 44233]
          Length = 312

 Score =  265 bits (677), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 134/310 (43%), Positives = 192/310 (61%), Gaps = 10/310 (3%)

Query: 1   MMTYP-KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           M T P +H+    +++   L+ +++ A   K          PL+GK +A++FEK STRTR
Sbjct: 1   MTTAPVRHYLRDDDVTPDELTALLDTADTFKKDRTGY---TPLAGKAIAVVFEKNSTRTR 57

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFEV +  LGG  + + G   QLGR ETI DT++VLSR+VDA+ +RT    R+  L   
Sbjct: 58  LSFEVGIAQLGGQPVIVDGRTSQLGREETIEDTSRVLSRFVDAVAIRTFAQRRIDALAGV 117

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNY 178
           + VPVINALTD  HPCQ++AD+ T  E +G + G   ++ GDG NN+ HSL+ G A    
Sbjct: 118 SRVPVINALTDEFHPCQVLADLQTIRERKGRLAGLTLTYLGDGANNMAHSLMLGGANAGL 177

Query: 179 LLNIATPIGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFK 234
            + ++ P G +P  E++  AR +    GA+V L  D   AV G   + TDTW+SM QE  
Sbjct: 178 HVRVSAPAGFDPHPEFVAAARQRGAQTGATVELITDPHAAVDGCDVLVTDTWVSMGQEND 237

Query: 235 AREE-HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLH 293
             +    F+P+Q+N  L++ A+ DA+ +HCLPAHRG E+ +EV+DG  S V+DEAENRLH
Sbjct: 238 GLDRVGPFRPYQINRELLARANQDAIVLHCLPAHRGFEITDEVIDGASSAVWDEAENRLH 297

Query: 294 TQKAILLWCF 303
            QKA+L +  
Sbjct: 298 AQKALLAFLL 307


>gi|206603534|gb|EDZ40014.1| Ornithine carbamoyltransferase [Leptospirillum sp. Group II '5-way
           CG']
          Length = 309

 Score =  265 bits (677), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 127/302 (42%), Positives = 191/302 (63%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  +S+   S +  + E+ ++++ +      ++  + K + ++FEK STRTR+SFE  
Sbjct: 7   RHFLKVSDFQPSEIREVFELTEEVRKNPGQY--DQRFARKTVCLLFEKSSTRTRLSFEAG 64

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  +GGDT+FL G + QL R ETI DTA+V+S Y+D +++RT  H R+    + A +PVI
Sbjct: 65  VHQMGGDTVFLGG-DSQLARGETIEDTARVMSGYLDMVIIRTFGHDRIERFAKSAEIPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ ++D     +  G +KG   ++ GDGNN+ HSL+E AA     L +ATP
Sbjct: 124 NGLTDGHHPCQALSDFSFIGKEFGEIKGVRMAYVGDGNNMAHSLMEAAALLGVHLIVATP 183

Query: 186 IGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHV 240
            G  P  + L+W    AR  G S+    D ++A +GA  ++TD W SM QE ++   E  
Sbjct: 184 PGYAPNRDVLHWSAEQARKTGGSITWMSDPMEAARGARVLYTDVWTSMGQEAESSIREQS 243

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F  +Q+N  ++S A  DA+ +HCLPA+RG+EV  EVL+GP+S VF +AENRLH QKA++L
Sbjct: 244 FAGYQINQEMLSRAESDAIVLHCLPAYRGKEVTEEVLEGPRSRVFPQAENRLHLQKALML 303

Query: 301 WC 302
           +C
Sbjct: 304 FC 305


>gi|154500391|ref|ZP_02038429.1| hypothetical protein BACCAP_04058 [Bacteroides capillosus ATCC
           29799]
 gi|150270896|gb|EDM98179.1| hypothetical protein BACCAP_04058 [Bacteroides capillosus ATCC
           29799]
          Length = 307

 Score =  265 bits (677), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 134/285 (47%), Positives = 179/285 (62%), Gaps = 2/285 (0%)

Query: 22  IIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEM 81
           I+ VA ++K + ++   +  L GK LAMIFEK STRTRVSFE  M  LGG  +FLSG E 
Sbjct: 19  ILNVADQMKYNQKHGLTHNYLQGKTLAMIFEKNSTRTRVSFETGMFQLGGHALFLSGKES 78

Query: 82  QLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADI 141
           Q+GR E I DTA+VLSRY D I++RT     +  L +YA++PVIN LTD  HPCQ++AD+
Sbjct: 79  QIGRGEPIEDTARVLSRYCDGIMIRTFGQDEVETLAKYASIPVINGLTDFAHPCQVLADL 138

Query: 142 MTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARN- 200
           MT  EH+  ++G    + GDGNN+ +SLI G  +    +++A P G +P  + L++A+  
Sbjct: 139 MTIREHKARLEGLKMCFIGDGNNMANSLIVGGLKCGMDVSVACPEGYDPDRKVLDFAKTV 198

Query: 201 QGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREEHVFQPFQVNLSLMSMAHPDAL 259
            G+   L     +A   A  + TD W SM QE  KA  E  F  FQVN +LMS+AH   +
Sbjct: 199 TGSKFQLCRTPEEAAVDADVMITDVWASMGQEGEKAAREKAFAGFQVNDALMSLAHEGCM 258

Query: 260 FMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
             HCLPAHRGEE+  EV +     +FDEAENRLH QKA++    G
Sbjct: 259 VQHCLPAHRGEEITAEVFEAHADEIFDEAENRLHAQKAVMFLLMG 303


>gi|160934777|ref|ZP_02082163.1| hypothetical protein CLOLEP_03652 [Clostridium leptum DSM 753]
 gi|156866230|gb|EDO59602.1| hypothetical protein CLOLEP_03652 [Clostridium leptum DSM 753]
          Length = 303

 Score =  265 bits (677), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 131/296 (44%), Positives = 189/296 (63%), Gaps = 2/296 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH   L + SS  +   + +A ++K   ++  E+K L+GK L MIF+K STRTRVSFEV 
Sbjct: 2   KHLLKLLDWSSQEIMDTLNLADQLKYELKHGIEHKRLAGKTLGMIFQKSSTRTRVSFEVG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  +MQ+GR E + DTA+VLSRY++ I++RT   S +  L EY ++P+I
Sbjct: 62  MYQLGGMPIFLSAKDMQIGRGEPVQDTARVLSRYLNGIMIRTFEQSEVEALAEYGSIPII 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ++AD+MT  E +G ++G    + GDGNN+++SLI G  +    ++ A P
Sbjct: 122 NGLTDFCHPCQVLADLMTIREFKGKLEGLKMCFIGDGNNMMNSLIVGGLKTGMSVSAACP 181

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHVFQPF 244
            G +P    L++A+       L    ++A K A  + TD W SM QE +A + +  F  +
Sbjct: 182 EGYDPDPRVLDFAKEYDC-FELCRAPLEAAKDADVIITDVWASMGQEGEAEKRKKAFAGY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           Q+N  LM+ AH DA+  HCLPAHRGEE+  EV +   + +F+EAENRLH QKA+++
Sbjct: 241 QINEELMAAAHKDAMVQHCLPAHRGEEITAEVFEAHAAEIFEEAENRLHAQKAVMV 296


>gi|312795222|ref|YP_004028144.1| Ornithine carbamoyltransferase [Burkholderia rhizoxinica HKI 454]
 gi|312166997|emb|CBW74000.1| Ornithine carbamoyltransferase (EC 2.1.3.3) [Burkholderia
           rhizoxinica HKI 454]
          Length = 310

 Score =  265 bits (677), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 137/296 (46%), Positives = 186/296 (62%), Gaps = 5/296 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +H+    + S+ +   ++E A+ +K   +N     PL  + LAMIFEK STRTR+SFE  
Sbjct: 8   RHYLQFRDFSADDYDYVLERARILKQKFKNYETYHPLHDRTLAMIFEKNSTRTRLSFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  +F+S  + QLGR E I D A+V+SR VD I++RT     L    + + VPVI
Sbjct: 68  IFQLGGHAVFMSTRDTQLGRGEPIEDAAQVISRMVDIIMIRTFGQDILRRFAQNSRVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQ++AD+ TF EHRG ++GK  +W GD NN+ ++ IE A    + L ++TP
Sbjct: 128 NGLTNEYHPCQVLADVFTFHEHRGPIRGKTVAWVGDANNMAYTWIEAAHILGFKLRVSTP 187

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKAREEHVFQP 243
            G    +  ++ A    ASV    D   A +GAH V TD W SM   QE  AR+   F  
Sbjct: 188 PGYRLDHASIDPA--HLASVEETDDPRAACEGAHLVTTDVWTSMGFEQENDARKA-AFAD 244

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + V+  LM++A PDALFMHCLPAHRGEEV  +V+DG QSVV+DEAENRLH QKA++
Sbjct: 245 WCVDAELMALAQPDALFMHCLPAHRGEEVSADVIDGRQSVVWDEAENRLHVQKALM 300


>gi|120404285|ref|YP_954114.1| ornithine carbamoyltransferase [Mycobacterium vanbaalenii PYR-1]
 gi|119957103|gb|ABM14108.1| ornithine carbamoyltransferase [Mycobacterium vanbaalenii PYR-1]
          Length = 307

 Score =  265 bits (676), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 136/305 (44%), Positives = 190/305 (62%), Gaps = 10/305 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRVSFEV 64
           +HF    ++S    + ++ +A  +K   ++ F  +PL G + +A+IFEK STRTR SFE+
Sbjct: 3   RHFLRDDDLSPEEQAEVLALAADLK---KDRFSRRPLEGPRGVAVIFEKNSTRTRFSFEM 59

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG  + + G   QLGR ET+ DT +VLSRYVDAIV RT    RL  +   +TVP+
Sbjct: 60  GIAELGGHAVVVDGRSTQLGREETLEDTGQVLSRYVDAIVWRTFAQERLTAMASGSTVPI 119

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLNIA 183
           INAL+D  HPCQ++AD+ T  E +G +KG   ++ GDG NN+ HSL+ G       + IA
Sbjct: 120 INALSDEFHPCQVLADLQTLAERKGDLKGLRLTYFGDGANNMAHSLMLGGVTAGIHVTIA 179

Query: 184 TPIGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE- 238
            P G EP   ++  A  +    GA+V L  D V+A  G   + TDTW SM QE    +  
Sbjct: 180 APRGFEPHPMFVAAAETRAHRTGATVTLTDDPVRAADGVDVLVTDTWTSMGQENDGLDRV 239

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F+PFQVN  +++ A  +A+ +HCLPAHRG E+ ++V+DGPQS V+DEAENRLH QKA+
Sbjct: 240 RPFRPFQVNADMLAHADSEAVVLHCLPAHRGHEITDDVIDGPQSAVWDEAENRLHAQKAL 299

Query: 299 LLWCF 303
           L W  
Sbjct: 300 LAWLL 304


>gi|225850183|ref|YP_002730417.1| ornithine carbamoyltransferase [Persephonella marina EX-H1]
 gi|225645847|gb|ACO04033.1| ornithine carbamoyltransferase [Persephonella marina EX-H1]
          Length = 302

 Score =  265 bits (676), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 127/302 (42%), Positives = 190/302 (62%), Gaps = 7/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F ++S+++   +  IIE A K+K       +++ L GK + +IF KPSTRTR+SFEV 
Sbjct: 3   RDFLNISDLNRDEIFQIIEYAVKLKKGE---IKDQTLKGKSIGLIFMKPSTRTRLSFEVG 59

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  +GG  I++ GS  Q+ R E I DT +V+SRY+D IV+RT +HS + EL+ Y   PVI
Sbjct: 60  VYQMGGQPIYIQGSSTQMSRGEDIKDTGRVMSRYLDGIVIRTYSHSEVEELSRYFDKPVI 119

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD  HPCQI+AD+ T  E  G ++G   ++ GDGNN+ ++ +       + +++ATP
Sbjct: 120 NALTDYLHPCQILADLQTIYERLGKIEGIKVAFVGDGNNVANTWLIAGGLVGFNVSVATP 179

Query: 186 IGSEPRN----EYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
            G EP      E    +   GA + + +D V+AVK A  V+TD W+SM QE +  ++ +F
Sbjct: 180 EGYEPSGKAVYEAFKLSEKSGAEIQITNDPVEAVKEADVVYTDVWVSMGQEGEKEKKELF 239

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           + F VN  L+S A  + + MHCLPAH+GEE+  ++ +    V+FDEAENRLH QKA++  
Sbjct: 240 KGFTVNSDLLSHASKNVIVMHCLPAHKGEEITEDIFEKYSDVIFDEAENRLHAQKALMSL 299

Query: 302 CF 303
            F
Sbjct: 300 LF 301


>gi|224438405|ref|ZP_03659332.1| ornithine carbamoyltransferase [Helicobacter cinaedi CCUG 18818]
 gi|313144846|ref|ZP_07807039.1| ornithine carbamoyltransferase [Helicobacter cinaedi CCUG 18818]
 gi|313129877|gb|EFR47494.1| ornithine carbamoyltransferase [Helicobacter cinaedi CCUG 18818]
          Length = 328

 Score =  265 bits (676), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 137/309 (44%), Positives = 193/309 (62%), Gaps = 14/309 (4%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L++ S   +  +  +A K+K    N      L GK+LAMIFEK STRTRVSFE  
Sbjct: 2   RHFLTLNDFSKDEILAVTNLALKLKQELRNSNHTPYLKGKILAMIFEKSSTRTRVSFEGG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  +FLS  ++QLGR E I DT++V+S  VD ++MRT  H +L E  EY++VP+I
Sbjct: 62  IYQLGGHGMFLSHKDIQLGRGEPIKDTSRVISSMVDMVMMRTDRHEKLQEFAEYSSVPII 121

Query: 126 NALTDNTHPCQIIADIMTFEE---------HRGSVKGKLFSWSGDGNNILHSLIEGAARF 176
           N L+D+ HP Q++AD +T  E         H+  +K  + ++ GDGNN+ HS I  AA  
Sbjct: 122 NGLSDDFHPVQLMADYLTMLECGIALPDGIHKNGLKKPIVAYIGDGNNMAHSWINLAAIL 181

Query: 177 NYLLNIATPIGSEPRNEYLNWA----RNQGASVALFHDAVQAVKGAHCVFTDTWISMNQE 232
            + L +A+P+G  PR + +  A    +  G ++ +  +  +AV G + V TDTW SM QE
Sbjct: 182 GFELRVASPLGYFPRTDIIESALKTCKQSGGAIHIMQEPQKAVSGVNVVVTDTWASMGQE 241

Query: 233 FKARE-EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENR 291
            + +E E  F  F V+ SLM++A  DA+F+HCLPA+RG+EV   VL+G QS VF EA NR
Sbjct: 242 EQKKEREKAFVGFCVDDSLMNLAQEDAIFLHCLPAYRGQEVSESVLEGKQSRVFQEANNR 301

Query: 292 LHTQKAILL 300
           LH QKAI+L
Sbjct: 302 LHAQKAIML 310


>gi|296273196|ref|YP_003655827.1| ornithine carbamoyltransferase [Arcobacter nitrofigilis DSM 7299]
 gi|296097370|gb|ADG93320.1| ornithine carbamoyltransferase [Arcobacter nitrofigilis DSM 7299]
          Length = 308

 Score =  265 bits (676), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 138/305 (45%), Positives = 200/305 (65%), Gaps = 8/305 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  +++ S   L  I+++A +IK  ++     + L  +VL MIFEK STRTRVSFE  
Sbjct: 2   RHFLTIADFSKEELLEILDLAIQIKAETKQRNFKEYLPKQVLGMIFEKSSTRTRVSFETG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  +FLS +++QLGR E + DT++V+SR VD +++RT  HS+L E  +Y+ VPVI
Sbjct: 62  IYQLGGIGLFLSSNDIQLGRGEPMSDTSRVISRMVDMVMIRTFEHSKLEEFAQYSKVPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HP Q++AD +T  E  G  K  + ++ GDGNN+ HS +  AA+  + L IATP
Sbjct: 122 NGLTDDFHPVQLLADYLTIIEE-GKDKDLVAAYVGDGNNLAHSWLMLAAKLGFELRIATP 180

Query: 186 IGSEPRNEYLN----WARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV- 240
            G E   + L+    +A+  GA + + +D ++A+K A  V TDTW+SM QE   +E+ V 
Sbjct: 181 KGYEVNQKILDRALEFAKISGAKIVIGNDPIEAIKNATVVTTDTWVSMGQE-DEKEKRVK 239

Query: 241 -FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  + V+  LMS A+ +A+F+HCLPA+R  EV  EV +GPQS VF+EAENRLH QK I+
Sbjct: 240 DFTGYIVDTKLMSYANSNAIFLHCLPAYREYEVSEEVFEGPQSKVFEEAENRLHAQKGIM 299

Query: 300 LWCFG 304
           +W  G
Sbjct: 300 VWLDG 304


>gi|134094111|ref|YP_001099186.1| ornithine carbamoyltransferase [Herminiimonas arsenicoxydans]
 gi|226739201|sp|A4G3H2|OTC_HERAR RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|133738014|emb|CAL61059.1| ornithine carbamoyltransferase (OTCase) [Herminiimonas
           arsenicoxydans]
          Length = 304

 Score =  265 bits (676), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 139/295 (47%), Positives = 182/295 (61%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF   S+++      +IE  + IK   +N   + PL  + L M+FEK STRTR+SFE  
Sbjct: 4   KHFLQFSDLTLDEFEYVIERTRIIKRKFKNYEPHHPLVDRTLVMVFEKNSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  I L+  + QLGR E + D A+V+SR  D I++RT     +      + VPVI
Sbjct: 64  MHQLGGAAIHLATRDSQLGRGEPVEDAAQVMSRMCDIIMIRTFGQDIIERFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQ++AD+ TF EHRGS+KGK  +W GD NN+L+S ++ A  F++ +N++TP
Sbjct: 124 NGLTNEHHPCQVLADVFTFIEHRGSIKGKTVAWIGDANNMLYSWLQAAQVFDFHVNVSTP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN-QEFKAREEHVFQPF 244
            G E  +  L  A N      L+     A  GAH V TD W SM  +E  A     F  +
Sbjct: 184 KGYEI-DPTLVAADN--THYKLYAAPSDACAGAHLVTTDVWTSMGFEEENAARLKAFDGW 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            V+ + M  A PDALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA+L
Sbjct: 241 IVDAAKMKRAQPDALFMHCLPAHRGEEVAAEVIDGPQSVVWDEAENRLHAQKALL 295


>gi|257052572|ref|YP_003130405.1| ornithine carbamoyltransferase [Halorhabdus utahensis DSM 12940]
 gi|256691335|gb|ACV11672.1| ornithine carbamoyltransferase [Halorhabdus utahensis DSM 12940]
          Length = 297

 Score =  265 bits (676), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 135/298 (45%), Positives = 183/298 (61%), Gaps = 10/298 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           ++  D+ +++S  L+ +++ A  IK   E      PL  + LAMIFEKPSTRTRVSFE  
Sbjct: 3   RNVLDIDDLTSEELTTVLDRAATIKAGEEA---GNPLEDETLAMIFEKPSTRTRVSFETG 59

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFL   ++ LG +E + DTA+ +SRY DAI+ R  +H+   EL EYATVPVI
Sbjct: 60  MTQLGGHAIFLGPDDIHLGDSEPVKDTARAVSRYADAIMARLFDHADAEELAEYATVPVI 119

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ +AD++T  +  G       +W GDGNN+  SL+ GAA     L +ATP
Sbjct: 120 NGLTDDAHPCQTLADLLTIRQEFGGFDTVRVAWVGDGNNVAQSLVLGAAMVGLDLTVATP 179

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV--FQP 243
            G E   E L+ A   G +    HD   AV+ A  V+TD ++SM QE   REE +  F+ 
Sbjct: 180 EGYEIDEEVLDRAAELGTAPETTHDPEAAVEDADVVYTDVFVSMGQE-DEREEKLAAFEG 238

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           FQV   L+     D   MHCLPAHRGEEV +EV++   ++V+++AENRLH Q  +L+W
Sbjct: 239 FQVTTELLG----DRTLMHCLPAHRGEEVTDEVIESENAIVWEQAENRLHAQNGLLVW 292


>gi|297526595|ref|YP_003668619.1| ornithine carbamoyltransferase [Staphylothermus hellenicus DSM
           12710]
 gi|297255511|gb|ADI31720.1| ornithine carbamoyltransferase [Staphylothermus hellenicus DSM
           12710]
          Length = 314

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 142/299 (47%), Positives = 190/299 (63%), Gaps = 12/299 (4%)

Query: 11  LSNISSSNLSCIIEVAKKIKN---SSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMK 67
           L++ S   L  IIE AK++K    + E I     L+G+ LAMIFEKPSTRTR+SFE AM+
Sbjct: 13  LADYSREELLFIIETAKQLKQRYLAGERIIPL--LTGRHLAMIFEKPSTRTRISFETAMR 70

Query: 68  HLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINA 127
            LGGD ++L   E+QLGR ETI DTA+V+SRYVD I+ R   H +L +L  Y+ VPVIN 
Sbjct: 71  ELGGDALYLGWKELQLGRGETIEDTARVISRYVDGIMARVYEHEKLEKLARYSRVPVING 130

Query: 128 LTDNTHPCQIIADIMTFEEHRGSVKGKL-FSWSGD-GNNILHSLIEGAARFNYLLNIATP 185
           L+D  HP Q + DI T  E +GS   KL   + GD G+N+LHSL+ G       + I++P
Sbjct: 131 LSDLLHPAQALTDIYTIMEKKGSDLRKLKIVFVGDGGDNVLHSLMLGIGILGGKIIISSP 190

Query: 186 IGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREEHV 240
            G +P    +      A   G    +  D  +AV+ A  V+TD W+SM QE  K +    
Sbjct: 191 KGYDPNPRIIKLFEEKAVPNGGEYEIIRDPYEAVRDADVVYTDVWVSMGQEAEKEKRIKD 250

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            +P++V + LM  A PDA+FMHCLPAHRG+EV++EV+DG  S+V+D+AENR H QKAIL
Sbjct: 251 LEPYRVTVELMKQAKPDAVFMHCLPAHRGQEVVDEVIDGKWSIVWDQAENRKHVQKAIL 309


>gi|307596126|ref|YP_003902443.1| ornithine carbamoyltransferase [Vulcanisaeta distributa DSM 14429]
 gi|307551327|gb|ADN51392.1| ornithine carbamoyltransferase [Vulcanisaeta distributa DSM 14429]
          Length = 313

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 136/301 (45%), Positives = 196/301 (65%), Gaps = 7/301 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSS-ENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           + F  L + ++  +  ++ +++ +K+   +    +  L GK L MIFEKPSTRTRVS +V
Sbjct: 10  RDFITLMDYTTDEIKYLLGLSRDLKSRYYQGERYSDVLRGKTLLMIFEKPSTRTRVSLDV 69

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           A   LG   I+ +  E+QLGR ETI DTA+V+ R+VDAI  R   H  L+E+ +YA VPV
Sbjct: 70  AATQLGMHVIYSNPQELQLGRGETIADTARVVDRFVDAIAARVYKHESLIEMAKYAVVPV 129

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLNIA 183
           INAL+D  HP Q++AD +T  E +G + G   ++ GDG NN+ HSL+   A+  + + I 
Sbjct: 130 INALSDREHPLQVLADALTLWEVKGRLDGIKLAFVGDGDNNVAHSLMIIGAKLGWEVRII 189

Query: 184 TPIGSEPRN--EYLNW-ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EH 239
           +P    P    E L   +R  GA++ +  D ++ V+G   V+TD W+SM  E +A E + 
Sbjct: 190 SPKKYWPSKFAELLTEDSRRTGANIVI-SDNIEDVRGVDAVYTDVWVSMGMEAEAEERKK 248

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           VF+P+QVN  +M  A P A+FMHCLPAHRGEEV ++V+DGPQSVV+D+AENRLHT KA+L
Sbjct: 249 VFRPYQVNAEVMKKAGPQAVFMHCLPAHRGEEVTDDVIDGPQSVVWDQAENRLHTAKAVL 308

Query: 300 L 300
           +
Sbjct: 309 I 309


>gi|84488861|ref|YP_447093.1| ornithine carbamoyltransferase [Methanosphaera stadtmanae DSM 3091]
 gi|121697947|sp|Q2NI83|OTC_METST RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|84372180|gb|ABC56450.1| ArgF [Methanosphaera stadtmanae DSM 3091]
          Length = 302

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 126/294 (42%), Positives = 190/294 (64%), Gaps = 8/294 (2%)

Query: 15  SSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTI 74
           + + ++ I+E+A  +K+        KPL+ K + MIFEK STRTRVSFEV +  LGG  +
Sbjct: 10  AKNEVNAILEIASGLKSGE---ITEKPLTNKYIGMIFEKSSTRTRVSFEVGIHQLGGTPL 66

Query: 75  FLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHP 134
           +LS  ++QL R E I DTA+VLSR++D I++R   H  + EL +Y+T+P+I+ LTD  HP
Sbjct: 67  YLSSKDLQLNRGEPIEDTARVLSRFLDGIMIRAKKHENVEELVQYSTIPIISGLTDKEHP 126

Query: 135 CQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEY 194
           CQI AD++T +E++G    K   + GDGNN+ +SL+  AA     + +A P G EP  + 
Sbjct: 127 CQIFADLLTIKEYKGDFNDKKIVFIGDGNNVCNSLLLAAAYVGMDMTVACPEGYEPNEKI 186

Query: 195 LNWARNQG----ASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EHVFQPFQVNLS 249
              A+ +     +++ + ++  +AVK A  ++TD W+SM  E +  E E +F+P+Q+N  
Sbjct: 187 YTLAKQEAQKTNSTIKIENNVNEAVKDADVLYTDVWVSMGDEDEQDERERIFKPYQINNE 246

Query: 250 LMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           L+S A  DA+ MHCLPA RG+E+  +V+  PQS ++D+AENRLH QKAIL   F
Sbjct: 247 LLSQAKDDAIVMHCLPAIRGQEITADVMVSPQSAIWDQAENRLHAQKAILYHIF 300


>gi|159037508|ref|YP_001536761.1| ornithine carbamoyltransferase [Salinispora arenicola CNS-205]
 gi|157916343|gb|ABV97770.1| ornithine carbamoyltransferase [Salinispora arenicola CNS-205]
          Length = 323

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 131/306 (42%), Positives = 191/306 (62%), Gaps = 10/306 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRVSFEV 64
           +HF    ++S +  + ++E+A ++K    + F  +PL+G + +A++F+KPS RTR+SF+ 
Sbjct: 3   RHFLRDDDLSPAEQATVLELAARMK---ADRFGYQPLAGPRSVAVLFDKPSLRTRMSFDA 59

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG  + +      LGR ET+ D  +VLSRYV AIV+RT    R+ E+  +ATVPV
Sbjct: 60  GIAELGGHPLVVDSQVTHLGRGETLADVGRVLSRYVAAIVLRTHGDDRITEIAAHATVPV 119

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGD-GNNILHSLIEGAARFNYLLNIA 183
           +NALTD  HPCQ++AD++T  EH G   G+  ++ GD  NN+ HS +   A     + +A
Sbjct: 120 VNALTDTYHPCQLLADLLTIREHLGGTTGRTLAYVGDAANNVCHSYLLAGATAGMHVRVA 179

Query: 184 TPIGSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
            P G  P  + +      A   G SV +  D V AV+GA  V TDTW SM QE    +  
Sbjct: 180 GPAGFRPNPDVMARAEKIAAGTGGSVRVGDDPVVAVRGADVVATDTWTSMGQESDGLDRV 239

Query: 240 V-FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F+P+QVN +L++ A   A+ +HCLPAHRG+E+ +EVLDGP+S VFD+AENRLH QKA+
Sbjct: 240 TPFRPYQVNAALLTHAASHAIVLHCLPAHRGDEITDEVLDGPRSAVFDQAENRLHAQKAL 299

Query: 299 LLWCFG 304
           L +  G
Sbjct: 300 LTFLLG 305


>gi|94265424|ref|ZP_01289176.1| Ornithine carbamoyltransferase [delta proteobacterium MLMS-1]
 gi|93454081|gb|EAT04416.1| Ornithine carbamoyltransferase [delta proteobacterium MLMS-1]
          Length = 332

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 136/296 (45%), Positives = 191/296 (64%), Gaps = 2/296 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH   L++ S   L  +I+ A ++K  S+    ++ L G+ +A+IFEKPSTRTRVSFE A
Sbjct: 31  KHLLALADFSGEELRALIDRALQMKRESKAGGRHRALEGRSVALIFEKPSTRTRVSFEAA 90

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  I+LS  + QL R E + D A+V++RYVD +V+RT     + EL  Y+ VPVI
Sbjct: 91  MYGLGGQVIYLSSRDTQLARNEPLKDMARVMARYVDGLVVRTFGQEIVEELARYSAVPVI 150

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD  HPCQ+++D+MT  EH+G ++    +W GDGNN+ +S ++ AAR  + L +A P
Sbjct: 151 NALTDLHHPCQVLSDLMTVIEHQGELERLKIAWVGDGNNMANSWLQAAARLGFALTLACP 210

Query: 186 IGSEPRNEYLNWARNQGAS-VALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQP 243
            G EP  + L  AR   A  + L  D  +AV  A  V TD W SM QE +      +F+P
Sbjct: 211 EGYEPDADILAAARAAAARPINLVADPREAVADADVVNTDVWASMGQEDEQLHRLQIFRP 270

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           FQ+N  L++ A P A+ +HCLPAHR EE+   VL+GP+SVV+++AEN++H  KAIL
Sbjct: 271 FQINDELLAEAAPGAIVLHCLPAHRDEEISEAVLEGPRSVVWEQAENKMHIHKAIL 326


>gi|296164553|ref|ZP_06847124.1| ornithine carbamoyltransferase [Mycobacterium parascrofulaceum ATCC
           BAA-614]
 gi|295900153|gb|EFG79588.1| ornithine carbamoyltransferase [Mycobacterium parascrofulaceum ATCC
           BAA-614]
          Length = 309

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 144/306 (47%), Positives = 194/306 (63%), Gaps = 10/306 (3%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRVSFE 63
           P+HF    ++S +  + ++ +A  +K   ++ F  +PL G + +A++F+K STRTR SFE
Sbjct: 3   PRHFLRDDDLSPAEQAEVLRLAADLK---KDPFSCRPLEGPRGVAVLFDKNSTRTRFSFE 59

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V +  LGG  + +     QLGR ET+GDTA+VLSRYV+AIV RT    RL  + E ATVP
Sbjct: 60  VGIAQLGGHAVVVDARSTQLGRDETLGDTARVLSRYVEAIVWRTFGQDRLEAMAEAATVP 119

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLNI 182
           V+NAL+D  HPCQ++AD+ T  E +GS+ G   S+ GDG NN+ HSL+ G       + +
Sbjct: 120 VVNALSDEFHPCQVLADLQTIAERKGSLAGLRMSYFGDGANNMAHSLLVGGVTAGIHVTV 179

Query: 183 ATPIGSEP----RNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE 238
           A P G  P           A   G SV L  DA  A KGA  + TDTW SM QE   R+ 
Sbjct: 180 AAPEGFAPDPACTAAARERAEATGGSVTLTADADAAAKGADVLVTDTWTSMGQEGDGRDR 239

Query: 239 HV-FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
              F+PFQVN  L+ +A P+A+ +HCLPAHRGEE+ +EV+DGP SVV+DEAENRLH QKA
Sbjct: 240 LTPFRPFQVNQRLLGLADPEAIVLHCLPAHRGEEITDEVMDGPASVVWDEAENRLHAQKA 299

Query: 298 ILLWCF 303
           +L+W  
Sbjct: 300 LLVWLL 305


>gi|288561371|ref|YP_003424857.1| ornithine carbamoyltransferase ArgF [Methanobrevibacter ruminantium
           M1]
 gi|288544081|gb|ADC47965.1| ornithine carbamoyltransferase ArgF [Methanobrevibacter ruminantium
           M1]
          Length = 304

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 129/270 (47%), Positives = 177/270 (65%), Gaps = 6/270 (2%)

Query: 37  FENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVL 96
            E KPL  + LAMIF+K STRTRVSFEV M  LGG  +FLS +++QLGR E I DTAKVL
Sbjct: 29  IEEKPLKDQKLAMIFQKSSTRTRVSFEVGMYELGGTALFLSTNDIQLGRGEPIKDTAKVL 88

Query: 97  SRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLF 156
           SR+VD I++R   H  ++EL   + VP+IN LT+  HPCQ +AD++T +EH+G   GK F
Sbjct: 89  SRFVDVIMIRAIEHDDVIELERESDVPIINGLTNLEHPCQALADMLTVKEHKGGFDGK-F 147

Query: 157 SWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLN----WARNQGASVALFHDAV 212
            + GDGNN+ +SL+         + IA P    P  E       +A+   +++ +  D  
Sbjct: 148 VYVGDGNNVCNSLLLICGCLGMDMAIACPDEYRPNEEITKKAKEYAKANNSTITITSDIE 207

Query: 213 QAVKGAHCVFTDTWISMNQEFKAREEHV-FQPFQVNLSLMSMAHPDALFMHCLPAHRGEE 271
           +AV GA  ++TD W+SM  E ++ +    F+ +QVN +L+ MA  D +FMHCLPA RGEE
Sbjct: 208 EAVSGADVIYTDVWVSMGDEEESEKRRADFKDYQVNQNLIDMADDDVIFMHCLPAIRGEE 267

Query: 272 VINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           V  EV+DGP SVV+D+AENR+H QKA+L +
Sbjct: 268 VSAEVIDGPHSVVYDQAENRMHAQKAVLYY 297


>gi|256832347|ref|YP_003161074.1| ornithine carbamoyltransferase [Jonesia denitrificans DSM 20603]
 gi|256685878|gb|ACV08771.1| ornithine carbamoyltransferase [Jonesia denitrificans DSM 20603]
          Length = 310

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 140/306 (45%), Positives = 196/306 (64%), Gaps = 13/306 (4%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRVSFEV 64
           +HF   ++++    + ++ +A    N + N   ++P +G + +A+IF+KPSTRTRVSF V
Sbjct: 3   RHFLADADLNPQEQADVLNLAL---NFATNRHLHQPFAGPQGVAIIFDKPSTRTRVSFSV 59

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG  + +  S  Q+GR E I DTA+VL+R V AIV RT + + L E+  ++ VPV
Sbjct: 60  GVAELGGYPLIIDSSGSQMGRGEPISDTAQVLTRQVSAIVWRTFSQAGLEEMAHHSRVPV 119

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVK---GKLFSWSGDG-NNILHSLIEGAARFNYLL 180
           INALTD+ HPCQI+AD+MT  +HRG V+   G+  ++ GDG NN+ HS + G A     +
Sbjct: 120 INALTDDYHPCQILADLMTVAQHRGGVEALPGQTLTYLGDGANNMAHSYLLGGATAGMHV 179

Query: 181 NIATPIGSEPR----NEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR 236
            IA P    PR     + ++ A   G SV +  D  QA +GA  + TDTW+SM  E  A 
Sbjct: 180 RIAAPEEFHPRPKIVAQAIHVAARTGGSVTITTDVAQAAQGADVIATDTWVSMGDEESAH 239

Query: 237 -EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
                F P+QVN  LM++A PDA+ +HCLPA+RG+E+  EV+DGPQSVVFDEAENRLH Q
Sbjct: 240 IRSRPFLPYQVNAELMALAAPDAIVLHCLPAYRGKEITAEVIDGPQSVVFDEAENRLHAQ 299

Query: 296 KAILLW 301
           KA+L W
Sbjct: 300 KALLTW 305


>gi|94968846|ref|YP_590894.1| ornithine carbamoyltransferase [Candidatus Koribacter versatilis
           Ellin345]
 gi|94550896|gb|ABF40820.1| ornithine carbamoyltransferase [Candidatus Koribacter versatilis
           Ellin345]
          Length = 323

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 130/302 (43%), Positives = 192/302 (63%), Gaps = 7/302 (2%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
           +   F  + + +   +  ++++A  IK   +    ++ L GK +A+IFEKPS RTRVSF+
Sbjct: 2   FASDFLSIRDFTPQQIRHLLDLAMHIKAMPQAY--SRSLRGKTMALIFEKPSLRTRVSFD 59

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V ++ LGG +++LS +E+ LG+ E + D AK L R V  I++RT  H  + ++  +A++P
Sbjct: 60  VGIQQLGGFSVYLSPAEINLGKREGVYDVAKNLERMVQGIMIRTFAHRIVEDMAAFASIP 119

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           +IN LTD +HPCQ +AD MT  E +G + G   ++ GDGNN+ HSL+   A+    + +A
Sbjct: 120 IINGLTDYSHPCQAMADYMTIFEAKGRLSGLKLAYVGDGNNVAHSLMFAGAQLGVHVWVA 179

Query: 184 TPIGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EE 238
           TP G EP +    WA  +    G S  + +D V AV+ A  ++TD W SM QE +A   +
Sbjct: 180 TPDGYEPDHAAREWATRRAAETGGSCTITNDPVAAVEDADVIYTDVWASMGQESEAALRK 239

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
            +F P+QVN  L + A PD +FMHCLPAHRG+EV +EV+D P+S VF EAENRLH QKAI
Sbjct: 240 KIFLPYQVNGKLFAQAKPDTIFMHCLPAHRGDEVTDEVIDSPRSFVFPEAENRLHAQKAI 299

Query: 299 LL 300
           +L
Sbjct: 300 ML 301


>gi|126652705|ref|ZP_01724866.1| ornithine carbamoyltransferase [Bacillus sp. B14905]
 gi|126590554|gb|EAZ84672.1| ornithine carbamoyltransferase [Bacillus sp. B14905]
          Length = 337

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 134/299 (44%), Positives = 192/299 (64%), Gaps = 5/299 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L + +S  ++ +IE+A ++K  ++     + L GK L MIFEK STRTR+SFEV 
Sbjct: 34  KDLLTLLDYTSQEVAELIELATQLKMITKEGKCPRLLEGKTLGMIFEKHSTRTRISFEVG 93

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG ++F+   ++Q+GR E+I DTA VLS Y+D I++R  +H+ + EL E+AT+PVI
Sbjct: 94  MNQLGGKSMFMHARDLQIGRGESIYDTAHVLSGYLDGIMIRANSHAMVRELAEHATIPVI 153

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ +AD+ T  E++G +KG   ++ GDGNN+ HSLI  +A     + +ATP
Sbjct: 154 NGLTDIYHPCQALADLETIAENKGFLKGLKIAYVGDGNNVAHSLIVASAHVGMNVAVATP 213

Query: 186 IGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HV 240
            G E   E        A   G+++ + HD V+AV  A  V+ D W SM QE +A +    
Sbjct: 214 AGYECDAEVIAKAQAIAAANGSTILVTHDPVEAVLNADVVYADVWTSMGQEEEAAKRLQD 273

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           F  +Q+N  L++ A P+ +F+HCLPAHR EEV   V+DGP S +F++AENRLH QKA+L
Sbjct: 274 FADYQINDELVAYAKPNYMFLHCLPAHREEEVATSVIDGPNSYIFEQAENRLHAQKAVL 332


>gi|167750885|ref|ZP_02423012.1| hypothetical protein EUBSIR_01869 [Eubacterium siraeum DSM 15702]
 gi|167656064|gb|EDS00194.1| hypothetical protein EUBSIR_01869 [Eubacterium siraeum DSM 15702]
          Length = 303

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 128/300 (42%), Positives = 189/300 (63%), Gaps = 2/300 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH   + ++S+  +  I+ +A ++K   ++   +  L GK L MIF K STRTRVSFE  
Sbjct: 2   KHLLKMMDLSTEEIIEILNLADQLKYELKHGIPHDHLKGKTLGMIFRKASTRTRVSFETG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG+ ++LS S+MQ+GR E I DTA+VLSRY+D I++RT + + +  L EY  +P+I
Sbjct: 62  MYQLGGNPLYLSASDMQIGRGEPIQDTARVLSRYIDGIMIRTFDQAEVENLAEYGNIPII 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD +HPCQ++AD+MT  E++G + G    + GDGNN+ +SLI G  +    +++A P
Sbjct: 122 NGLTDLSHPCQVLADLMTIREYKGKLDGLKMCYIGDGNNMANSLIVGGLKTGMSVSVACP 181

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQPF 244
               P    L +A+       L  D ++A K A  +FTD W SM QE +A   +  F+ F
Sbjct: 182 ENYHPAATTLAFAKKYDC-FELTDDPIKAAKDADVIFTDVWASMGQEGEAEIRKKAFKGF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           Q+N  +M++A PDA+  HCLPAHR EE+  +V +   + +FDEAENRLH QKA+++   G
Sbjct: 241 QINDEVMAVAKPDAMVQHCLPAHREEEITAKVFEEHANEIFDEAENRLHAQKAVMVLLMG 300


>gi|152979907|ref|YP_001352538.1| ornithine carbamoyltransferase [Janthinobacterium sp. Marseille]
 gi|151279984|gb|ABR88394.1| ornithine carbamoyltransferase [Janthinobacterium sp. Marseille]
          Length = 304

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 135/295 (45%), Positives = 179/295 (60%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF   S+++      +IE  + IK   +N     PLS + L M+FEK STRTR+SFE  
Sbjct: 4   KHFLQFSDLTLDEFEHVIERTRVIKRKFKNYEPYHPLSDRTLVMVFEKNSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  I+L+  + QLGR E + D A+V+SR  D I++RT     +      + VPVI
Sbjct: 64  MHQLGGAAIYLNTRDSQLGRGEPVEDAAQVMSRMCDIIMIRTFGQEIIERFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQ++AD+ T+ E RGS+KGK  +W GD NN+L+S ++ A  F++ +N++TP
Sbjct: 124 NGLTNEHHPCQVLADVFTYIEQRGSIKGKTVAWIGDANNMLYSWLQAAQVFDFHVNVSTP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN-QEFKAREEHVFQPF 244
            G E     +           L+     A  GAH V TD W SM  +E  A     F  +
Sbjct: 184 KGYEIDPTLVA---QDNTHYTLYASPSDACAGAHLVTTDVWTSMGFEEENAARLKAFDGW 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            V+ + M  A PDALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA+L
Sbjct: 241 IVDAAKMKRAQPDALFMHCLPAHRGEEVAAEVIDGPQSVVWDEAENRLHVQKALL 295


>gi|94971185|ref|YP_593233.1| ornithine carbamoyltransferase [Candidatus Koribacter versatilis
           Ellin345]
 gi|94553235|gb|ABF43159.1| ornithine carbamoyltransferase [Candidatus Koribacter versatilis
           Ellin345]
          Length = 338

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 133/307 (43%), Positives = 189/307 (61%), Gaps = 7/307 (2%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           T  +    +++ +   ++  +++A  +K    +      L+GK + M FEKPS RTR++F
Sbjct: 20  TNDRDLVSITDFTPEEITSALDLASAMKVHPADF--RGALAGKQVVMFFEKPSLRTRITF 77

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E  +  LGG + F+     +LG  E + D A  L R+VD IV+RT  H     + E++++
Sbjct: 78  ESGISSLGGVSFFVDQGASRLGAREPLSDIAHNLERWVDGIVLRTFAHDTCSVMAEHSSI 137

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVINAL+D+ HPCQ +AD++T +EH GS++    ++ GDGNN+ HSL+   A     L +
Sbjct: 138 PVINALSDHEHPCQALADVLTLKEHFGSLRKLKVAFVGDGNNVAHSLMLACASVGANLTV 197

Query: 183 ATPIGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE- 237
            TP G EP  + L      A++ GA++ +  DAV AV GA  ++TD W SM QE +A E 
Sbjct: 198 GTPKGYEPSVQVLKQAQKIAKSTGATIDVTTDAVAAVTGAQAIYTDVWASMGQESEAAER 257

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
           + +F PFQVN  LMS A   A FMHCLPAHRG+EV  +V+D P SVVFD+AENRLH QKA
Sbjct: 258 QQIFLPFQVNAKLMSQAAKKAKFMHCLPAHRGDEVTADVIDSPSSVVFDQAENRLHAQKA 317

Query: 298 ILLWCFG 304
           ILL   G
Sbjct: 318 ILLMLLG 324


>gi|145224110|ref|YP_001134788.1| ornithine carbamoyltransferase [Mycobacterium gilvum PYR-GCK]
 gi|315444446|ref|YP_004077325.1| ornithine carbamoyltransferase [Mycobacterium sp. Spyr1]
 gi|189036334|sp|A4T9W6|OTC_MYCGI RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|145216596|gb|ABP46000.1| ornithine carbamoyltransferase [Mycobacterium gilvum PYR-GCK]
 gi|315262749|gb|ADT99490.1| ornithine carbamoyltransferase [Mycobacterium sp. Spyr1]
          Length = 307

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 134/287 (46%), Positives = 181/287 (63%), Gaps = 7/287 (2%)

Query: 24  EVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQ 82
           EV        ++ F  +PL G + +A+IFEK STRTR SFE+ +  LGG  + + G   Q
Sbjct: 18  EVLALAAALKKDPFSRRPLEGPRGVAVIFEKNSTRTRFSFEMGIAQLGGHAVVVDGRSTQ 77

Query: 83  LGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIM 142
           LGR ET+ DT  VLSRYVDAIV RT    RL  +   A+VP++NAL+D  HPCQ++AD+ 
Sbjct: 78  LGREETLEDTGAVLSRYVDAIVWRTFAQERLTAMASGASVPIVNALSDEFHPCQVLADLQ 137

Query: 143 TFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQ 201
           T  E +GS+KG   ++ GDG NN+ HSL+ G       + IA P G EP   ++  A  +
Sbjct: 138 TLIERKGSLKGLRLAYFGDGANNMAHSLMLGGVTAGVDVTIAAPRGFEPHPMFIAAAETR 197

Query: 202 ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQPFQVNLSLMSMAHP 256
               GA+VA+  D ++A  GA  + TDTW SM QE    +    F+PFQVN  L+  A  
Sbjct: 198 AHQTGATVAVIDDPLRAADGADVLVTDTWTSMGQENDGLDRVRPFRPFQVNADLLGRADS 257

Query: 257 DALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +A+ +HCLPAHRG E+ +EV+DGP+S V+DEAENRLH QKA+L+W  
Sbjct: 258 EAVVLHCLPAHRGHEITDEVIDGPRSAVWDEAENRLHAQKALLVWLL 304


>gi|268323765|emb|CBH37353.1| putative ornithin carbamoyltransferase [uncultured archaeon]
          Length = 300

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 188/295 (63%), Gaps = 1/295 (0%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAM 66
           +F  + ++S + +  +IE    +K   +       L GK LA++FEKPSTRTRVSFEVAM
Sbjct: 2   NFISIFDLSRAEIEALIEKGAALKREPKGARTRDDLRGKTLALLFEKPSTRTRVSFEVAM 61

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
             LGG+ + L+ +E+QLGR E I +TAKVLS YVDA+++R   H  + E   YA++PVIN
Sbjct: 62  LELGGNVVSLNRNELQLGRGERIKETAKVLSSYVDAVMIRAYRHDTVAEFAHYASIPVIN 121

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI 186
            LTD  HPCQI+AD+MT +E++  + G   +W GDGNN+ +SLI GAA     +++A P 
Sbjct: 122 GLTDFEHPCQILADLMTIKEYKDRLAGVKIAWIGDGNNVCNSLIGGAAIMGMDMSVACPK 181

Query: 187 GSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EHVFQPFQ 245
           G EP  E +  A+  G  V +     +A   A  ++TD W+SM  E ++ + ++  + +Q
Sbjct: 182 GYEPAKELVAKAKKLGCDVVITEKVEEAADDADVLYTDVWVSMGDEDESEQIKNDLKIYQ 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           +N +L+ +A  D + MHC+P H GEE+   V++   SV+F +AENRLH QKA++L
Sbjct: 242 INENLVRVAKADVIIMHCMPVHIGEEITAGVMNSTNSVIFAQAENRLHAQKALVL 296


>gi|20904484|gb|AAM29841.1| Ornithine carbamoyltransferase [Methanosarcina mazei Go1]
          Length = 320

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 129/299 (43%), Positives = 184/299 (61%), Gaps = 1/299 (0%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           T  +    ++++S   +  ++E A  +K   +     + L  K L MIFEK STRTRVSF
Sbjct: 18  TMKRDVLSITDLSREEIYELLESAADLKKKRKAGEPTEYLKHKSLGMIFEKSSTRTRVSF 77

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           EVAM   GG  ++L+  ++Q+GR ETI DTA+ LS Y+  I+ R  +H  + +L  ++T+
Sbjct: 78  EVAMSDFGGHALYLNSRDIQVGRGETIEDTARTLSGYLHGIMARVMSHDTVEKLARFSTI 137

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVINAL+D  HPCQI+ D MT  E++   +G  F+W GDGNN+ +S + G+A       I
Sbjct: 138 PVINALSDREHPCQILGDFMTIMEYKNRFEGLKFAWIGDGNNVCNSALLGSAIMGMEFVI 197

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVF 241
           A P G EP  E+L  A+  G   ++  D   A K A  ++TD W+SM  E +  +    F
Sbjct: 198 ACPEGYEPGAEFLEKAKALGGKFSITDDPKTAAKDADIIYTDVWVSMGDEAEQEKRLKDF 257

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
             FQVN  L+ +A PD + MHCLPA RG E+ +EV+DGP SV+F+EAENRLH QKA++L
Sbjct: 258 GSFQVNTELLGVAKPDVIVMHCLPARRGLEITDEVMDGPNSVIFEEAENRLHAQKALIL 316


>gi|315503273|ref|YP_004082160.1| ornithine carbamoyltransferase [Micromonospora sp. L5]
 gi|315409892|gb|ADU08009.1| ornithine carbamoyltransferase [Micromonospora sp. L5]
          Length = 308

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 131/305 (42%), Positives = 190/305 (62%), Gaps = 10/305 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRVSFEV 64
           +HF    +++ +  + ++++A ++K    + + ++PL+G K +A++F+K S RTR+SF+V
Sbjct: 3   RHFLRDDDLTPAEQAAVLDLAARMK---ADRYAHQPLTGPKSVAVLFDKQSLRTRISFDV 59

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG  + +       GR ET+ D  +VLSRYV AIV+RT    R+ E+ E+ATVPV
Sbjct: 60  GIAELGGHPLVVDTQVTHFGRGETLADAGRVLSRYVAAIVLRTHGDDRIAEVAEHATVPV 119

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGD-GNNILHSLIEGAARFNYLLNIA 183
           +NALTD  HPCQ++AD++T  E  G   G++ ++ GD  NN+ HS +         + IA
Sbjct: 120 VNALTDTYHPCQLLADLLTVRERFGGTAGRIVTYVGDAANNMAHSYLLAGTTAGMHVRIA 179

Query: 184 TPIGSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
            P G +P  E +      A   G SV LF D V+AV+GAH V TDTW SM QE    +  
Sbjct: 180 GPDGFQPDPEIVARAEKIAATTGGSVQLFTDPVEAVRGAHVVATDTWTSMGQEDDGLDRI 239

Query: 240 V-FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F P+QVN +L+  A  D + +HCLPAHRGEE+ +E LDGP S VFD+AENRLH QKA+
Sbjct: 240 TPFLPYQVNAALLGHADADVIVLHCLPAHRGEEITDEALDGPHSAVFDQAENRLHAQKAL 299

Query: 299 LLWCF 303
           L +  
Sbjct: 300 LTFLL 304


>gi|170693517|ref|ZP_02884676.1| ornithine carbamoyltransferase [Burkholderia graminis C4D1M]
 gi|170141672|gb|EDT09841.1| ornithine carbamoyltransferase [Burkholderia graminis C4D1M]
          Length = 309

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 136/296 (45%), Positives = 184/296 (62%), Gaps = 5/296 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +H+    + S  +   ++E A+ +K   +N     PL  + LAMIFEK STRTR+SFE  
Sbjct: 7   RHYLQFKDFSLDDYEYVLERARILKRKFKNYETYHPLHDRTLAMIFEKNSTRTRLSFEAG 66

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  +F+S  + QLGR E I D A+V+SR VD I++RT     +    E + VPVI
Sbjct: 67  IFQLGGHAVFMSTRDTQLGRGEPIEDAAQVISRMVDIIMIRTFGQDIIQRFAENSRVPVI 126

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQ++ADI T+ EHRG ++GK  +W GD NN+L++ IE A    + L ++TP
Sbjct: 127 NGLTNEYHPCQVLADIFTYFEHRGPIRGKTVAWVGDANNMLYTWIEAAQILGFKLRLSTP 186

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKAREEHVFQP 243
            G +    ++  A         F D  +A  GA  V TD W SM    E +AR++  F  
Sbjct: 187 PGYKLDRGFV--AAESAPFYEEFDDPNEACAGADLVTTDVWTSMGFEAENEARKK-AFAD 243

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + V+  +MS AH DALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA++
Sbjct: 244 WCVDAEMMSRAHADALFMHCLPAHRGEEVSAEVIDGPQSVVWDEAENRLHVQKALM 299


>gi|149194232|ref|ZP_01871329.1| Ornithine carbamoyltransferase [Caminibacter mediatlanticus TB-2]
 gi|149135407|gb|EDM23886.1| Ornithine carbamoyltransferase [Caminibacter mediatlanticus TB-2]
          Length = 313

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 135/307 (43%), Positives = 195/307 (63%), Gaps = 11/307 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L + +   +  II++A +IK  ++N      L    LAMIFEK STRTRVSFEV 
Sbjct: 2   RHFLSLIDYTKEEIKEIIDLAFQIKKETKNRIFKPYLKNYQLAMIFEKSSTRTRVSFEVG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG+ IFLS  ++QLGR E I DTA+V+SR VD I++RT    RL E  +Y+ VPVI
Sbjct: 62  INQLGGNGIFLSSRDIQLGRGEPIKDTARVISRMVDMIMIRTFGQERLEEFAKYSKVPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHR----GSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           N LTD  HP Q++AD+MT  E++     + +  +  + GDGNN+ +S +  A++  + L 
Sbjct: 122 NGLTDKCHPVQLLADLMTMIEYKKFDFDNPQKTVVVYIGDGNNMANSWVILASKLGFNLR 181

Query: 182 IATPIGSE----PRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE 237
           +ATP G E     + + L +A+  GA +   +D  +A+K A  V TDTW+SM QE   +E
Sbjct: 182 VATPKGYEIDEDIKQKALEFAKQSGAKIEFLYDVKEAIKNADVVTTDTWVSMGQE-DEKE 240

Query: 238 EHV--FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
           + +  F+ F+VN  LM++A  DA+F+HCLPA+RG EV  EV +   + +FDEAENRLH Q
Sbjct: 241 KRISDFKGFEVNSELMNLAKKDAIFLHCLPAYRGYEVSEEVFEKHSNEIFDEAENRLHAQ 300

Query: 296 KAILLWC 302
           K +++W 
Sbjct: 301 KGLMVWL 307


>gi|88705573|ref|ZP_01103283.1| Ornithine carbamoyltransferase [Congregibacter litoralis KT71]
 gi|88700086|gb|EAQ97195.1| Ornithine carbamoyltransferase [Congregibacter litoralis KT71]
          Length = 310

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 140/295 (47%), Positives = 192/295 (65%), Gaps = 4/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L + S   L  +I+ A  +K +      +    G V+AMIF K STRTRVSFE  
Sbjct: 4   QHFLTLLDFSPEELDALIDRAIALKAAHRAGKPSPQFPGSVMAMIFAKSSTRTRVSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  +GG  +FLS  + QLGR E I D+A+V+S  VD +++RT  H  +    E ++VPVI
Sbjct: 64  MAQMGGHAMFLSPGDTQLGRGEPIEDSARVISSMVDIVMIRTFGHDIVERFAENSSVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+ HPCQ++AD+ T+ EHRG+++GK   W GDGNN+ HS I  A +F++ L IA P
Sbjct: 124 NALTDDYHPCQLLADMQTYREHRGAIRGKTVCWLGDGNNMCHSYINAARQFDFHLRIACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQ-EFKAREEHVFQPF 244
            G EP  + L   R+    VAL+HDA  AV GA  + TD W SM Q E +AR      PF
Sbjct: 184 EGFEPDAQLL---RDNSDRVALYHDAGSAVDGASLLVTDVWASMGQEEEQARRAAAMAPF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           Q+N +L++ A PDAL++HCLPAHRGEE+  E++D   +V+++EAENRLH QKA++
Sbjct: 241 QLNAALLAAAAPDALYLHCLPAHRGEEISAELMDAGDTVIWEEAENRLHAQKALV 295


>gi|91785023|ref|YP_560229.1| ornithine carbamoyltransferase [Burkholderia xenovorans LB400]
 gi|91688977|gb|ABE32177.1| ornithine carbamoyltransferase [Burkholderia xenovorans LB400]
          Length = 309

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 136/296 (45%), Positives = 185/296 (62%), Gaps = 5/296 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +H+    + S  +   ++E A+ +K   +N     PL  + LAMIFEK STRTR+SFE  
Sbjct: 7   RHYLQFKDFSLEDYEYVLERARILKRKFKNYETYHPLHDRTLAMIFEKNSTRTRLSFEAG 66

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  +F+S  + QLGR E I D A+V+SR VD I++RT     L   +E + VPVI
Sbjct: 67  IFQLGGHAVFMSTRDTQLGRGEPIEDAAQVISRMVDIIMIRTFGQDILQRFSENSRVPVI 126

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQ++ADI T+ EHRG ++GK  +W GD NN+L++ IE A    + L ++TP
Sbjct: 127 NGLTNEYHPCQVLADIFTYFEHRGPIRGKTVAWVGDANNMLYTWIEAAQILGFKLRLSTP 186

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKAREEHVFQP 243
            G +     +  A         F D  +A  GA  V TD W SM    E +AR++  F  
Sbjct: 187 PGYKLDRAVV--AAESAPFYEEFDDPNEACAGADLVTTDVWTSMGFEAENEARKK-AFAD 243

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + V+  +M+ A+PDALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA++
Sbjct: 244 WCVDADMMARANPDALFMHCLPAHRGEEVSAEVIDGPQSVVWDEAENRLHVQKALM 299


>gi|332711668|ref|ZP_08431599.1| ornithine carbamoyltransferase [Lyngbya majuscula 3L]
 gi|332349646|gb|EGJ29255.1| ornithine carbamoyltransferase [Lyngbya majuscula 3L]
          Length = 306

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 131/304 (43%), Positives = 191/304 (62%), Gaps = 9/304 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F   +++S+S++  +++ A K+K    N     P   KVL ++F K STRTRVSF VA
Sbjct: 7   RDFLGFTDLSASDIQELLDKATKLKKGQWN-----PRCNKVLGLLFYKASTRTRVSFSVA 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  I L+ +  Q+GR E + DTA+VL RY+D + +RT    +L    EYA +P+I
Sbjct: 62  MYQLGGQVIDLNPNVTQVGRGEPVVDTARVLDRYLDILAIRTFEQKQLETFAEYAKIPII 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD  HPCQI+AD++T +E  G++ G   ++ GDGNN+ HSL+ G A     + +ATP
Sbjct: 122 NALTDWEHPCQILADLLTIQECFGTLAGLTLTYVGDGNNVAHSLMLGCALMGMNVRVATP 181

Query: 186 IGSEPRNEYLNWARNQGAS---VALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVF 241
              +P +     A    AS   V + +D + A K +  ++TD W SM QE  A E   +F
Sbjct: 182 PAYQPDSAICELALKTAASRTEVMVTNDPIAAAKESQVIYTDVWASMGQEASAEERIPIF 241

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           +P+QVN  L+  A P A+ +HCLPAHRGEE+ N+V++G +S V+D+AENRLH QKA+L+ 
Sbjct: 242 EPYQVNQQLLDHADPSAIVLHCLPAHRGEEITNQVIEGSRSRVWDQAENRLHAQKALLVS 301

Query: 302 CFGI 305
             G+
Sbjct: 302 LLGV 305


>gi|153005545|ref|YP_001379870.1| ornithine carbamoyltransferase [Anaeromyxobacter sp. Fw109-5]
 gi|152029118|gb|ABS26886.1| ornithine carbamoyltransferase [Anaeromyxobacter sp. Fw109-5]
          Length = 309

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 139/299 (46%), Positives = 189/299 (63%), Gaps = 10/299 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F  L+++  S L  ++E A + K   +     +PL    + ++FEK STRTRVSF VA
Sbjct: 9   RDFLRLTDLDRSELLELLERAAEWKLLGKR--GPRPLEHSTIGLVFEKASTRTRVSFTVA 66

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
              LG DT+ LS  + QLGR E I DTA+VLSRY+D +V+RT  HS+L E+  +A+VPV+
Sbjct: 67  AHQLGADTLMLSPRDTQLGRGEPIRDTARVLSRYLDCLVVRTFEHSKLEEMARFASVPVV 126

Query: 126 NALTDNTHPCQIIADIMTFEEHRGS---VKGKL-FSWSGDGNNILHSLIEGAARFNYLLN 181
           NALTD++HPCQ++AD++T  E  G+    KG L  +W GDGNN+ +S +E      + L 
Sbjct: 127 NALTDSSHPCQLLADLLTVTERFGADVLAKGGLSVAWIGDGNNMANSWLEACVLLGFDLR 186

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EHV 240
           +A P G +P  + L     +G  V       +A  GAH V TD W SM QE +A E +  
Sbjct: 187 LACPEGYDPDPQLLARTGGRGRVV---RSPAEAAAGAHVVNTDVWASMGQEQEAEERKRK 243

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           F  + V+ +LM  A PDA+ +HCLPAHRGEE+   VL+GPQS VFDEAENRLH QKA+L
Sbjct: 244 FAGYIVDEALMRAARPDAIVLHCLPAHRGEEISESVLEGPQSAVFDEAENRLHAQKALL 302


>gi|253996738|ref|YP_003048802.1| ornithine carbamoyltransferase [Methylotenera mobilis JLW8]
 gi|253983417|gb|ACT48275.1| ornithine carbamoyltransferase [Methylotenera mobilis JLW8]
          Length = 305

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 134/295 (45%), Positives = 184/295 (62%), Gaps = 3/295 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF   ++++   L  + E  + IK+  ++  +  PL  + L MIFEK STRTR+SFE  
Sbjct: 5   KHFLQFNDLNRDELEYVFERTRWIKSQFKDYQQYWPLQDRTLVMIFEKASTRTRLSFEAG 64

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG  I+L+  + QLGR E + D A+V+SR  D +++RT     +      + VPVI
Sbjct: 65  MQQLGGSAIYLNTRDSQLGRGEPVEDAAQVISRMSDLVMIRTFEQEIIERFAANSRVPVI 124

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI T+ EHRGS+KGK  +W GD NN+ H+ ++ A   ++ ++++TP
Sbjct: 125 NGLTNEYHPCQILADIFTYIEHRGSIKGKTVAWIGDSNNMCHTWLQAAELLDFNVHVSTP 184

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQPF 244
            G E   E  N        V  F D + A +GA  V TD W SM  E +  E    F  +
Sbjct: 185 PGYEVEPERANLYGTDHFEV--FADPMDAARGADLVTTDVWTSMGFEAENEERMRDFADW 242

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           QV+  +M +A  DALFMHCLPAHRGEEV  EV+DG QSVV+DEAENRLHTQKA++
Sbjct: 243 QVDSDMMRVAAKDALFMHCLPAHRGEEVSAEVIDGMQSVVWDEAENRLHTQKALM 297


>gi|152990110|ref|YP_001355832.1| ornithine carbamoyltransferase [Nitratiruptor sp. SB155-2]
 gi|189036335|sp|A6Q1W6|OTC_NITSB RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|151421971|dbj|BAF69475.1| ornithine carbamoyltransferase [Nitratiruptor sp. SB155-2]
          Length = 309

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 135/302 (44%), Positives = 193/302 (63%), Gaps = 8/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L + +   +  +IE+A+ IK  ++       +  K LAMIFEK STRTRVSFEV 
Sbjct: 2   RHFLTLKDFTKEEILEMIELARSIKAQTKRREFVPYMENKTLAMIFEKSSTRTRVSFEVG 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  +FLS +++QLGR E + DTA+V+SR  D +++RT   S+L E   ++ VPVI
Sbjct: 62  IYQLGGIGLFLSKNDIQLGRGEPMKDTARVVSRICDMVMIRTYEQSKLEEFAAFSQVPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HP Q++AD +T  E+ G     + ++ GDGNN+ HS +  A++  + L IATP
Sbjct: 122 NGLTNEYHPVQLMADYLTMIEY-GKADSPVVAYVGDGNNMTHSWLMLASKLGFTLRIATP 180

Query: 186 IGSEPR----NEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV- 240
            G EP      + + +A+  GA++ L HD   AV+ A  V TDTWISM QE + +E+ + 
Sbjct: 181 KGYEPDPNIVEDAMRFAKESGATIELMHDPKAAVQDADVVTTDTWISMGQE-EEKEKRIK 239

Query: 241 -FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ FQV+  LMS+A  DA+F+HCLPA+RG EV  EV +     +FDEAENRLH QK I+
Sbjct: 240 DFKGFQVDTILMSLAKKDAIFLHCLPAYRGYEVSEEVFEAHAEEIFDEAENRLHAQKGIM 299

Query: 300 LW 301
           +W
Sbjct: 300 VW 301


>gi|16