PSIBLAST alignment of GI: 255764473 and protein with PDB id: 1fb5

gi|34810173|pdb|1FB5|A Chain A, Low Resolution Structure Of Ovine Ornithine Transcarbmoylase In The Unliganded State Length = 320
 Score =  184 bits (466), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 119/306 (38%), Positives = 171/306 (55%), Gaps = 7/306 (2%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIK-NSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
             +    L N +   +  ++ ++  +K    +       L GK L MIFEK STRTR+S 
Sbjct: 4   KGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQKGEYLPLLQGKSLGMIFEKRSTRTRLST 63

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E     LGG   FL+  ++ LG  E++ DTA+VLS   DA++ R    S L  L + A++
Sbjct: 64  ETGFALLGGHPCFLTTQDIHLGVNESLTDTARVLSSMADAVLARVYKQSDLETLAKEASI 123

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVIN L+D  HP QI+AD +T +EH  S+KG   SW GDGNNILHS++  AA+F   L  
Sbjct: 124 PVINGLSDLYHPIQILADYLTLQEHYSSLKGLTLSWIGDGNNILHSIMMSAAKFGMHLQA 183

Query: 183 ATPIGSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE 238
           ATP G EP          +A+  G  + L +D ++A  G + + TDTWISM +E + ++ 
Sbjct: 184 ATPKGYEPDASVTKLAEQYAKENGTKLLLTNDPLEAAHGGNVLITDTWISMGREEEKKKR 243

Query: 239 HV-FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
              FQ +QVN     +A     F+HCLP  + EEV ++V   P+S+VF EAENR  T  A
Sbjct: 244 LQAFQGYQVNSKTAKVAASAWTFLHCLP-RKPEEVDDDVFYSPRSLVFPEAENRKWTIMA 302

Query: 298 ILLWCF 303
           +++   
Sbjct: 303 VMVSLL 308