PSIBLAST alignment of GI: 255764473 and protein with PDB id: 2at2

>gi|494729|pdb|2AT2|A Chain A, Molecular Structure Of Bacillus Subtilis Aspartate Transcarbamoylase At 3.0 Angstroms Resolution Length = 300
>gi|494730|pdb|2AT2|B Chain B, Molecular Structure Of Bacillus Subtilis Aspartate Transcarbamoylase At 3.0 Angstroms Resolution Length = 300
 Score =  182 bits (461), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 63/299 (21%), Positives = 127/299 (42%), Gaps = 18/299 (6%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH   +S +S+  +  +++ A+++K    +   +  L+GK  A +F +PSTRTR SFEV
Sbjct: 1   MKHLTTMSELSTEEIKDLLQTAQELK----SGKTDNQLTGKFAANLFFEPSTRTRFSFEV 56

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRY--VDAIVMRTTNHSRLLELTEYATV 122
           A K LG + + L G+   + + ET+ DT + L        ++  + +      +++    
Sbjct: 57  AEKKLGMNVLNLDGTSTSVQKGETLYDTIRTLESIGVDVCVIRHSEDEYYEELVSQVNIP 116

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGD--GNNILHSLIEGAARFNYLL 180
            +        HP Q + D+MT  E   + KG   S  GD   + +  S  E   R    +
Sbjct: 117 ILNAGDGCGQHPTQSLLDLMTIYEEFNTFKGLTVSIHGDIKHSRVARSNAEVLTRLGARV 176

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
             + P   +              +   +    +AV+ +  V      +   +    +E  
Sbjct: 177 LFSGPSEWQDEE----------NTFGTYVSMDEAVESSDVVMLLRIQNERHQSAVSQEGY 226

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
              + + +         A+ MH  P +RG E+ + +++  +S +F + +N +  + A++
Sbjct: 227 LNKYGLTVERAERMKRHAIIMHPAPVNRGVEIDDSLVESEKSRIFKQMKNGVFIRMAVI 285