PSIBLAST alignment of GI: 255764473 and protein with PDB id: 2atc

>gi|640095|pdb|2ATC|A Chain A, Crystal And Molecular Structures Of Native And Ctp-Liganded Aspartate Carbamoyltransferase From Escherichia Coli Length = 305
 Score =  158 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 66/307 (21%), Positives = 120/307 (39%), Gaps = 25/307 (8%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAM 66
           H   ++++S  +L+ ++  A K+K + +     + L  KV+A  F + STRTR+SF+ +M
Sbjct: 8   HIISINDLSRDDLNLVLATAAKLKANPQ----PELLKHKVIASCFFEASTRTRLSFQTSM 63

Query: 67  KH--LGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY--ATV 122
                       S +     + +T+ +T  V+S YVDAIVMR          TE+     
Sbjct: 64  HRLGASVVGFSDSANTSLGKKGQTLANTISVISTYVDAIVMRHPQEGAARLATEFSGNVP 123

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNY---L 179
            +      N HP Q + D+ T ++  G +     +  GD            A   +    
Sbjct: 124 VLNAGDGSNQHPTQTLLDLFTIQQTEGRLNNLHVAMVGDLKYGRTVHSLTQALAKFDGNR 183

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
                P         L+    +G + +L     + +         T +   +   +    
Sbjct: 184 FYFIAPDALAMPEYILDMLDEKGIAWSLHSSIEEVM---------TRVQKERLDPSEYAX 234

Query: 240 VFQPFQVNLS---LMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
           V   F V  +    +  A  +A  +H LP  R +E+  +V   P +  F +A N +  ++
Sbjct: 235 VKAQFLVRANSLGGLHNAKMNAKVLHPLP--RVDEIATDVDKTPHAWYFQQAGNGIFARQ 292

Query: 297 AILLWCF 303
           A+L    
Sbjct: 293 ALLALVL 299