PSIBLAST alignment of GI: 255764473 and protein with PDB id: 2fg6

>gi|109157615|pdb|2FG6|X Chain X, N-Succinyl-L-Ornithine Transcarbamylase From B. Fragilis Complexed With Sulfate And N-Succinyl-L-Norvaline Length = 338
>gi|109157616|pdb|2FG6|Y Chain Y, N-Succinyl-L-Ornithine Transcarbamylase From B. Fragilis Complexed With Sulfate And N-Succinyl-L-Norvaline Length = 338
 Score =  103 bits (256), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 65/312 (20%), Positives = 124/312 (39%), Gaps = 31/312 (9%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           ++ K F  + +I   +L     +A+  +   +     +    K L MIF   S RTR+S 
Sbjct: 19  SHMKKFTCVQDIG--DLKS--ALAESFEIKKDRFKYVELGRNKTLLMIFFNSSLRTRLST 74

Query: 63  EVA------------MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMR---- 106
           + A            +           G  M   + E + +   V+  Y D I +R    
Sbjct: 75  QKAALNLGMNVIVLDINQGAWKLETERGVIMDGDKPEHLLEAIPVMGCYCDIIGVRSFAR 134

Query: 107 ------TTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKL-FSWS 159
                   N   + +  +++  PV +      HP Q  AD++T EE++ + + K+  +W+
Sbjct: 135 FENREYDYNEVIINQFIQHSGRPVFSMEAATRHPLQSFADLITIEEYKKTARPKVVMTWA 194

Query: 160 GDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAH 219
                +  ++    A     +N           E          +  + +D ++A +GA 
Sbjct: 195 PHPRPLPQAVPNSFAE---WMNATDYEFVITHPEGYELDPKFVGNARVEYDQMKAFEGAD 251

Query: 220 CVFTDTWISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDG 279
            ++   W +   +   +     + + V    M++ + +A FMHCLP  R   V ++V++ 
Sbjct: 252 FIYAKNWAAYLGDNYGQILSTDRNWTVGDRQMAVTN-NAYFMHCLPVRRNMIVTDDVIES 310

Query: 280 PQSVVFDEAENR 291
           PQS+V  EA NR
Sbjct: 311 PQSIVIPEAANR 322