PSIBLAST alignment of GI: 255764473 and protein with PDB id: 3kzc

>gi|292659720|pdb|3KZC|A Chain A, Crystal Structure Of N-Acetyl-L-Ornithine Transcarbamylase Length = 359
>gi|292659721|pdb|3KZK|A Chain A, Crystal Structure Of Acetylornithine Transcarbamylase Complexed With Acetylcitrulline Length = 359
 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 83/341 (24%), Positives = 133/341 (39%), Gaps = 44/341 (12%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M+  KHF +  + S + L  ++  A   K +         L GK +A++F  PS RTR S
Sbjct: 21  MSL-KHFLNTQDWSRAELDALLTQAALFKRNKLGSE----LKGKSIALVFFNPSMRTRTS 75

Query: 62  FEVAMKHLG------------GDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTN 109
           FE+    LG                F  G+ M     E I + A+VL RYVD I +R   
Sbjct: 76  FELGAFQLGGHAVVLQPGKDAWPIEFNLGTVMDGDTEEHIAEVARVLGRYVDLIGVRAFP 135

Query: 110 HS---------RLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVK----GKLF 156
                      ++L+     +   +  +   THPCQ +A  +  +EH G+        + 
Sbjct: 136 KFVDWSKDREDQVLKSFAKYSPVPVINMETITHPCQELAHALALQEHFGTPDLRGKKYVL 195

Query: 157 SWSGDGNN----ILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAV 212
           +W+         + +S +  A R    + +  P      +E       Q  + +     V
Sbjct: 196 TWTYHPKPLNTAVANSALTIATRMGMDVTLLCPTPDYILDERYMDWAAQNVAESGGSLQV 255

Query: 213 QAVKGAHC---------VFTDTWISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHC 263
                +            +       N E +      +Q F V+   M++ + + +F HC
Sbjct: 256 SHDIDSAYAGADVVYAKSWGALPFFGNWEPEKPIRDQYQHFIVDERKMALTN-NGVFSHC 314

Query: 264 LPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           LP  R     + V+D P  +  DEAENRLH QKAI+    G
Sbjct: 315 LPLRRNVXATDAVMDSPNCIAIDEAENRLHVQKAIMAALVG 355