PSIBLAST alignment of GI: 255764473 and protein with PDB id: 3lxm

>gi|291191348|pdb|3LXM|A Chain A, 2.00 Angstrom Resolution Crystal Structure Of A Catalytic Subunit Of An Aspartate Carbamoyltransferase (Pyrb) From Yersinia Pestis Co92 Length = 335
>gi|291191349|pdb|3LXM|B Chain B, 2.00 Angstrom Resolution Crystal Structure Of A Catalytic Subunit Of An Aspartate Carbamoyltransferase (Pyrb) From Yersinia Pestis Co92 Length = 335
 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 68/307 (22%), Positives = 119/307 (38%), Gaps = 14/307 (4%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
           Y KH   ++++S   L  ++  A  +K + +     + L  KV+A  F + STRTR+SFE
Sbjct: 30  YHKHIISINDLSRDELELVLRTAASLKKTPQ----PELLKHKVIASCFFEASTRTRLSFE 85

Query: 64  VAMKH--LGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY-- 119
            ++            S +     + ET+ DT  V+S YVDAIVMR           ++  
Sbjct: 86  TSIHRLGASVVGFSDSSNTSLGKKGETLADTMSVISTYVDAIVMRHPQEGASRLAAQFSG 145

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNY- 178
               V      N HP Q + D+ T +E +G +     +  GD            A   + 
Sbjct: 146 NVPIVNAGDGANQHPTQTLLDLFTIQETQGRLDNINIAMVGDLKYGRTVHSLTQALAKFN 205

Query: 179 --LLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR 236
                   P         L     +    +L     + V     ++  T +   +   + 
Sbjct: 206 GNHFFFIAPDALAMPAYILQMLEEKEIEYSLHESLEEVVPELDILYM-TRVQKERLDPSE 264

Query: 237 EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
             +V   F +  S ++ A  +   +H LP  R +E+  +V   P +  F +A N +  ++
Sbjct: 265 YANVKAQFILRSSDLTGARDNLKVLHPLP--RIDEITTDVDKTPYAYYFQQAGNGIFARQ 322

Query: 297 AILLWCF 303
           A+L    
Sbjct: 323 ALLALVL 329