PSIBLAST alignment of GI: 255764473 and protein with PDB id: 9atc

>gi|5822587|pdb|9ATC|A Chain A, Atcase Y165f Mutant Length = 310
 Score =  173 bits (439), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 71/307 (23%), Positives = 125/307 (40%), Gaps = 14/307 (4%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
           Y KH   ++++S  +L+ ++  A K+K + +     + L  KV+A  F + STRTR+SFE
Sbjct: 5   YQKHIISINDLSRDDLNLVLATAAKLKANPQ----PELLKHKVIASCFFEASTRTRLSFE 60

Query: 64  VAMKH--LGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY-- 119
            +M            S +     + ET+ DT  V+S YVDAIVMR          TE+  
Sbjct: 61  TSMHRLGASVVGFSDSANTSLGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFSG 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNY- 178
               +      N HP Q + D+ T +E +G +     +  GD            A   + 
Sbjct: 121 NVPVLNAGDGSNQHPTQTLLDLFTIQETQGRLDNLHVAMVGDLKFGRTVHSLTQALAKFD 180

Query: 179 --LLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR 236
                   P         L+    +G + +L     + +     ++  T +   +   + 
Sbjct: 181 GNRFYFIAPDALAMPQYILDMLDEKGIAWSLHSSIEEVMAEVDILYM-TRVQKERLDPSE 239

Query: 237 EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
             +V   F +  S +  A  +   +H LP  R +E+  +V   P +  F +A N +  ++
Sbjct: 240 YANVKAQFVLRASDLHNAKANMKVLHPLP--RVDEIATDVDKTPHAWYFQQAGNGIFARQ 297

Query: 297 AILLWCF 303
           A+L    
Sbjct: 298 ALLALVL 304