BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|255764473|ref|YP_003064846.2| ornithine carbamoyltransferase
[Candidatus Liberibacter asiaticus str. psy62]
         (306 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|255764473|ref|YP_003064846.2| ornithine carbamoyltransferase [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254547824|gb|ACT56906.2| ornithine carbamoyltransferase [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 306

 Score =  260 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 306/306 (100%), Positives = 306/306 (100%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV
Sbjct: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA
Sbjct: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL
Sbjct: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
           NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV
Sbjct: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL
Sbjct: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300

Query: 301 WCFGII 306
           WCFGII
Sbjct: 301 WCFGII 306


>gi|323135686|ref|ZP_08070769.1| ornithine carbamoyltransferase [Methylocystis sp. ATCC 49242]
 gi|322398777|gb|EFY01296.1| ornithine carbamoyltransferase [Methylocystis sp. ATCC 49242]
          Length = 314

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 162/304 (53%), Positives = 211/304 (69%), Gaps = 2/304 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFEN--KPLSGKVLAMIFEKPSTRTR 59
           MT P+HF D+ + S   L  I+++AK +K       E   +PL+GK L MIF+KPSTRTR
Sbjct: 6   MTRPRHFLDICDHSGEELRRILDLAKSLKAKRVKGVEPTGRPLAGKYLGMIFDKPSTRTR 65

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+VAM+ LGG+TI L+G+EMQ+GR ETI DTA+VLSR++DAI++R  +H  L EL  +
Sbjct: 66  VSFDVAMRDLGGETIMLTGNEMQIGRGETIADTARVLSRFLDAIMIRILSHEDLTELARH 125

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ATVPVIN LT  +HPCQI+AD++TFEEH G + G+  +W GD NN+L S +  AARF + 
Sbjct: 126 ATVPVINGLTKLSHPCQIMADVLTFEEHCGPISGRTVAWIGDANNVLASWVHAAARFGFA 185

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           +N+ATP    P  E ++WA+  G ++ +  D   AV G   V TD W+SM    +     
Sbjct: 186 INVATPAELSPAAELVDWAKANGVAMNVTRDPYAAVAGTDAVITDCWVSMGDRDEDFRRK 245

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           V  P+QV+  LM  A  DA+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK +L
Sbjct: 246 VLAPYQVDAKLMRAADKDAVFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKGVL 305

Query: 300 LWCF 303
            WC 
Sbjct: 306 AWCL 309


>gi|182677152|ref|YP_001831298.1| ornithine carbamoyltransferase [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182633035|gb|ACB93809.1| ornithine carbamoyltransferase [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 319

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 173/304 (56%), Positives = 225/304 (74%), Gaps = 3/304 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFE--NKPLSGKVLAMIFEKPSTRTRVSF 62
           PKHF DLS + + +L  I+++A  +K       +   +PL GKVLAM+F++PSTRTRVSF
Sbjct: 13  PKHFLDLSRLEAKDLRAILDLAAGLKAKRRRGQKAKEQPLEGKVLAMVFDQPSTRTRVSF 72

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           ++AM+ LGG+TI L+G EMQLGR ETI DTA+VLSR+VDAIV+R  NH+ LLEL EYA V
Sbjct: 73  DLAMRELGGETIMLTGQEMQLGRGETIADTARVLSRFVDAIVIRILNHADLLELAEYAEV 132

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVIN LT  +HPCQI+AD++TFEEHRG +KG+  +W+GD NN+L S IE A R ++ LN+
Sbjct: 133 PVINGLTKLSHPCQIMADLLTFEEHRGPIKGRTIAWTGDSNNVLASWIEAARRLDFTLNV 192

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREEHVF 241
           A P    P  E + +A  QG  + +  D  +AV+GA  V +D W+SM ++E +AR + + 
Sbjct: 193 ACPAELSPAPELVAFANAQGKRLNVLRDPFEAVRGADAVISDCWVSMGDEEEEARRQALL 252

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
            P+QVN  LM+ A  DA+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK IL W
Sbjct: 253 SPYQVNAELMATAAKDAIFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKGILAW 312

Query: 302 CFGI 305
           CFG+
Sbjct: 313 CFGV 316


>gi|315122119|ref|YP_004062608.1| ornithine carbamoyltransferase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495521|gb|ADR52120.1| ornithine carbamoyltransferase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 305

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 263/304 (86%), Positives = 280/304 (92%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MTY KHF DLS +SSSNLS I+EVAKK KN   N  E KPLSGKVLAMIFEKPSTRTRVS
Sbjct: 1   MTYTKHFLDLSKVSSSNLSLIMEVAKKRKNPLANDLEEKPLSGKVLAMIFEKPSTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FEVAMK+LGG+TIFLSGSEMQLGRAETIGDTA+VLSRYVDAIVMRTTNHSRLLEL E+AT
Sbjct: 61  FEVAMKNLGGETIFLSGSEMQLGRAETIGDTARVLSRYVDAIVMRTTNHSRLLELAEHAT 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVINALTDNTHPCQIIAD+MTFEE R SVKGKLFSWSGDGNNIL+SLIEGA RF+Y LN
Sbjct: 121 VPVINALTDNTHPCQIIADVMTFEEVRESVKGKLFSWSGDGNNILNSLIEGAVRFDYRLN 180

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           IATPIGSEP+ EYLNWARNQGASV LFHDAV+AVK +HCVFTDTW SMNQEF+AREE+VF
Sbjct: 181 IATPIGSEPQGEYLNWARNQGASVVLFHDAVKAVKDSHCVFTDTWTSMNQEFRAREEYVF 240

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           +PFQVN  LMSMAHPDALFMHCLPAHRG+EV NEVLDGPQSVVFDEAENRLHTQKAILLW
Sbjct: 241 EPFQVNSKLMSMAHPDALFMHCLPAHRGKEVTNEVLDGPQSVVFDEAENRLHTQKAILLW 300

Query: 302 CFGI 305
           CF +
Sbjct: 301 CFDL 304


>gi|83591107|ref|YP_431116.1| ornithine carbamoyltransferase [Moorella thermoacetica ATCC 39073]
 gi|83574021|gb|ABC20573.1| ornithine carbamoyltransferase [Moorella thermoacetica ATCC 39073]
          Length = 314

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 142/306 (46%), Positives = 199/306 (65%), Gaps = 5/306 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             + F  L + S   +  ++++A  +K   +    +  L+GK L MIF K STRTRVSFE
Sbjct: 9   KGRDFLSLKDFSREEIFYLLDLADDLKAKLKKREPHPLLAGKTLGMIFTKRSTRTRVSFE 68

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M  LGG  +FL+  ++QLGR ETI DTA+VLSRY+D I++RT +H  + EL EYA++P
Sbjct: 69  VGMYQLGGYPLFLTKDDLQLGRGETIADTARVLSRYLDGIMIRTYSHREVEELAEYASIP 128

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HP Q +ADIMT  E +G ++G   ++ GDGNN+ HSL+ G A+    + IA
Sbjct: 129 VINGLTDFLHPTQALADIMTIREWKGKLQGLNLTFIGDGNNVAHSLMYGGAKVGLNVTIA 188

Query: 184 TPIGSEPRNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
            P G EP  + +  AR      G  +A+ ++  +A +GA  ++TD W SM QE +A +  
Sbjct: 189 CPSGYEPMPQVVEEARRIAAGNGCQIAVTNNIKEAAEGADILYTDVWASMGQEDEAEKRR 248

Query: 240 V-FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F+ +Q+N  L+ +A PDA+ +HCLPAHRGEE+ +EV+DGPQS VFDEAENRLH  KAI
Sbjct: 249 QAFRKYQINSELLKLAKPDAMVLHCLPAHRGEEITDEVMDGPQSAVFDEAENRLHAHKAI 308

Query: 299 LLWCFG 304
           ++   G
Sbjct: 309 MVALMG 314


>gi|39937830|ref|NP_950106.1| ornithine carbamoyltransferase [Rhodopseudomonas palustris CGA009]
 gi|56404377|sp|Q6N0J0|OTC_RHOPA RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|39651690|emb|CAE30212.1| ornithine carbamoyltransferase [Rhodopseudomonas palustris CGA009]
          Length = 310

 Score =  247 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 172/309 (55%), Positives = 222/309 (71%), Gaps = 3/309 (0%)

Query: 1   MMT--YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFE-NKPLSGKVLAMIFEKPSTR 57
           MM+   P+HF DL+ + +S L  ++  A  +K   +   +  KPL+GK LAMIF+KPSTR
Sbjct: 1   MMSNNMPRHFLDLTELPTSELRNMLSAAVAMKAKRKANADGEKPLAGKTLAMIFDKPSTR 60

Query: 58  TRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELT 117
           TRVSF+V M+ LGG++I L+G+EMQLGR ETI DTA+VLSR+VD I++R  NH  LLEL 
Sbjct: 61  TRVSFDVGMRQLGGESIMLTGAEMQLGRGETIADTARVLSRFVDIIMIRILNHEALLELA 120

Query: 118 EYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFN 177
             ATVPVIN LT  +HPCQ++AD+MTFEEHRG +KG+  +W+GD NN+L S    A RF 
Sbjct: 121 ANATVPVINGLTRKSHPCQVMADVMTFEEHRGPIKGRTIAWTGDDNNVLASFAHAAQRFE 180

Query: 178 YLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE 237
           + LNIATP    P     +W +  GA++ +  D  +AV+GA CV TDTW+SM  +     
Sbjct: 181 FKLNIATPPQLSPSKALRDWIKASGAAITIGTDPEEAVRGADCVVTDTWVSMGDKDGEHR 240

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
            ++ +P+QVN  LMS+AH DA+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK 
Sbjct: 241 HNLLKPYQVNAKLMSLAHKDAIFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKG 300

Query: 298 ILLWCFGII 306
           IL WC G +
Sbjct: 301 ILAWCLGAV 309


>gi|15887776|ref|NP_353457.1| ornithine carbamoyltransferase [Agrobacterium tumefaciens str. C58]
 gi|32699460|sp|Q8UI70|OTC_AGRT5 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|15155348|gb|AAK86242.1| ornithine carbamoyltransferase [Agrobacterium tumefaciens str. C58]
          Length = 305

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 207/305 (67%), Positives = 255/305 (83%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M  PKHF DLS +   +L  I++ A+  K +++     KPL+GK+LAMIFEKPSTRTRVS
Sbjct: 1   MASPKHFLDLSAVGPQDLRTILDDARARKVATKAGTAEKPLAGKMLAMIFEKPSTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V M+ LGG+T+FLSG+EMQLGRAETIGDTAKVLSRYVDAI++RTT+HSRLLEL E+AT
Sbjct: 61  FDVGMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTDHSRLLELAEHAT 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD+THPCQI+ADIMTFEEHRG VKGK  +W+GDGNN+LHS +EG+ARF Y + 
Sbjct: 121 VPVINGLTDDTHPCQIMADIMTFEEHRGPVKGKTIAWTGDGNNVLHSFVEGSARFGYRMT 180

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +A P+GSEP ++++NWARN G  +AL+HDA +AV GA CV TDTW+SMNQE KAR  ++F
Sbjct: 181 MAVPMGSEPHDKFMNWARNNGGEIALYHDADKAVAGADCVVTDTWVSMNQEHKARGHNIF 240

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+QVN +LM+ A  DALFMHCLPAHRGEEV + V+DGPQSVVFDEAENRLH QK+++ W
Sbjct: 241 QPYQVNEALMAKAQKDALFMHCLPAHRGEEVTDAVIDGPQSVVFDEAENRLHAQKSVIAW 300

Query: 302 CFGII 306
           C G+I
Sbjct: 301 CMGVI 305


>gi|158425651|ref|YP_001526943.1| ornithine carbamoyltransferase [Azorhizobium caulinodans ORS 571]
 gi|158332540|dbj|BAF90025.1| ornithine carbamoyltransferase [Azorhizobium caulinodans ORS 571]
          Length = 309

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 163/298 (54%), Positives = 225/298 (75%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF DL+++ + +L  ++E++K++K   +   E KPL+GK LAM+F+KPSTRTRVSF++A
Sbjct: 7   RHFLDLTDLEAVDLRGVLELSKQLKAKRKAGTEEKPLAGKSLAMVFDKPSTRTRVSFDLA 66

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+G+EMQLGR E+I DTA+VLSR+VDAI++R  +H  LLEL ++ATVPVI
Sbjct: 67  MRQLGGETIMLTGAEMQLGRGESIADTARVLSRFVDAIMIRILSHEDLLELAKFATVPVI 126

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT  +HPCQ++AD++TFEEH+GS++G+  +W+GD NN+L S +  AA+F++ +N+ATP
Sbjct: 127 NGLTRVSHPCQVMADVLTFEEHKGSIEGRSVAWTGDANNVLASWVHAAAQFDFTINVATP 186

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
               PR     + +   A V    D  +AV+G  CV TDTW+SM  +   R  ++ +P+Q
Sbjct: 187 KELSPRQALKEFVKRTQAKVRFMRDPEEAVEGVDCVITDTWVSMGDKEAERRHNLLKPYQ 246

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN  LM+ A PDA+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK IL WC 
Sbjct: 247 VNAKLMARAAPDAIFMHCLPAHRGEEVTDEVMDGPQSVVFDEAENRLHAQKGILAWCL 304


>gi|209883806|ref|YP_002287663.1| ornithine carbamoyltransferase [Oligotropha carboxidovorans OM5]
 gi|209872002|gb|ACI91798.1| ornithine carbamoyltransferase [Oligotropha carboxidovorans OM5]
          Length = 311

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 162/304 (53%), Positives = 216/304 (71%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           T  +HF DLS + + +L  I++ +  +K + +    ++PL  K LAMIFE+PSTRTRVSF
Sbjct: 7   TKLRHFLDLSELPTEDLRAILDASLAMKKNLKAGHPDRPLKDKTLAMIFERPSTRTRVSF 66

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           EV M+ LGG+ I L+G EMQLGR ET  DTA+VLSR+VD I++R  +H  L E+ E+ATV
Sbjct: 67  EVGMRQLGGEAIMLTGQEMQLGRGETFADTARVLSRFVDIIMIRILSHDALTEMVEHATV 126

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVIN LT  +HP Q++AD+MTFEEHRG +KG+  +W+GD NN+L S +  A RF + L +
Sbjct: 127 PVINGLTRRSHPTQVMADVMTFEEHRGPIKGRTIAWTGDDNNVLASWMHAAERFAFTLRV 186

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQ 242
           ATP    P+    +W +   AS+ L  D V+AV+ A CV TDTW+SM  +   +  ++ +
Sbjct: 187 ATPPELAPKKALKDWIKATQASIVLGTDPVEAVRNADCVITDTWMSMGDKDAEQRHNLLK 246

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           P+QVN  LMS+A PDA+FMHCLPAHRGEEV ++V+DGPQSVVFDEAENRLH  K IL WC
Sbjct: 247 PYQVNEKLMSLAKPDAIFMHCLPAHRGEEVTDDVIDGPQSVVFDEAENRLHAHKGILAWC 306

Query: 303 FGII 306
            G +
Sbjct: 307 LGAV 310


>gi|316936253|ref|YP_004111235.1| ornithine carbamoyltransferase [Rhodopseudomonas palustris DX-1]
 gi|315603967|gb|ADU46502.1| ornithine carbamoyltransferase [Rhodopseudomonas palustris DX-1]
          Length = 311

 Score =  245 bits (626), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 171/304 (56%), Positives = 220/304 (72%), Gaps = 1/304 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFE-NKPLSGKVLAMIFEKPSTRTRVSF 62
            P+HF DL+ + +S L  ++  A  +K   +   E +KPL+GK LAMIF+KPSTRTRVSF
Sbjct: 7   TPRHFLDLTELPTSELRSMLAAAVAMKAKRKANAEADKPLAGKTLAMIFDKPSTRTRVSF 66

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           +V M+ LGG++I L+G EMQLGR ETI DTA+VLSR+VD I++R  NH  LLEL   ATV
Sbjct: 67  DVGMRQLGGESIMLTGQEMQLGRGETIADTARVLSRFVDIIMIRILNHEALLELAANATV 126

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVIN LT  +HPCQ++AD+MTFEEHRG +KG+  +W+GD NN+L S    AA F++ LN+
Sbjct: 127 PVINGLTRKSHPCQVMADVMTFEEHRGPIKGRTIAWTGDDNNVLASFAHAAACFDFKLNV 186

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQ 242
           ATP    P     +W +  GA++ +  D  QAV+GA CV TDTW+SM  +      ++ +
Sbjct: 187 ATPPQLAPNKALRDWIKASGAAITIGTDPEQAVRGADCVVTDTWVSMGDKDGEHRHNLLK 246

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           P+QVN  LMS+AH DA+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK IL WC
Sbjct: 247 PYQVNAKLMSLAHKDAIFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKGILAWC 306

Query: 303 FGII 306
            G +
Sbjct: 307 LGAV 310


>gi|304392361|ref|ZP_07374302.1| ornithine carbamoyltransferase [Ahrensia sp. R2A130]
 gi|303295465|gb|EFL89824.1| ornithine carbamoyltransferase [Ahrensia sp. R2A130]
          Length = 305

 Score =  245 bits (626), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 181/301 (60%), Positives = 225/301 (74%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             KHF DL+ +    L  I++ A  +K +++     +PL GKVLAMIF+KPSTRTRVSF+
Sbjct: 1   MAKHFLDLAAVDGGELRSILDGAVAMKTATKQGASPRPLEGKVLAMIFDKPSTRTRVSFD 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M+ LGG+TI L G+  QLGR ET+ DTA+VLSRYVDAI++RTT+H RLLEL ++ATVP
Sbjct: 61  VGMRQLGGETIILDGASSQLGRGETVADTARVLSRYVDAIMIRTTSHDRLLELAQHATVP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD THPCQI+AD+MT+EEHRG + GK ++W+GDGNN+LHS++E +ARF + L  A
Sbjct: 121 VINGLTDETHPCQIMADVMTYEEHRGPIAGKTWAWTGDGNNVLHSMLEASARFGFRLRAA 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQP 243
           TP    P   Y+NWA  +G +V +  DA  AVK A CV TDTW SM  E ++   + F P
Sbjct: 181 TPAKHGPMERYVNWAEVEGGNVTMLRDAEDAVKNADCVVTDTWESMGMEDESGGHNTFAP 240

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +QVN  LM+ A PDALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK IL WC 
Sbjct: 241 YQVNADLMAKAAPDALFMHCLPAHRGEEVTDEVMDGPQSVVFDEAENRLHAQKGILAWCL 300

Query: 304 G 304
           G
Sbjct: 301 G 301


>gi|91975376|ref|YP_568035.1| ornithine carbamoyltransferase [Rhodopseudomonas palustris BisB5]
 gi|91681832|gb|ABE38134.1| ornithine carbamoyltransferase [Rhodopseudomonas palustris BisB5]
          Length = 316

 Score =  245 bits (626), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 178/307 (57%), Positives = 220/307 (71%), Gaps = 1/307 (0%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSE-NIFENKPLSGKVLAMIFEKPSTRTR 59
           M   P+HF DLS + +S L  ++     IK   + NI  +KPL+GK LAMIFEKPSTRTR
Sbjct: 9   MNNAPRHFLDLSELPTSELRNMLAAGVAIKAKRKANIEPDKPLAGKTLAMIFEKPSTRTR 68

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V M+ LGG+ I L+G+EMQLGR ETI DTA+VLSR+VD I++R  NH  LLEL   
Sbjct: 69  VSFDVGMRQLGGEAIMLTGAEMQLGRGETIADTARVLSRFVDIIMIRILNHDSLLELAAN 128

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ATVPVIN LT  +HPCQ++AD+MTFEEHRGS+KG   +W+GD NN+L S    A RF + 
Sbjct: 129 ATVPVINGLTRKSHPCQVMADVMTFEEHRGSIKGATVAWTGDDNNVLASWAHAAQRFEFN 188

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L IATP    P     +W +  GA V L +DA +AV+GA CV TDTW+SM  +      +
Sbjct: 189 LKIATPPQLAPNKAMRDWIKASGAQVTLGNDAEEAVRGADCVVTDTWVSMGDKDGEHRHN 248

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + +P+QVN  LMS+AH DA+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK IL
Sbjct: 249 LLKPYQVNSKLMSLAHKDAIFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKGIL 308

Query: 300 LWCFGII 306
            WC G +
Sbjct: 309 AWCLGAV 315


>gi|192293615|ref|YP_001994220.1| ornithine carbamoyltransferase [Rhodopseudomonas palustris TIE-1]
 gi|192287364|gb|ACF03745.1| ornithine carbamoyltransferase [Rhodopseudomonas palustris TIE-1]
          Length = 309

 Score =  245 bits (626), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 170/305 (55%), Positives = 220/305 (72%), Gaps = 1/305 (0%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFE-NKPLSGKVLAMIFEKPSTRTRVS 61
             P+HF DL+ + +S L  ++  A  +K   +   + +KPL+GK LAMIF+KPSTRTRVS
Sbjct: 4   NMPRHFLDLTELPTSELRNMLSAAVAMKAKRKANADGDKPLAGKTLAMIFDKPSTRTRVS 63

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V M+ LGG++I L+G+EMQLGR ETI DTA+VLSR+VD I++R  NH  LLEL   AT
Sbjct: 64  FDVGMRQLGGESIMLTGAEMQLGRGETIADTARVLSRFVDIIMIRILNHEALLELAANAT 123

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LT  +HPCQ++AD+MTFEEHRG +KG+  +W+GD NN+L S    A RF + LN
Sbjct: 124 VPVINGLTRKSHPCQVMADVMTFEEHRGPIKGRTIAWTGDDNNVLASFAHAAQRFEFKLN 183

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           IATP    P     +W +  GA++ +  D  +AV+GA CV TDTW+SM  +      ++ 
Sbjct: 184 IATPPQLSPSKALRDWIKQSGAAITIGTDPEEAVRGADCVVTDTWVSMGDKDGEHRHNLL 243

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           +P+QVN  LMS+AH DA+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK IL W
Sbjct: 244 KPYQVNAKLMSLAHKDAIFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKGILAW 303

Query: 302 CFGII 306
           C G +
Sbjct: 304 CLGAV 308


>gi|222147383|ref|YP_002548340.1| ornithine carbamoyltransferase [Agrobacterium vitis S4]
 gi|221734373|gb|ACM35336.1| ornithine carbamoyltransferase [Agrobacterium vitis S4]
          Length = 305

 Score =  245 bits (625), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 211/305 (69%), Positives = 251/305 (82%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M  PKHF DLS ++S +L  I+  A + K  +     +KPL+GK+LAMIFEKPSTRTRVS
Sbjct: 1   MASPKHFLDLSAMTSEDLHSILSDAHQRKTRTRAGTADKPLAGKMLAMIFEKPSTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V M+ LGG+T+FLSG+EMQLGRAETIGDTAKVLSRYVDAI++RTT+H+RLLEL E+AT
Sbjct: 61  FDVGMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTDHNRLLELAEHAT 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVINALTD THPCQI+ADIMT EEHRG ++GK  +W+GDGNN+LHSL+EGAARF Y +N
Sbjct: 121 VPVINALTDLTHPCQIMADIMTIEEHRGPIRGKTLAWTGDGNNVLHSLVEGAARFGYRMN 180

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +A P+GSEP ++ LNWARN G  + L HDA +AV GA  V TDTW+SMN E KAR  +VF
Sbjct: 181 MAVPMGSEPEDQILNWARNNGGEIMLCHDADRAVTGADAVITDTWVSMNLEHKARGHNVF 240

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QPFQVN +LM  A PDALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK+IL W
Sbjct: 241 QPFQVNPALMKQAKPDALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKSILAW 300

Query: 302 CFGII 306
           C G +
Sbjct: 301 CLGAV 305


>gi|325291862|ref|YP_004277726.1| Ornithine carbamoyltransferase [Agrobacterium sp. H13-3]
 gi|325059715|gb|ADY63406.1| Ornithine carbamoyltransferase [Agrobacterium sp. H13-3]
          Length = 305

 Score =  245 bits (624), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 207/305 (67%), Positives = 257/305 (84%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M  PKHF DLS + S +L  I++ A+  K +++     KPL+GK+LAMIFEKPSTRTRVS
Sbjct: 1   MGSPKHFLDLSAVGSEDLRTILDDARTRKIATKTGTAEKPLAGKMLAMIFEKPSTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V M+ LGG+T+FLSG+EMQLGRAETIGDTAKVLSRYVDAI++RTT+HSRLLEL E+AT
Sbjct: 61  FDVGMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTDHSRLLELAEHAT 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD+THPCQI+ADI+TFEEHRG VKGK  +W+GDGNN+LHS +EG+ARF Y + 
Sbjct: 121 VPVINGLTDDTHPCQIMADILTFEEHRGPVKGKTIAWTGDGNNVLHSFVEGSARFGYRMA 180

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +A P+GSEP +++LNWARN G  ++L+HDA +AV GA CV TDTW+SMNQE KAR  ++F
Sbjct: 181 MAVPMGSEPHDKFLNWARNNGGEISLYHDADKAVAGADCVVTDTWVSMNQEHKARGHNIF 240

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+QVN +LM+ A+ +ALFMHCLPAHRGEEV + V+DGPQSVVFDEAENRLH QK+I+ W
Sbjct: 241 QPYQVNEALMAKANKEALFMHCLPAHRGEEVTDAVIDGPQSVVFDEAENRLHAQKSIIAW 300

Query: 302 CFGII 306
           C G+I
Sbjct: 301 CMGVI 305


>gi|299134025|ref|ZP_07027218.1| ornithine carbamoyltransferase [Afipia sp. 1NLS2]
 gi|298590772|gb|EFI50974.1| ornithine carbamoyltransferase [Afipia sp. 1NLS2]
          Length = 307

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 160/306 (52%), Positives = 211/306 (68%), Gaps = 1/306 (0%)

Query: 2   MTYP-KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M+   +HF DLS +   +L  I++ +  +K + +    ++PL  K LAMIFE+PSTRTRV
Sbjct: 1   MSQKLRHFLDLSELPVHDLRAILDASIAMKKNLKAGHPDRPLKDKTLAMIFERPSTRTRV 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFEV M+ LGG+ I L+G EMQLGR ET  DTA+VLSR+VD I++R  +H  L E+ E+A
Sbjct: 61  SFEVGMRQLGGEAIMLTGQEMQLGRGETFADTARVLSRFVDIIMIRILSHDALAEMVEFA 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVIN LT  +HP Q++AD+MTFEEHRG +KG+  +W GD NN++ S    A RF + L
Sbjct: 121 TVPVINGLTRRSHPTQVMADVMTFEEHRGPIKGRTVAWVGDDNNVMASWAHAAERFGFTL 180

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            +ATP    P     +W +   A + L  DA +AV+G  CV TDTW+SM  +      ++
Sbjct: 181 RVATPPQLAPNKRLRDWIKATNAPIVLGTDAQEAVRGTDCVVTDTWMSMGDKDAEHRHNL 240

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
            +P+QV+  LMS+A PDA+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH  K IL 
Sbjct: 241 LKPYQVDEKLMSLAKPDAIFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAHKGILA 300

Query: 301 WCFGII 306
           WC G +
Sbjct: 301 WCLGAV 306


>gi|92116262|ref|YP_575991.1| ornithine carbamoyltransferase [Nitrobacter hamburgensis X14]
 gi|122418618|sp|Q1QQG6|OTC_NITHX RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|91799156|gb|ABE61531.1| ornithine carbamoyltransferase [Nitrobacter hamburgensis X14]
          Length = 308

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 167/305 (54%), Positives = 219/305 (71%), Gaps = 1/305 (0%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIF-ENKPLSGKVLAMIFEKPSTRTR 59
           M T P+HF DL ++ ++ L  I++ +  +K   +     +KPL GK LAMIF+KPSTRTR
Sbjct: 1   MSTAPRHFLDLFDVPTTELRAILDASVAMKKRRKEGRIADKPLDGKTLAMIFDKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V M+ LGG+ I L+G+EMQLGR ETI DTA+VLSR+VD I++R  +H  L EL  +
Sbjct: 61  VSFDVGMRQLGGEAIMLTGAEMQLGRGETIADTARVLSRFVDIIMIRILSHDALTELAAH 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ATVPVIN LT  +HPCQ++AD+MTFEEHRG +KG+  +W+GD NN+L S    A RF++ 
Sbjct: 121 ATVPVINGLTRRSHPCQVMADVMTFEEHRGPIKGRTVAWTGDDNNVLASWAHAADRFSFN 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           LN+ATP    P     +W R+ GAS+ L  +   A +GA C+ TDTW+SM  +      +
Sbjct: 181 LNVATPPELAPNKLLKDWIRSSGASIKLGTNPEAAARGADCIVTDTWVSMGDKDGEHRHN 240

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + +P+QVN  LMS+A PDALFMHCLPAHRG+EV +EV+DGPQSVVFDEAENR+H QK IL
Sbjct: 241 LLKPYQVNAKLMSLAKPDALFMHCLPAHRGDEVTDEVIDGPQSVVFDEAENRMHAQKGIL 300

Query: 300 LWCFG 304
            WC G
Sbjct: 301 AWCLG 305


>gi|327401264|ref|YP_004342103.1| Ornithine carbamoyltransferase [Archaeoglobus veneficus SNP6]
 gi|327316772|gb|AEA47388.1| Ornithine carbamoyltransferase [Archaeoglobus veneficus SNP6]
          Length = 305

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 145/301 (48%), Positives = 199/301 (66%), Gaps = 1/301 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH   +S++++  L+ I+E+A+K+K           L  K LAMIFE PSTRTRVSFEV
Sbjct: 1   MKHLLSISDLTAEELAEILELAEKLKAERYKGVVTDYLKNKSLAMIFELPSTRTRVSFEV 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           AM  LGG  ++L  +E+QLGR E I DTA+VLSRYV AI+MR  NHS L E   Y++VPV
Sbjct: 61  AMTDLGGHALYLGWNELQLGRGEPIKDTARVLSRYVHAIMMRVRNHSTLEEFAAYSSVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN L++  HPCQIIAD++T +E++GS++    +W GDGNN+ +SLI   A     + ++T
Sbjct: 121 INGLSNLEHPCQIIADLLTIKEYKGSLEDVKVAWVGDGNNVCNSLILATALAGMEIVVST 180

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREEHVFQP 243
           P G EP    +  A+   A++    + V+AVK A  ++TD W+SM  +  K +    F P
Sbjct: 181 PSGYEPDESIIKKAKELKANLKFESNPVKAVKDADVIYTDVWVSMGQESEKRKRLKDFGP 240

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +QVN  L+ +A  D + MHCLPAHRGEE+ +EV++G  SV+FD+AENRLH QKAILL   
Sbjct: 241 YQVNKKLVDVAKEDVIVMHCLPAHRGEEITDEVIEGASSVIFDQAENRLHAQKAILLKLI 300

Query: 304 G 304
           G
Sbjct: 301 G 301


>gi|75674712|ref|YP_317133.1| ornithine carbamoyltransferase [Nitrobacter winogradskyi Nb-255]
 gi|123614122|sp|Q3SVB0|OTC_NITWN RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|74419582|gb|ABA03781.1| ornithine carbamoyltransferase [Nitrobacter winogradskyi Nb-255]
          Length = 308

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 169/305 (55%), Positives = 219/305 (71%), Gaps = 2/305 (0%)

Query: 2   MTY-PKHFADLSNISSSNLSCIIEVAKKIKNSSENI-FENKPLSGKVLAMIFEKPSTRTR 59
           M+  P+HF DL ++S+  L  I++ +  +K   +     +KPL+GK LAMIF+KPSTRTR
Sbjct: 1   MSKAPRHFLDLLDMSTGELRAILDASVAMKKRRKEGLIADKPLAGKTLAMIFDKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V M+ LGG+ I L+G+EMQLGR ETI DTAKVLSR+VD I++R  +H  L EL  +
Sbjct: 61  VSFDVGMRQLGGEAIMLTGAEMQLGRGETIADTAKVLSRFVDIIMIRILSHDALTELAAH 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ATVPVIN LT  +HPCQ++AD+MTFEEHRG ++G+  +W+GD NN+L S    A RF++ 
Sbjct: 121 ATVPVINGLTRRSHPCQVMADVMTFEEHRGPIEGRTVAWTGDDNNVLASWAHAAERFSFN 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           LN+ATP    P     +W R+ GAS+ L  D   AV+GA C+ TDTW+SM  +      +
Sbjct: 181 LNVATPQELAPNKPLKDWIRSSGASIRLGTDPEAAVRGADCIVTDTWVSMGDKDGEHRHN 240

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + +P+QVN  LM +A  DALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK IL
Sbjct: 241 LLRPYQVNAELMRLAKSDALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKGIL 300

Query: 300 LWCFG 304
            WC G
Sbjct: 301 AWCLG 305


>gi|86747910|ref|YP_484406.1| ornithine carbamoyltransferase [Rhodopseudomonas palustris HaA2]
 gi|86570938|gb|ABD05495.1| ornithine carbamoyltransferase [Rhodopseudomonas palustris HaA2]
          Length = 328

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 175/307 (57%), Positives = 221/307 (71%), Gaps = 1/307 (0%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSE-NIFENKPLSGKVLAMIFEKPSTRTR 59
           M + P+HF DL+ + +S L  ++     +K   + N   +KPL+GK LAMIFEKPSTRTR
Sbjct: 21  MTSAPRHFLDLTEVPTSELRNMLAAGVAMKAKRKANADADKPLAGKTLAMIFEKPSTRTR 80

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V M+ LGG++I L+G+EMQLGR ETI DTA+VLSR+VD I++R  NH  LLEL   
Sbjct: 81  VSFDVGMRQLGGESIMLTGAEMQLGRGETIADTARVLSRFVDIIMIRILNHDSLLELAAN 140

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ATVPVIN LT  +HPCQ++AD+MTFEEHRG +KG   +W+GD NN+L S    A RF++ 
Sbjct: 141 ATVPVINGLTRKSHPCQVMADVMTFEEHRGPIKGATVAWTGDDNNVLASWAHAAQRFDFR 200

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           LNIATP    P     +W +  GA++ L  DA  AV+GA CV TDTW+SM  +      +
Sbjct: 201 LNIATPPQLAPNKAMRDWIKTSGAAITLGSDAEAAVRGADCVVTDTWVSMGDKDGEHRHN 260

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + +PFQVN  LMS+AH DA+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK IL
Sbjct: 261 LLKPFQVNAKLMSLAHKDAIFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKGIL 320

Query: 300 LWCFGII 306
            WC G +
Sbjct: 321 AWCLGAV 327


>gi|328954146|ref|YP_004371480.1| Ornithine carbamoyltransferase [Desulfobacca acetoxidans DSM 11109]
 gi|328454470|gb|AEB10299.1| Ornithine carbamoyltransferase [Desulfobacca acetoxidans DSM 11109]
          Length = 322

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 145/303 (47%), Positives = 203/303 (66%), Gaps = 1/303 (0%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           T  +    + +++++ +  ++E A  +K   +   + KPL+GK LA+IFEKPSTRTRVSF
Sbjct: 16  TMNRDLLTILDLTAAEIYQLLERAAALKVLHQQDHDPKPLAGKTLALIFEKPSTRTRVSF 75

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E  + HLGG TI+L  ++ QL R+E I DTA+VL+RYVD IV+RT  H  + ++  +A +
Sbjct: 76  EAGIAHLGGSTIYLGRNDSQLSRSEPIADTARVLARYVDGIVIRTFGHDIVEDMARWADI 135

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVIN LTD+ HPCQ+++D+ T +E  G V     +W GDGNN+ +S I  A R ++ L++
Sbjct: 136 PVINGLTDSHHPCQVLSDLQTIQERFGRVTDLKVAWIGDGNNMANSWITAALRLDFSLSL 195

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVF 241
           A P G EP    L  AR +G  + L  D V+AV+ AH + TD W SM QE +A+  + VF
Sbjct: 196 ACPPGYEPDAGLLQQARQEGRPIYLQDDPVRAVQEAHVINTDVWASMGQEAEAKARKKVF 255

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
            P+QVN +L+  A PDA+ +HCLPAHRGEE+  EVLDGPQS  +D+AENRLH QKA+L W
Sbjct: 256 APYQVNGALLQHARPDAIILHCLPAHRGEEITGEVLDGPQSAAWDQAENRLHLQKALLEW 315

Query: 302 CFG 304
             G
Sbjct: 316 LIG 318


>gi|27376210|ref|NP_767739.1| ornithine carbamoyltransferase [Bradyrhizobium japonicum USDA 110]
 gi|32699440|sp|Q89VE8|OTC_BRAJA RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|27349350|dbj|BAC46364.1| ornithine carbamoyltransferase [Bradyrhizobium japonicum USDA 110]
          Length = 307

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 170/306 (55%), Positives = 218/306 (71%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M   PKHF D++ +  S L  +++ +  +K   +     +PL GK LAMIFE+PSTRTRV
Sbjct: 1   MSKSPKHFLDINELPLSELKSMLDASSAMKAKQKAHQPVRPLEGKTLAMIFERPSTRTRV 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF+VAM+ LGG+ I L+G+EMQLGR ETI DTA+VLSRYVDAI++R  NH  LLEL   A
Sbjct: 61  SFDVAMRQLGGEPIMLTGAEMQLGRGETIADTARVLSRYVDAIMIRILNHDALLELAANA 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVIN LT  +HPCQ++AD++T++EHRG ++G+  +W+GD NN+L S    A RF + L
Sbjct: 121 TVPVINGLTRRSHPCQVMADLLTYQEHRGPIEGRTVAWTGDDNNVLASWAHAAERFKFQL 180

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
           N+ATP    P+    +W +  GA + L  D   AV+GA CV TDTW+SM  +      +V
Sbjct: 181 NVATPPELAPKKAMRDWIKASGAPIMLGTDPEAAVRGADCVVTDTWVSMGDKEGEHRHNV 240

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
            +P+QVN  LMS+A PDALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK IL 
Sbjct: 241 LKPYQVNAKLMSLAKPDALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKGILA 300

Query: 301 WCFGII 306
           WCF  +
Sbjct: 301 WCFDAV 306


>gi|222084787|ref|YP_002543316.1| ornithine carbamoyltransferase protein [Agrobacterium radiobacter
           K84]
 gi|221722235|gb|ACM25391.1| ornithine carbamoyltransferase protein [Agrobacterium radiobacter
           K84]
          Length = 305

 Score =  242 bits (617), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 217/305 (71%), Positives = 259/305 (84%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M  PKHF DLS +++++L  II+ A   K + +    +KPL+GK+LAMIFEKPSTRTRVS
Sbjct: 1   MASPKHFLDLSAVAAADLRSIIDDAIVRKRALKAGTADKPLAGKMLAMIFEKPSTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V M+ LGG+T+FLSG+EMQLGRAETIGDTAKVLSRYVDAI++RTT HSRLLEL E+AT
Sbjct: 61  FDVGMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTEHSRLLELAEHAT 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVINALTD+THPCQI+ADIMTFEEHRG +KGK  +W+GDGNN+LHSLIEGAARF+Y +N
Sbjct: 121 VPVINALTDDTHPCQIMADIMTFEEHRGPIKGKTIAWTGDGNNVLHSLIEGAARFDYRMN 180

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +A P+GSEP++ YLNWARNQGA + L HDA +AV G  CV TDTW+SMNQE +AR  +VF
Sbjct: 181 MAVPLGSEPKDHYLNWARNQGAEIMLSHDADRAVAGVDCVVTDTWVSMNQEHRARGHNVF 240

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+QVN +LM+ A  DALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK+IL W
Sbjct: 241 QPYQVNQALMAQAGKDALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKSILAW 300

Query: 302 CFGII 306
           C G I
Sbjct: 301 CLGAI 305


>gi|240103209|ref|YP_002959518.1| ornithine carbamoyltransferase [Thermococcus gammatolerans EJ3]
 gi|239910763|gb|ACS33654.1| Ornithine carbamoyltransferase (argF) [Thermococcus gammatolerans
           EJ3]
          Length = 315

 Score =  242 bits (617), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 140/304 (46%), Positives = 194/304 (63%), Gaps = 5/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +    L + +   +  I++ A+ +K  ++    ++ L GK LAMIF+KPSTRTR+SFEV 
Sbjct: 8   RDLLCLQDFTREEIETILKTAEMMKIWNKIGKPHRVLEGKTLAMIFQKPSTRTRISFEVG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  ++L+ +++QL R ETI DTA+VLSRYVD I+ R   H  + +L +YA+VPVI
Sbjct: 68  IYQLGGYGLYLNANDLQLRRGETIADTARVLSRYVDGIMARVYAHKDVEDLAKYASVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D +HPCQ +AD  T  E +G ++G    + GDGNN+ HSL+    +    + +ATP
Sbjct: 128 NGLSDFSHPCQALADYQTILEKKGRIQGLKVVYVGDGNNVAHSLMIAGTKLGANVVVATP 187

Query: 186 IGSEPRNEYLNWARNQGAS----VALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHV 240
            G EP    + WA    A       L HD V+AVK A  ++TD W SM QE +A     +
Sbjct: 188 EGYEPDERVIKWAEQNAAESGGSFELLHDPVKAVKDADVIYTDVWASMGQETEAEERRKI 247

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+PFQVN  L+  A PD +FMHCLPAHRGEEV ++V+D P SVVFD+AENRLH QKA++ 
Sbjct: 248 FKPFQVNKELVKHAKPDYIFMHCLPAHRGEEVTDDVIDSPNSVVFDQAENRLHAQKAVMA 307

Query: 301 WCFG 304
              G
Sbjct: 308 LVMG 311


>gi|20904484|gb|AAM29841.1| Ornithine carbamoyltransferase [Methanosarcina mazei Go1]
          Length = 320

 Score =  242 bits (617), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 129/302 (42%), Positives = 184/302 (60%), Gaps = 1/302 (0%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           T  +    ++++S   +  ++E A  +K   +     + L  K L MIFEK STRTRVSF
Sbjct: 18  TMKRDVLSITDLSREEIYELLESAADLKKKRKAGEPTEYLKHKSLGMIFEKSSTRTRVSF 77

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           EVAM   GG  ++L+  ++Q+GR ETI DTA+ LS Y+  I+ R  +H  + +L  ++T+
Sbjct: 78  EVAMSDFGGHALYLNSRDIQVGRGETIEDTARTLSGYLHGIMARVMSHDTVEKLARFSTI 137

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVINAL+D  HPCQI+ D MT  E++   +G  F+W GDGNN+ +S + G+A       I
Sbjct: 138 PVINALSDREHPCQILGDFMTIMEYKNRFEGLKFAWIGDGNNVCNSALLGSAIMGMEFVI 197

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVF 241
           A P G EP  E+L  A+  G   ++  D   A K A  ++TD W+SM  E +  +    F
Sbjct: 198 ACPEGYEPGAEFLEKAKALGGKFSITDDPKTAAKDADIIYTDVWVSMGDEAEQEKRLKDF 257

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
             FQVN  L+ +A PD + MHCLPA RG E+ +EV+DGP SV+F+EAENRLH QKA++L 
Sbjct: 258 GSFQVNTELLGVAKPDVIVMHCLPARRGLEITDEVMDGPNSVIFEEAENRLHAQKALILK 317

Query: 302 CF 303
             
Sbjct: 318 LM 319


>gi|115526871|ref|YP_783782.1| ornithine carbamoyltransferase [Rhodopseudomonas palustris BisA53]
 gi|122294390|sp|Q07GY2|OTC_RHOP5 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|115520818|gb|ABJ08802.1| ornithine carbamoyltransferase [Rhodopseudomonas palustris BisA53]
          Length = 312

 Score =  242 bits (617), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 175/311 (56%), Positives = 222/311 (71%), Gaps = 5/311 (1%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIF-----ENKPLSGKVLAMIFEKPS 55
           M   P+HF DL  + +  L  +++    +K   ++         KPL GK LAMIFE+PS
Sbjct: 1   MSNAPRHFLDLDEMPTKELRAVLDAGVALKAKLKSQKARNTLREKPLEGKTLAMIFERPS 60

Query: 56  TRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLE 115
           TRTRVSF+V M+ LGG++I L+G+EMQLGR ETI DTA+VLSRYVDAI++R  NH  LLE
Sbjct: 61  TRTRVSFDVGMRQLGGESIMLTGAEMQLGRGETIADTARVLSRYVDAIMIRILNHDALLE 120

Query: 116 LTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAAR 175
           L E+ATVPVIN LT  +HPCQ++AD+MTFEEHRG ++G+  +W+GD NN+L S    A R
Sbjct: 121 LAEFATVPVINGLTRRSHPCQVMADLMTFEEHRGPIEGRTIAWTGDDNNVLASWAHAAER 180

Query: 176 FNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA 235
           FN+ L IATP    P     +W ++ GAS+ L  D  +AV+GA CV TDTW+SM  +   
Sbjct: 181 FNFTLRIATPPELAPGKPMRDWIKSSGASIVLGTDPEEAVRGADCVLTDTWVSMGDKDGE 240

Query: 236 REEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
              ++ +P+QVN  LMS+A PDALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH Q
Sbjct: 241 HRHNLLKPYQVNTQLMSLAKPDALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQ 300

Query: 296 KAILLWCFGII 306
           K IL WCFG +
Sbjct: 301 KGILAWCFGAV 311


>gi|288931109|ref|YP_003435169.1| ornithine carbamoyltransferase [Ferroglobus placidus DSM 10642]
 gi|288893357|gb|ADC64894.1| ornithine carbamoyltransferase [Ferroglobus placidus DSM 10642]
          Length = 305

 Score =  242 bits (617), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 135/301 (44%), Positives = 192/301 (63%), Gaps = 2/301 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH   ++++    +  I+++A K+K         + L  K L MIFE PSTRTRVSFEV
Sbjct: 1   MKHVLSITDLKKEEIIEILDLADKLKEERRKGILKEYLKNKTLGMIFELPSTRTRVSFEV 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           AM   GG  I+++ +++QLGR ETI DTA+ LSRYV A++MR   H  L+E  ++++VPV
Sbjct: 61  AMNDCGGYAIYMNWNDLQLGRGETIADTARTLSRYVHAVMMRVRRHETLVEFAKFSSVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN L++  HPCQI+AD+ T  E +GS+     +W GDGNN+ +SL+  +A   + + +A 
Sbjct: 121 INGLSNLEHPCQILADLQTIREKKGSL-NVKVAWVGDGNNVCNSLLLASAIIGFEMKLAI 179

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQP 243
           P G +P +E L  A   G    +  D  +AV+GA  ++TD W SM QE +      +F+P
Sbjct: 180 PEGFDPPDEILKKAEELGGRFEILRDPKEAVRGADVIYTDVWASMGQEEERERRLKIFRP 239

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +QVN+ L+  A  D + MHCLPAHRGEE+ +EV+D   SVVFD+AENRLH QKA+LL   
Sbjct: 240 YQVNMELVGEAKEDVIVMHCLPAHRGEEITDEVIDSEYSVVFDQAENRLHAQKALLLKLI 299

Query: 304 G 304
           G
Sbjct: 300 G 300


>gi|294085450|ref|YP_003552210.1| ornithine carbamoyltransferase [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292665025|gb|ADE40126.1| ornithine carbamoyltransferase [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 302

 Score =  241 bits (615), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 159/301 (52%), Positives = 205/301 (68%), Gaps = 2/301 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFEN-KPLSGKVLAMIFEKPSTRTRVSFE 63
            +HF D+ + ++  LS I+E A  +K   +    + KPL+GK +AMIFEKPSTRTRVSFE
Sbjct: 1   MRHFLDIRDFNADTLSAILEQAASLKADRKAGSASAKPLAGKSVAMIFEKPSTRTRVSFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V +  LGG  + LS S++Q+GR E++ DTAKVLSRYVDAI++R   H  L+ L E+ATVP
Sbjct: 61  VGITELGGTPLILSASDLQVGRGESVADTAKVLSRYVDAIMIRCFKHDMLMTLAEHATVP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINALT+ +HPCQI+AD+ T  E  G + G+  +W GDGNN+  S IE AA F + LNIA
Sbjct: 121 VINALTEWSHPCQIMADLQTMIERHGPLAGQSVAWLGDGNNVATSWIEAAAVFGFKLNIA 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQP 243
            P G  P ++ L WAR QGA + L  DA++A K    + TD WI    + +      F P
Sbjct: 181 CPDGYAPSSKLLAWARAQGADITLTDDAMEAAKDVQTIVTDVWI-SMGDDEGTRAEDFAP 239

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +QVN ++M+ A  DA+FMHCLPA RG EV  +V+DG QSVVFDEAENRLH QKAIL WC 
Sbjct: 240 YQVNATIMAAAAGDAIFMHCLPAIRGMEVTADVIDGHQSVVFDEAENRLHAQKAILAWCV 299

Query: 304 G 304
           G
Sbjct: 300 G 300


>gi|91773048|ref|YP_565740.1| ornithine carbamoyltransferase [Methanococcoides burtonii DSM 6242]
 gi|91712063|gb|ABE51990.1| Ornithine carbamoyltransferase [Methanococcoides burtonii DSM 6242]
          Length = 301

 Score =  241 bits (615), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 133/300 (44%), Positives = 189/300 (63%), Gaps = 1/300 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH   +++++   +  I+++A+ +K           L  K LAMIFEK STRTRVSFEV
Sbjct: 1   MKHLISMTDLTQEEIIEILDMAEDLKEKRLRGKMTDLLKNKSLAMIFEKSSTRTRVSFEV 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           AM  LGG +I+L+  ++Q+GR ET+ DTA+VLSRYV  I  R  +H  + +L +++ VPV
Sbjct: 61  AMSDLGGHSIYLNSRDIQIGRGETVSDTAQVLSRYVAGITARVNSHRTVEDLAKHSNVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INAL+D  HPCQI+AD +T  E++  + G  F+W GDGNN+ +SLI G A     + +A 
Sbjct: 121 INALSDLEHPCQILADFLTIREYKNRLNGLKFAWIGDGNNVCNSLILGCALVGMQIAVAC 180

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQP 243
           P G  P  E +   R  G  + +  D  +A   A  ++ D W+SM  E +  +     + 
Sbjct: 181 PEGYMPNPEIVAKGRELGGDILITTDPEEAAADADVLYADVWVSMGDEEEREKRLSDLEN 240

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +Q+N +L+ +A PD +FMHCLPAHRGEEV  EV+DGP SVVFD+AENRLH QKA+L+   
Sbjct: 241 YQINSNLVELAKPDVIFMHCLPAHRGEEVSAEVMDGPHSVVFDQAENRLHAQKALLMKLM 300


>gi|154245167|ref|YP_001416125.1| ornithine carbamoyltransferase [Xanthobacter autotrophicus Py2]
 gi|154159252|gb|ABS66468.1| ornithine carbamoyltransferase [Xanthobacter autotrophicus Py2]
          Length = 309

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 162/298 (54%), Positives = 218/298 (73%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF DLS I +  L  +++ +K +K   +    ++PL+GK LAM+F+KPSTRTRVSF++A
Sbjct: 7   RHFLDLSEIPAEELRRVLDFSKDLKARRKAGEVDRPLAGKTLAMVFDKPSTRTRVSFDLA 66

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+G EMQLGR ETI DTA+VLSR+VDAI++R  +H  L EL ++ATVPVI
Sbjct: 67  MRQLGGETIMLTGQEMQLGRGETIADTARVLSRFVDAIMIRILDHDDLTELAKHATVPVI 126

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT  +HPCQ++AD++TFEEHRG++ G+  +W+GD NN+L S +  A RF++ L +ATP
Sbjct: 127 NGLTRISHPCQVMADVLTFEEHRGNITGRSVAWTGDANNVLASWVHAAQRFDFSLKVATP 186

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
               PR    ++ +   A V    D  +AV+G  CV TDTW+SM  +   R  ++ +P+Q
Sbjct: 187 KELSPRQALKDFVKRTKAKVKFMRDPEEAVEGVDCVVTDTWVSMGDKEAERRHNLLKPYQ 246

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN SLM+ A  +A+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK IL WCF
Sbjct: 247 VNRSLMARADKEAIFMHCLPAHRGEEVSDEVMDGPQSVVFDEAENRLHAQKGILAWCF 304


>gi|121534678|ref|ZP_01666499.1| ornithine carbamoyltransferase [Thermosinus carboxydivorans Nor1]
 gi|121306698|gb|EAX47619.1| ornithine carbamoyltransferase [Thermosinus carboxydivorans Nor1]
          Length = 308

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 141/306 (46%), Positives = 196/306 (64%), Gaps = 5/306 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K    + ++S + ++ I ++AK +K+  +   E+  L GK LAMIF+K STRTRVSFE
Sbjct: 2   KGKDLLSVHDLSQAEINRIFDLAKTLKSKQQQGEEHHLLKGKTLAMIFQKASTRTRVSFE 61

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M  LGG  +FL+ +++Q+GR E + DTA+VLSRYVD I++RT  H  ++EL  YATVP
Sbjct: 62  VGMWQLGGKALFLNANDLQIGRGEPVKDTARVLSRYVDGIMIRTFAHDEVVELARYATVP 121

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQ + DI T  E +G ++G+  ++ GDGNN+ ++L+   A+    + +A
Sbjct: 122 VINGLTDLYHPCQALTDIFTVWEFKGDLQGRKLAYIGDGNNMANALLHACAKVGMHMTVA 181

Query: 184 TPIGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREE 238
           TP G EP    L  A +     G+ + +  D   A   A  ++TD W SM QE + A   
Sbjct: 182 TPPGYEPPAAVLAEAADDALVTGSRLEIVSDPFAAAYDADVLYTDVWASMGQEKEQAARR 241

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F  +QVN  L+ +A PDA+ MHCLPAHRGEE+ +EV++G QSVVFD+AENRLH QKAI
Sbjct: 242 AAFAGYQVNGELLKVAKPDAIVMHCLPAHRGEEITDEVMEGSQSVVFDQAENRLHVQKAI 301

Query: 299 LLWCFG 304
           L    G
Sbjct: 302 LALLMG 307


>gi|220927194|ref|YP_002502496.1| ornithine carbamoyltransferase [Methylobacterium nodulans ORS 2060]
 gi|219951801|gb|ACL62193.1| ornithine carbamoyltransferase [Methylobacterium nodulans ORS 2060]
          Length = 314

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 164/304 (53%), Positives = 216/304 (71%), Gaps = 2/304 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFEN--KPLSGKVLAMIFEKPSTRTRVSF 62
           P+HF DL+++S   L  +++   ++K           +PL+GKVLAM+F++PSTRTRVSF
Sbjct: 9   PRHFLDLTDLSPGQLRTVLDACAELKRHRRKGQPPAERPLAGKVLAMVFDRPSTRTRVSF 68

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           +VAM+ LGG+T+ L+G EMQLGR ET+ DTA+VLSRYVDAI++R  +H  + EL  +A V
Sbjct: 69  DVAMRELGGETLMLTGKEMQLGRGETVADTARVLSRYVDAIMIRILDHGMMQELAAHAEV 128

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVIN LT  +HPCQI+AD++TFEEHRG ++G+  +WSGD NN+L S    AARF++ LN+
Sbjct: 129 PVINGLTKVSHPCQIMADVLTFEEHRGPIRGRTVAWSGDANNVLASWAHAAARFDFRLNV 188

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQ 242
           A P     R + L WA+ +GA + +  D  +AV GA  V TD W+SM  E +A   ++  
Sbjct: 189 ACPPELAVRPDLLAWAKAEGAQINVTTDPFEAVAGADAVVTDCWVSMGDEDEAHRHNLLM 248

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           P+QVN  LM  A  DA+FMHCLPAHRGEEV  EV+DGPQSVVFDEAENRLH QK IL WC
Sbjct: 249 PYQVNGKLMQAAAKDAIFMHCLPAHRGEEVTAEVIDGPQSVVFDEAENRLHAQKGILAWC 308

Query: 303 FGII 306
            G +
Sbjct: 309 LGAV 312


>gi|161618283|ref|YP_001592170.1| ornithine carbamoyltransferase [Brucella canis ATCC 23365]
 gi|254703669|ref|ZP_05165497.1| ornithine carbamoyltransferase [Brucella suis bv. 3 str. 686]
 gi|260567078|ref|ZP_05837548.1| ornithine carbamoyltransferase [Brucella suis bv. 4 str. 40]
 gi|261754309|ref|ZP_05998018.1| ornithine carbamoyltransferase [Brucella suis bv. 3 str. 686]
 gi|161335094|gb|ABX61399.1| ornithine carbamoyltransferase [Brucella canis ATCC 23365]
 gi|260156596|gb|EEW91676.1| ornithine carbamoyltransferase [Brucella suis bv. 4 str. 40]
 gi|261744062|gb|EEY31988.1| ornithine carbamoyltransferase [Brucella suis bv. 3 str. 686]
          Length = 312

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 197/298 (66%), Positives = 239/298 (80%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF DLS + ++ L  I+E AK  K   +     +P +GKVLAMIFEKPSTRTRVSF+V 
Sbjct: 8   KHFIDLSTVPATELRAILEDAKARKARLKAGEVEQPYAGKVLAMIFEKPSTRTRVSFDVG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+GSEMQLGR+E I DTAKVLSRYVDAI++RTT H R+LEL EYATVPVI
Sbjct: 68  MRQLGGETIMLTGSEMQLGRSEAIADTAKVLSRYVDAIMIRTTAHERMLELAEYATVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+THPCQI+AD++T+EEHRG +KGK F+W GDGNN+LHSL+E AARF++ +NIATP
Sbjct: 128 NALTDDTHPCQIMADVLTYEEHRGPIKGKTFAWMGDGNNVLHSLVEAAARFDFNVNIATP 187

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            GSEP+++Y++WAR  GA +    D  +A  GA C+ TDTW+SM QE  AR  +VF P+Q
Sbjct: 188 KGSEPKSQYIDWARANGAGIMSTTDPEKAASGADCIVTDTWVSMGQEDHARGHNVFIPYQ 247

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN +LM+ A P ALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QKAIL WC 
Sbjct: 248 VNANLMAKADPKALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKAILAWCL 305


>gi|254173482|ref|ZP_04880154.1| ornithine carbamoyltransferase [Thermococcus sp. AM4]
 gi|214032174|gb|EEB73004.1| ornithine carbamoyltransferase [Thermococcus sp. AM4]
          Length = 315

 Score =  240 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 143/304 (47%), Positives = 193/304 (63%), Gaps = 5/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +    L + +   L  I++ A+ +K  ++    ++ L GK LAMIF+KPSTRTR+SFEV 
Sbjct: 8   RDVLCLQDFTREELETILKTAEMMKIWNKIGKPHRVLEGKTLAMIFQKPSTRTRISFEVG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  ++L+  ++QL R ETI DTA+VLSRYVD I+ R   H  + +L +YA+VPVI
Sbjct: 68  IYQLGGYGLYLNAQDLQLRRGETIADTARVLSRYVDGIMARVYAHKDVEDLAKYASVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D +HPCQ +AD  T  E +G ++G    + GDGNN+ HSL+    +    + +ATP
Sbjct: 128 NGLSDFSHPCQALADYQTILEKKGRIQGLKIVYVGDGNNVAHSLMIAGTKLGAHVVVATP 187

Query: 186 IGSEPRNEYLNWARNQGAS----VALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHV 240
            G EP    + WA    A       L HD VQAVK A  ++TD W SM QE +A     +
Sbjct: 188 EGYEPDERVIKWAEQNAAESGGSFELTHDPVQAVKDADVIYTDVWASMGQEAEAEERRKI 247

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           FQPFQVN  L+  A PD +FMHCLPAHRGEEV ++V+D P SVVFD+AENRLH QKA++ 
Sbjct: 248 FQPFQVNKELVKHAKPDYIFMHCLPAHRGEEVTDDVIDSPNSVVFDQAENRLHAQKAVMA 307

Query: 301 WCFG 304
              G
Sbjct: 308 LVMG 311


>gi|254701120|ref|ZP_05162948.1| ornithine carbamoyltransferase [Brucella suis bv. 5 str. 513]
 gi|254707957|ref|ZP_05169785.1| ornithine carbamoyltransferase [Brucella pinnipedialis M163/99/10]
 gi|254709464|ref|ZP_05171275.1| ornithine carbamoyltransferase [Brucella pinnipedialis B2/94]
 gi|254713117|ref|ZP_05174928.1| ornithine carbamoyltransferase [Brucella ceti M644/93/1]
 gi|254716529|ref|ZP_05178340.1| ornithine carbamoyltransferase [Brucella ceti M13/05/1]
 gi|256030958|ref|ZP_05444572.1| ornithine carbamoyltransferase [Brucella pinnipedialis M292/94/1]
 gi|256060449|ref|ZP_05450620.1| ornithine carbamoyltransferase [Brucella neotomae 5K33]
 gi|256159004|ref|ZP_05456841.1| ornithine carbamoyltransferase [Brucella ceti M490/95/1]
 gi|256254362|ref|ZP_05459898.1| ornithine carbamoyltransferase [Brucella ceti B1/94]
 gi|256368763|ref|YP_003106269.1| ornithine carbamoyltransferase [Brucella microti CCM 4915]
 gi|260168093|ref|ZP_05754904.1| ornithine carbamoyltransferase [Brucella sp. F5/99]
 gi|261218325|ref|ZP_05932606.1| ornithine carbamoyltransferase [Brucella ceti M13/05/1]
 gi|261221524|ref|ZP_05935805.1| ornithine carbamoyltransferase [Brucella ceti B1/94]
 gi|261315448|ref|ZP_05954645.1| ornithine carbamoyltransferase [Brucella pinnipedialis M163/99/10]
 gi|261316987|ref|ZP_05956184.1| ornithine carbamoyltransferase [Brucella pinnipedialis B2/94]
 gi|261320826|ref|ZP_05960023.1| ornithine carbamoyltransferase [Brucella ceti M644/93/1]
 gi|261324441|ref|ZP_05963638.1| ornithine carbamoyltransferase [Brucella neotomae 5K33]
 gi|261751655|ref|ZP_05995364.1| ornithine carbamoyltransferase [Brucella suis bv. 5 str. 513]
 gi|261757544|ref|ZP_06001253.1| ornithine carbamoyltransferase [Brucella sp. F5/99]
 gi|265988024|ref|ZP_06100581.1| ornithine carbamoyltransferase [Brucella pinnipedialis M292/94/1]
 gi|265997487|ref|ZP_06110044.1| ornithine carbamoyltransferase [Brucella ceti M490/95/1]
 gi|255998921|gb|ACU47320.1| ornithine carbamoyltransferase [Brucella microti CCM 4915]
 gi|260920108|gb|EEX86761.1| ornithine carbamoyltransferase [Brucella ceti B1/94]
 gi|260923414|gb|EEX89982.1| ornithine carbamoyltransferase [Brucella ceti M13/05/1]
 gi|261293516|gb|EEX97012.1| ornithine carbamoyltransferase [Brucella ceti M644/93/1]
 gi|261296210|gb|EEX99706.1| ornithine carbamoyltransferase [Brucella pinnipedialis B2/94]
 gi|261300421|gb|EEY03918.1| ornithine carbamoyltransferase [Brucella neotomae 5K33]
 gi|261304474|gb|EEY07971.1| ornithine carbamoyltransferase [Brucella pinnipedialis M163/99/10]
 gi|261737528|gb|EEY25524.1| ornithine carbamoyltransferase [Brucella sp. F5/99]
 gi|261741408|gb|EEY29334.1| ornithine carbamoyltransferase [Brucella suis bv. 5 str. 513]
 gi|262551955|gb|EEZ07945.1| ornithine carbamoyltransferase [Brucella ceti M490/95/1]
 gi|264660221|gb|EEZ30482.1| ornithine carbamoyltransferase [Brucella pinnipedialis M292/94/1]
          Length = 312

 Score =  240 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 198/298 (66%), Positives = 240/298 (80%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF DLS + ++ L  I+E AK  K   +     +P +GKVLAMIFEKPSTRTRVSF+V 
Sbjct: 8   KHFIDLSTVPATELRAILEDAKARKARLKAGEVERPYAGKVLAMIFEKPSTRTRVSFDVG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+GSEMQLGR+ETI DTAKVLSRYVDAI++RTT H R+LEL EYATVPVI
Sbjct: 68  MRQLGGETIMLTGSEMQLGRSETIADTAKVLSRYVDAIMIRTTAHERMLELAEYATVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+THPCQI+AD++T+EEHRG +KGK F+W GDGNN+LHSL+E AARF++ +NIATP
Sbjct: 128 NALTDDTHPCQIMADVLTYEEHRGPIKGKTFAWMGDGNNVLHSLVEAAARFDFNVNIATP 187

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            GSEP+++Y++WAR  GA +    D  +A  GA C+ TDTW+SM QE  AR  +VF P+Q
Sbjct: 188 KGSEPKSQYIDWARANGAGIMSTTDPEKAASGADCIVTDTWVSMGQEDHARGHNVFIPYQ 247

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN +LM+ A P ALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QKAIL WC 
Sbjct: 248 VNANLMAKADPKALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKAILAWCL 305


>gi|302343312|ref|YP_003807841.1| ornithine carbamoyltransferase [Desulfarculus baarsii DSM 2075]
 gi|301639925|gb|ADK85247.1| ornithine carbamoyltransferase [Desulfarculus baarsii DSM 2075]
          Length = 309

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 139/300 (46%), Positives = 198/300 (66%), Gaps = 1/300 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH   + ++++  +  +IE A+++K      +   PL+GK +AMIFEKPSTRTRVSFEV 
Sbjct: 7   KHLLTIRDLTAQEVLGLIERARQLKAGWRGGYRPTPLAGKSVAMIFEKPSTRTRVSFEVG 66

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  +F++  + Q+ R+E + DTA+VLSRYVD IV+RT  H  + +L  +  VPVI
Sbjct: 67  VFQLGGKALFIASRDSQISRSEPLRDTARVLSRYVDGIVVRTFGHEVVEDLARFGDVPVI 126

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD  HPCQ++ D+ T  E++G V+ ++++W GDGNN+ HS IE AA     L +A P
Sbjct: 127 NALTDRYHPCQVLGDLQTVAEYKGEVRDQVYAWIGDGNNMAHSWIEAAAVLGLRLRLACP 186

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQPF 244
            G +P  E +  AR +GA + L  +  +A  GA  + TD W SM QE +A+     F  F
Sbjct: 187 EGYDPDPEIVAQARARGADILLTREPDEAASGATVINTDVWASMGQEDEAKGRAEAFGGF 246

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
            V+  LMS+A  +A+ +HCLPAHRGEE+ +EV++GPQS ++DEAENRLH QKAI+    G
Sbjct: 247 TVDGRLMSLAAREAIVLHCLPAHRGEEISDEVMEGPQSAIWDEAENRLHMQKAIMEALLG 306


>gi|23501209|ref|NP_697336.1| ornithine carbamoyltransferase [Brucella suis 1330]
 gi|163842587|ref|YP_001626991.1| ornithine carbamoyltransferase [Brucella suis ATCC 23445]
 gi|32699451|sp|Q8G2L7|OTC_BRUSU RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|23347089|gb|AAN29251.1| ornithine carbamoyltransferase [Brucella suis 1330]
 gi|163673310|gb|ABY37421.1| ornithine carbamoyltransferase [Brucella suis ATCC 23445]
          Length = 312

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 197/298 (66%), Positives = 239/298 (80%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF DLS + ++ L  I+E AK  K   +     +P +GKVLAMIFEKPSTRTRVSF+V 
Sbjct: 8   KHFIDLSTVPATELRAILEDAKARKARLKAGEVERPYAGKVLAMIFEKPSTRTRVSFDVG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+GSEMQLGR+E I DTAKVLSRYVDAI++RTT H R+LEL EYATVPVI
Sbjct: 68  MRQLGGETIMLTGSEMQLGRSEAIADTAKVLSRYVDAIMIRTTAHERMLELAEYATVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+THPCQI+AD++T+EEHRG +KGK F+W GDGNN+LHSL+E AARF++ +NIATP
Sbjct: 128 NALTDDTHPCQIMADVLTYEEHRGPIKGKTFAWMGDGNNVLHSLVEAAARFDFNVNIATP 187

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            GSEP+++Y++WAR  GA +    D  +A  GA C+ TDTW+SM QE  AR  +VF P+Q
Sbjct: 188 KGSEPKSQYIDWARANGAGIMSTTDPEKAASGADCIVTDTWVSMGQEDHARGHNVFIPYQ 247

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN +LM+ A P ALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QKAIL WC 
Sbjct: 248 VNANLMAKADPKALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKAILAWCL 305


>gi|170744571|ref|YP_001773226.1| ornithine carbamoyltransferase [Methylobacterium sp. 4-46]
 gi|168198845|gb|ACA20792.1| ornithine carbamoyltransferase [Methylobacterium sp. 4-46]
          Length = 314

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 167/306 (54%), Positives = 217/306 (70%), Gaps = 2/306 (0%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFEN--KPLSGKVLAMIFEKPSTRTRV 60
           T P+HF DL+++S+  L  +++    +K+          +PL+GK+LAM+F++PSTRTRV
Sbjct: 7   TGPRHFLDLTDLSAGQLRGVLDACADLKSRRRKGQPPAERPLAGKILAMVFDRPSTRTRV 66

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF+VAM+ LGG+T+ L+G EMQLGR ETI DTA+VLSRYVDAI++R  +H  + EL  +A
Sbjct: 67  SFDVAMRELGGETLMLTGKEMQLGRGETIADTARVLSRYVDAIMIRILDHDMMRELARHA 126

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
            VPVIN LT  +HPCQI+AD++TFEEHRG ++G+  +WSGD NN+L S    AARF + L
Sbjct: 127 EVPVINGLTKLSHPCQIMADVLTFEEHRGPIRGRTVAWSGDANNVLASWAHAAARFEFRL 186

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            IATP     + E L+WAR +GA V +  D  +A  GA  V TD W+SM  E +A   ++
Sbjct: 187 RIATPPELPVKPELLDWARAEGAQVTVTADPFEAAAGADAVVTDCWVSMGDEDEAHRHNL 246

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
             P+QVN  LM  A  DA+FMHCLPAHRGEEV  EV+DGPQSVVFDEAENRLH QK IL 
Sbjct: 247 LMPYQVNGELMRAAAKDAVFMHCLPAHRGEEVTAEVIDGPQSVVFDEAENRLHAQKGILA 306

Query: 301 WCFGII 306
           WC G +
Sbjct: 307 WCLGAV 312


>gi|332159010|ref|YP_004424289.1| ornithine carbamoyltransferase [Pyrococcus sp. NA2]
 gi|331034473|gb|AEC52285.1| ornithine carbamoyltransferase [Pyrococcus sp. NA2]
          Length = 317

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 150/306 (49%), Positives = 199/306 (65%), Gaps = 5/306 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             +    L + +   +  I+E AK +K   +    ++ L GK LAMIF+KPSTRTRVSFE
Sbjct: 6   KGRDLLCLQDYTPEEIWTILETAKMLKIWQKIGKPHRLLEGKTLAMIFQKPSTRTRVSFE 65

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VAM HLGG  ++L+  ++QL R ETI DTA+VLSRYVDAI+ R   H  + +L +YA+VP
Sbjct: 66  VAMAHLGGHALYLNAQDLQLRRGETIADTARVLSRYVDAIMARVYAHKDVEDLAKYASVP 125

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN L+D +HPCQ +AD MT  E +G++KG    + GDGNN+ HSL+    +    + +A
Sbjct: 126 VINGLSDFSHPCQALADYMTIWEKKGTIKGVKVVYVGDGNNVCHSLMIAGTKLGADVIVA 185

Query: 184 TPIGSEPRNEYLNWARNQGAS----VALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REE 238
           TP G EP  + + WA    A       L HD V+AVK A  ++TD W SM QE +A    
Sbjct: 186 TPEGYEPDEKVIKWAEQNAAESGGSFELLHDPVKAVKDADVIYTDVWASMGQEAEAEERR 245

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
            VF+PFQVN  L+  A PD +FMHCLPAHRGEEV ++V+D P SVV+D+AENRLH QKA+
Sbjct: 246 KVFRPFQVNKDLVKHAKPDYMFMHCLPAHRGEEVTDDVIDSPNSVVWDQAENRLHAQKAV 305

Query: 299 LLWCFG 304
           L+   G
Sbjct: 306 LVLLLG 311


>gi|110632370|ref|YP_672578.1| ornithine carbamoyltransferase [Mesorhizobium sp. BNC1]
 gi|110283354|gb|ABG61413.1| ornithine carbamoyltransferase [Chelativorans sp. BNC1]
          Length = 302

 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 202/301 (67%), Positives = 239/301 (79%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             ++F DLS +S+++L  I++ AK+ K   ++    KP  GKVLAMIF+KPSTRTRVSF+
Sbjct: 1   MARNFIDLSAVSAADLRSILDDAKERKALLKSGKAGKPFEGKVLAMIFDKPSTRTRVSFD 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VAM+ LGGDTI L+G EMQLGR+ETI DTAKVLSRYVDAI++RTT H RLLEL E ATVP
Sbjct: 61  VAMRQLGGDTIMLTGMEMQLGRSETIADTAKVLSRYVDAIMIRTTAHERLLELAENATVP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD+THPCQI+ADIMTFEEHRG VK +LF+WSGDGNN+LHSL+E +ARF + LNIA
Sbjct: 121 VINGLTDDTHPCQIMADIMTFEEHRGDVKDRLFAWSGDGNNVLHSLLEASARFGFRLNIA 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQP 243
           TP+GSEP   Y+ WA+  G  V L  D   AV+GA CV TDTWISM QE +AR  +VFQP
Sbjct: 181 TPVGSEPSAHYVEWAKTNGGRVTLTSDPEAAVRGADCVVTDTWISMGQEHRARGHNVFQP 240

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +QVN  LMS A  +ALFMHCLPAHRGEEV + V+DGP SVVFDEAENRLH QKA+L WC 
Sbjct: 241 YQVNERLMSFAKKEALFMHCLPAHRGEEVTDGVIDGPHSVVFDEAENRLHAQKAVLAWCL 300

Query: 304 G 304
           G
Sbjct: 301 G 301


>gi|254718495|ref|ZP_05180306.1| ornithine carbamoyltransferase [Brucella sp. 83/13]
 gi|265983465|ref|ZP_06096200.1| ornithine carbamoyltransferase [Brucella sp. 83/13]
 gi|306838302|ref|ZP_07471148.1| ornithine carbamoyltransferase [Brucella sp. NF 2653]
 gi|306842431|ref|ZP_07475083.1| ornithine carbamoyltransferase [Brucella sp. BO2]
 gi|306844941|ref|ZP_07477522.1| ornithine carbamoyltransferase [Brucella sp. BO1]
 gi|264662057|gb|EEZ32318.1| ornithine carbamoyltransferase [Brucella sp. 83/13]
 gi|306274573|gb|EFM56362.1| ornithine carbamoyltransferase [Brucella sp. BO1]
 gi|306287453|gb|EFM58930.1| ornithine carbamoyltransferase [Brucella sp. BO2]
 gi|306406593|gb|EFM62826.1| ornithine carbamoyltransferase [Brucella sp. NF 2653]
          Length = 312

 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 198/298 (66%), Positives = 239/298 (80%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF DLS + ++ L  I+E AK  K   +     +P +GKVLAMIFEKPSTRTRVSF+V 
Sbjct: 8   KHFIDLSTVPATELRAILEDAKARKARLKAGEVERPYAGKVLAMIFEKPSTRTRVSFDVG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+GSEMQLGR+ETI DTAKVLSRYVDAI++RTT H R+LEL EYATVPVI
Sbjct: 68  MRQLGGETIMLTGSEMQLGRSETIADTAKVLSRYVDAIMIRTTAHERMLELAEYATVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+THPCQI+AD++T+EEHRG +KGK F+W GDGNN+LHSL+E AARF++ +NIATP
Sbjct: 128 NALTDDTHPCQIMADVLTYEEHRGPIKGKTFAWMGDGNNVLHSLVEAAARFDFNVNIATP 187

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            GSEP+++Y++WAR  GA +    D  +A  GA C+ TDTW+SM QE  AR  +VF P+Q
Sbjct: 188 KGSEPKSQYIDWARANGAGIMSTTDPEKAASGADCIVTDTWVSMGQEDHARGHNVFIPYQ 247

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN  LM+ A P ALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QKAIL WC 
Sbjct: 248 VNAHLMAKADPKALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKAILAWCL 305


>gi|90426386|ref|YP_534756.1| ornithine carbamoyltransferase [Rhodopseudomonas palustris BisB18]
 gi|90108400|gb|ABD90437.1| ornithine carbamoyltransferase [Rhodopseudomonas palustris BisB18]
          Length = 310

 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 176/309 (56%), Positives = 219/309 (70%), Gaps = 4/309 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSE----NIFENKPLSGKVLAMIFEKPSTR 57
           M+ P+HF DL+ + +  L  I++V+  +K   +    N    KPL GK LAMIFEKPSTR
Sbjct: 1   MSTPRHFLDLTELPTKELRRILDVSVAMKTKLKAKDPNNKPGKPLEGKTLAMIFEKPSTR 60

Query: 58  TRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELT 117
           TRVSF+V M+ LGG+ I L+G+EMQLGR ET  DTAKVLSRYVDAI++R  +H  LLEL 
Sbjct: 61  TRVSFDVGMRQLGGEAIMLTGAEMQLGRGETFADTAKVLSRYVDAIMIRILSHEALLELA 120

Query: 118 EYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFN 177
            +ATVPVIN LT  +HP Q++AD+MTFEEHRG +KG+  +W+GD NN+L S +  A RF 
Sbjct: 121 AHATVPVINGLTRRSHPGQVMADLMTFEEHRGPIKGRTIAWTGDDNNVLASWVHAAERFQ 180

Query: 178 YLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE 237
           + L IATP    P     +W +  GAS+ L +DA  AVKGA CV TDTW+SM  +     
Sbjct: 181 FNLRIATPPQLAPNKAMKDWIKATGASIQLGNDAEAAVKGADCVITDTWVSMGDKEGEHR 240

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
            ++ +PFQVN  LMSMA  DA+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH  K 
Sbjct: 241 HNLLKPFQVNAKLMSMASKDAIFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAHKG 300

Query: 298 ILLWCFGII 306
           IL WCF  +
Sbjct: 301 ILAWCFDAV 309


>gi|90418944|ref|ZP_01226855.1| ornithine carbamoyltransferase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337024|gb|EAS50729.1| ornithine carbamoyltransferase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 317

 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 192/308 (62%), Positives = 239/308 (77%), Gaps = 5/308 (1%)

Query: 2   MTY---PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRT 58
           MT    PKHF D+S + S +L  II+ A + K    +    KPL+GKVLAMIF+KPSTRT
Sbjct: 1   MTMANGPKHFLDISAVPSRDLHDIIDDAARRKALGRDG--PKPLAGKVLAMIFDKPSTRT 58

Query: 59  RVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTE 118
           RVSF+V M+ LGG+T+FLSG+EMQLGR+ETI DTA+VLSRYVDAI++RTT H RL E+ +
Sbjct: 59  RVSFDVGMRQLGGETLFLSGTEMQLGRSETIADTARVLSRYVDAIMIRTTTHDRLTEMAQ 118

Query: 119 YATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNY 178
           YATVPVIN LTD+THPCQI+ D++TFEE RG V+GK F+W+GDGNN+L S +E +ARF++
Sbjct: 119 YATVPVINGLTDDTHPCQIMTDLLTFEEKRGPVRGKTFAWTGDGNNVLSSFVEASARFSF 178

Query: 179 LLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE 238
            L IATP GS P   ++  AR  GAS+ +  D V+AV GA CV TDTW+SM +E +AR  
Sbjct: 179 NLTIATPAGSGPDMRFVERARKDGASILITEDPVEAVTGADCVVTDTWVSMGREEQARGH 238

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
           +VF P+QVN  LM+ A P+ALFMHCLPAHRGEEV + V+DGPQSVVFDEAENRLH QK+I
Sbjct: 239 NVFMPYQVNERLMAHAKPEALFMHCLPAHRGEEVTDAVMDGPQSVVFDEAENRLHAQKSI 298

Query: 299 LLWCFGII 306
           L WCF  +
Sbjct: 299 LAWCFDAL 306


>gi|161485684|ref|NP_632169.2| ornithine carbamoyltransferase [Methanosarcina mazei Go1]
 gi|32699456|sp|Q8Q0J1|OTC_METMA RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
          Length = 302

 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 128/301 (42%), Positives = 183/301 (60%), Gaps = 1/301 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             +    ++++S   +  ++E A  +K   +     + L  K L MIFEK STRTRVSFE
Sbjct: 1   MKRDVLSITDLSREEIYELLESAADLKKKRKAGEPTEYLKHKSLGMIFEKSSTRTRVSFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VAM   GG  ++L+  ++Q+GR ETI DTA+ LS Y+  I+ R  +H  + +L  ++T+P
Sbjct: 61  VAMSDFGGHALYLNSRDIQVGRGETIEDTARTLSGYLHGIMARVMSHDTVEKLARFSTIP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINAL+D  HPCQI+ D MT  E++   +G  F+W GDGNN+ +S + G+A       IA
Sbjct: 121 VINALSDREHPCQILGDFMTIMEYKNRFEGLKFAWIGDGNNVCNSALLGSAIMGMEFVIA 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQ 242
            P G EP  E+L  A+  G   ++  D   A K A  ++TD W+SM  E +  +    F 
Sbjct: 181 CPEGYEPGAEFLEKAKALGGKFSITDDPKTAAKDADIIYTDVWVSMGDEAEQEKRLKDFG 240

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            FQVN  L+ +A PD + MHCLPA RG E+ +EV+DGP SV+F+EAENRLH QKA++L  
Sbjct: 241 SFQVNTELLGVAKPDVIVMHCLPARRGLEITDEVMDGPNSVIFEEAENRLHAQKALILKL 300

Query: 303 F 303
            
Sbjct: 301 M 301


>gi|14521522|ref|NP_126998.1| ornithine carbamoyltransferase [Pyrococcus abyssi GE5]
 gi|6685709|sp|O93656|OTC_PYRAB RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|5458741|emb|CAB50228.1| argF ornithine carbamoyltransferase [Pyrococcus abyssi GE5]
          Length = 317

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 150/306 (49%), Positives = 199/306 (65%), Gaps = 5/306 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             +    L + +   +  I+E AK +K   +    ++ L GK LAMIF+KPSTRTRVSFE
Sbjct: 6   KGRDLLCLQDYTPEEIWTILETAKMLKIWQKIGKPHRLLEGKTLAMIFQKPSTRTRVSFE 65

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VAM HLGG  ++L+  ++QL R ETI DTA+VLSRYVDAI+ R  +H  + +L +YA+VP
Sbjct: 66  VAMAHLGGHALYLNAQDLQLRRGETIADTARVLSRYVDAIMARVYDHKDVEDLAKYASVP 125

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN L+D +HPCQ +AD MT  E +G++KG    + GDGNN+ HSL+    +    + +A
Sbjct: 126 VINGLSDFSHPCQALADYMTIWEKKGTIKGVKVVYVGDGNNVAHSLMIAGTKLGADVVVA 185

Query: 184 TPIGSEPRNEYLNWARNQGAS----VALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REE 238
           TP G EP  + + WA    A       L HD V+AVK A  ++TD W SM QE +A    
Sbjct: 186 TPEGYEPDEKVIKWAEQNAAESGGSFELLHDPVKAVKDADVIYTDVWASMGQEAEAEERR 245

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
            +F+PFQVN  L+  A PD +FMHCLPAHRGEEV ++V+D P SVV+DEAENRLH QKA+
Sbjct: 246 KIFRPFQVNKDLVKHAKPDYMFMHCLPAHRGEEVTDDVIDSPNSVVWDEAENRLHAQKAV 305

Query: 299 LLWCFG 304
           L    G
Sbjct: 306 LALLLG 311


>gi|319779510|ref|YP_004130423.1| Ornithine carbamoyltransferase [Taylorella equigenitalis MCE9]
 gi|317109534|gb|ADU92280.1| Ornithine carbamoyltransferase [Taylorella equigenitalis MCE9]
          Length = 311

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 135/300 (45%), Positives = 197/300 (65%), Gaps = 3/300 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            +HF  L + S+  +  I++ A  +K   +N   + PL  + LAM+FEK STRTRVSFE 
Sbjct: 10  KRHFLQLKDFSTEEILYILDRAILLKKKFKNYEPHTPLLDRTLAMVFEKASTRTRVSFEA 69

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  +GG  I L+ ++ QLGR+E I DTA+V+SR VD +++RT   +RL +  EY+ VPV
Sbjct: 70  GMYQMGGFVINLTSNDSQLGRSEPIEDTARVVSRMVDIVMIRTFEQARLEKFAEYSRVPV 129

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LT+  HPCQI+AD++T+ E+RG +KGK  +W GD NN+ ++ I+ A   ++ LN + 
Sbjct: 130 INGLTNEFHPCQILADLLTYIEYRGPIKGKTVTWIGDENNMSYTWIQAAELLDFTLNFSA 189

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQP 243
           P   + + + +  A      + +F D ++A +G+  + TD W SM  E + A+ +  F  
Sbjct: 190 PKDYQLKADRI--AGVSEKHLKVFDDPIEAARGSDLITTDVWTSMGYEEENAKRKSAFAN 247

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +QVN  LMS+A  DA+FMHCLPAHRGEEV  EV+DGPQSVV+DEAENR+H QKA++ +  
Sbjct: 248 WQVNQELMSVAAKDAIFMHCLPAHRGEEVTAEVIDGPQSVVWDEAENRMHVQKAVMEFLL 307


>gi|20092125|ref|NP_618200.1| ornithine carbamoyltransferase [Methanosarcina acetivorans C2A]
 gi|32699458|sp|Q8TKT5|OTC_METAC RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|19917346|gb|AAM06680.1| ornithine carbamoyltransferase [Methanosarcina acetivorans C2A]
          Length = 302

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 127/301 (42%), Positives = 183/301 (60%), Gaps = 1/301 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             +    ++++S   +  ++E A  +K   +     + L  K L MIFEK STRTRVSFE
Sbjct: 1   MKRDVLSITDLSKEEIYELLESAADLKAKRKAGESTEYLKNKSLGMIFEKSSTRTRVSFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VAM   GG  ++L+  ++Q+GR ETI DTA+ LS Y+  ++ R  +H  + +L +Y+T+P
Sbjct: 61  VAMTDFGGHALYLNSRDIQVGRGETIEDTARTLSGYLHGLMARVMSHDTVEKLAKYSTMP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINAL+D  HPCQI+ D MT  E +   +G  F+W GDGNN+ +S + G+A       +A
Sbjct: 121 VINALSDREHPCQILGDFMTIMEFKKKFEGLKFAWVGDGNNVCNSALLGSAIMGMEFAVA 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQ 242
            P G EP+ E+L  A+  G    +  D   A K A  ++TD W+SM  E +  +    F 
Sbjct: 181 CPKGYEPKAEFLEQAKALGGKFTITDDPKVAAKDADIIYTDVWVSMGDEAEQEKRLREFA 240

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            FQVN  L+ +A PD + MHCLPA RG E+ +EV+DGP SV+F+EAENRLH QKA++L  
Sbjct: 241 SFQVNTELLGVAKPDVIVMHCLPARRGLEITDEVMDGPNSVIFEEAENRLHAQKALILKL 300

Query: 303 F 303
            
Sbjct: 301 M 301


>gi|57640806|ref|YP_183284.1| ornithine carbamoyltransferase [Thermococcus kodakarensis KOD1]
 gi|73921523|sp|Q5JI16|OTC_PYRKO RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|57159130|dbj|BAD85060.1| ornithine carbamoyltransferase [Thermococcus kodakarensis KOD1]
          Length = 315

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 142/304 (46%), Positives = 194/304 (63%), Gaps = 5/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +    L + +   L  I++ A+ +K  ++    ++ L GK LAMIF+KPSTRTR+SFEV 
Sbjct: 8   RDVLCLQDFTREELETILKTAEMMKIWNKIGKPHRVLEGKTLAMIFQKPSTRTRISFEVG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  ++L+  ++QL R ETI DTA+VLSRYVD I+ R  +H  + +L +YA+VPVI
Sbjct: 68  IYQLGGYGLYLNAQDLQLRRGETIADTARVLSRYVDGIMARVFDHKDVEDLAKYASVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D +HPCQ +AD  T  E +G ++G    + GDGNN+ HSL+    +    + +ATP
Sbjct: 128 NGLSDFSHPCQALADYQTILEKKGRIQGLKIVYVGDGNNVAHSLMIAGTKLGANVVVATP 187

Query: 186 IGSEPRNEYLNWARNQGAS----VALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHV 240
            G EP  + + WA    A       L HD VQAVK A  ++TD W SM QE +A     +
Sbjct: 188 EGYEPDPKVIKWAEQNAAESGGSFELLHDPVQAVKDADVIYTDVWASMGQEAEAEERRKI 247

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F PFQVN  L+  A PD +FMHCLPAHRGEEV ++V+D P SVVFD+AENRLH QKA++ 
Sbjct: 248 FMPFQVNKELVKHAKPDYIFMHCLPAHRGEEVTDDVIDSPNSVVFDQAENRLHAQKAVMA 307

Query: 301 WCFG 304
              G
Sbjct: 308 LVMG 311


>gi|294851690|ref|ZP_06792363.1| ornithine carbamoyltransferase [Brucella sp. NVSL 07-0026]
 gi|294820279|gb|EFG37278.1| ornithine carbamoyltransferase [Brucella sp. NVSL 07-0026]
          Length = 312

 Score =  239 bits (609), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 198/298 (66%), Positives = 239/298 (80%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF DLS + ++ L  I+E AK  K   +     +P +GKVLAMIFEKPSTRTRVSF+V 
Sbjct: 8   KHFIDLSTVPATELRAILEDAKARKARLKAGEVERPYAGKVLAMIFEKPSTRTRVSFDVG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L GSEMQLGR+ETI DTAKVLSRYVDAI++RTT H R+LEL EYATVPVI
Sbjct: 68  MRQLGGETIMLMGSEMQLGRSETIADTAKVLSRYVDAIMIRTTAHERMLELAEYATVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+THPCQI+AD++T+EEHRG +KGK F+W GDGNN+LHSL+E AARF++ +NIATP
Sbjct: 128 NALTDDTHPCQIMADVLTYEEHRGPIKGKTFAWMGDGNNVLHSLVEAAARFDFNVNIATP 187

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            GSEP+++Y++WAR  GA +    D  +A  GA C+ TDTW+SM QE  AR  +VF P+Q
Sbjct: 188 KGSEPKSQYIDWARANGAGIMSTTDPEKAASGADCIVTDTWVSMGQEDHARGHNVFIPYQ 247

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN +LM+ A P ALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QKAIL WC 
Sbjct: 248 VNANLMAKADPKALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKAILAWCL 305


>gi|11498854|ref|NP_070083.1| ornithine carbamoyltransferase [Archaeoglobus fulgidus DSM 4304]
 gi|3183096|sp|O29013|OTC_ARCFU RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|2649323|gb|AAB89987.1| ornithine carbamoyltransferase (argF) [Archaeoglobus fulgidus DSM
           4304]
          Length = 307

 Score =  238 bits (608), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 141/302 (46%), Positives = 188/302 (62%), Gaps = 1/302 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH   ++++    L  I+++A+K+K           L  K LAMIFE PSTRTRVSFEV
Sbjct: 1   MKHLLSMADLEKDELFEILKLAEKLKEERYKGVVTDYLKNKSLAMIFELPSTRTRVSFEV 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           AM  LGG  ++L   E+QLGR E I DTA+VLSRYV A++MR   HS + E   Y+TVPV
Sbjct: 61  AMTDLGGHALYLGWDELQLGRGEPIKDTARVLSRYVHAVMMRVREHSTIEEFARYSTVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN L++  HPCQ+IAD++T  E+RG  K    +W GDGNN+ +S+I  AA     + I+T
Sbjct: 121 INGLSNLEHPCQVIADLLTIYEYRGDFKDVTLAWVGDGNNVCNSMILAAALTGMKMVIST 180

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREEHVFQP 243
           P   +P  E +  A   GA +    D  +AVK A  ++TD W SM  +  K      FQP
Sbjct: 181 PENYDPNPEIVKKAEEMGAKLRFVRDPKEAVKEADVIYTDVWTSMGQEAEKEARLKAFQP 240

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +QV+  L+  +  D + MHCLPAHRGEE+ +EV++G  S+VFD+AENRLH QKAILL   
Sbjct: 241 YQVSDELLKFSKDDVVVMHCLPAHRGEEITDEVMEGKHSIVFDQAENRLHAQKAILLKLL 300

Query: 304 GI 305
           G 
Sbjct: 301 GK 302


>gi|73670947|ref|YP_306962.1| ornithine carbamoyltransferase [Methanosarcina barkeri str. Fusaro]
 gi|121718442|sp|Q465R0|OTC_METBF RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|72398109|gb|AAZ72382.1| ornithine carbamoyltransferase [Methanosarcina barkeri str. Fusaro]
          Length = 302

 Score =  238 bits (608), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 129/301 (42%), Positives = 186/301 (61%), Gaps = 1/301 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K    ++++S   +  ++E A  +K   +     + L  K L MIFEK STRTRVSFE
Sbjct: 1   MKKDVLSITDLSKEEIYELLESAMDLKEKRKAGEPTEYLKNKSLGMIFEKASTRTRVSFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VAM   GG +++L+  ++Q+GR ETI DTA+ LS Y+  I+ R  +H  + +L +Y+T+P
Sbjct: 61  VAMTDFGGHSLYLNSRDIQIGRGETIEDTARTLSGYLHGIMARVMSHETVEKLAKYSTIP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINAL+D  HPCQI+ D MT  E++   +   F+W GDGNN+ +S + G+A       +A
Sbjct: 121 VINALSDREHPCQILGDFMTIMEYKDKFEDLKFAWVGDGNNVCNSALLGSAIVGMEFAVA 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQ 242
            P G EP+ E+L  A++ G    +  D   AVK A  ++TD W+SM  E +  +    F 
Sbjct: 181 CPKGYEPKPEFLEKAKSLGGKFTVTDDPKVAVKDADIIYTDVWVSMGDEAEQEKRLKEFA 240

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            FQVN  L+ +A PD + MHCLPA RG E+ +EV+DGP SV+F+EAENRLH QKA++L  
Sbjct: 241 TFQVNTELLGVAKPDVIVMHCLPARRGLEITDEVMDGPNSVIFEEAENRLHAQKALILKL 300

Query: 303 F 303
            
Sbjct: 301 M 301


>gi|148252345|ref|YP_001236930.1| ornithine carbamoyltransferase [Bradyrhizobium sp. BTAi1]
 gi|146404518|gb|ABQ33024.1| ornithine carbamoyltransferase [Bradyrhizobium sp. BTAi1]
          Length = 308

 Score =  238 bits (608), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 171/305 (56%), Positives = 219/305 (71%), Gaps = 1/305 (0%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFE-NKPLSGKVLAMIFEKPSTRTR 59
           M   P+HF DL+ +    L  ++ ++ ++K + +      KPL GKVLAMIF+KPSTRTR
Sbjct: 1   MANTPRHFLDLTEMPVEELRNMLALSSRMKKTLKANEPAKKPLEGKVLAMIFDKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V M+ LGG+ I L+G+EMQLGR ETI DTA+VLSRYVDAI++R  +H  LLEL  +
Sbjct: 61  VSFDVGMRQLGGEAIMLTGTEMQLGRGETIADTARVLSRYVDAIMIRILSHEALLELAAH 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ATVPVIN LT  +HPCQ++AD+MTFEEHRGS++G+  +W+GD NN+L S    A RF + 
Sbjct: 121 ATVPVINGLTRRSHPCQVMADVMTFEEHRGSIEGRTVAWTGDDNNVLASWAHAAERFKFR 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           LN+ATP    P     ++ R   A + L HD   AV GA CV TDTW+SM  +      +
Sbjct: 181 LNVATPPQLSPGKPMKDFIRATKADIHLGHDPEAAVTGADCVVTDTWVSMGDKDGEHRHN 240

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + +P+QVN  LMS+A P+A+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK IL
Sbjct: 241 LLKPYQVNSKLMSLAKPEAIFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKGIL 300

Query: 300 LWCFG 304
            WCFG
Sbjct: 301 AWCFG 305


>gi|148559340|ref|YP_001258339.1| ornithine carbamoyltransferase [Brucella ovis ATCC 25840]
 gi|166918647|sp|A5VNP2|OTC_BRUO2 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|148370597|gb|ABQ60576.1| ornithine carbamoyltransferase [Brucella ovis ATCC 25840]
          Length = 312

 Score =  238 bits (607), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 197/298 (66%), Positives = 240/298 (80%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF DLS + ++ L  I+E AK  K   +     +P +GKVLAMIFEKPSTRTRVSF+V 
Sbjct: 8   KHFIDLSTVPATELRAILEDAKARKARLKAGEVERPYAGKVLAMIFEKPSTRTRVSFDVG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+GSEMQLGR+ETI DTAKVLSRYVDAI++RTT H R+LEL EYATVPVI
Sbjct: 68  MRQLGGETIMLTGSEMQLGRSETIADTAKVLSRYVDAIMIRTTAHERMLELAEYATVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+THPCQI+AD++T+EEHRG +KGK F+W GDGNN+LHSL+E AARF++ +NIATP
Sbjct: 128 NALTDDTHPCQIMADVLTYEEHRGPIKGKTFAWMGDGNNVLHSLVEAAARFDFNVNIATP 187

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            GSEP+++Y++WAR  GA +    D  +A  GA C+ TDTW+SM QE  AR  +VF P+Q
Sbjct: 188 KGSEPKSQYIDWARANGAGIMSTTDPEKAASGADCIVTDTWVSMGQEDHARGHNVFIPYQ 247

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN +LM+ A P ALFMHCLPAHRGEEV +EV+DGPQ+VVFDEAENRLH QKAIL WC 
Sbjct: 248 VNANLMAKADPKALFMHCLPAHRGEEVTDEVIDGPQAVVFDEAENRLHAQKAILAWCL 305


>gi|225626828|ref|ZP_03784867.1| ornithine carbamoyltransferase [Brucella ceti str. Cudo]
 gi|225618485|gb|EEH15528.1| ornithine carbamoyltransferase [Brucella ceti str. Cudo]
          Length = 323

 Score =  238 bits (607), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 198/298 (66%), Positives = 240/298 (80%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF DLS + ++ L  I+E AK  K   +     +P +GKVLAMIFEKPSTRTRVSF+V 
Sbjct: 19  KHFIDLSTVPATELRAILEDAKARKARLKAGEVERPYAGKVLAMIFEKPSTRTRVSFDVG 78

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+GSEMQLGR+ETI DTAKVLSRYVDAI++RTT H R+LEL EYATVPVI
Sbjct: 79  MRQLGGETIMLTGSEMQLGRSETIADTAKVLSRYVDAIMIRTTAHERMLELAEYATVPVI 138

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+THPCQI+AD++T+EEHRG +KGK F+W GDGNN+LHSL+E AARF++ +NIATP
Sbjct: 139 NALTDDTHPCQIMADVLTYEEHRGPIKGKTFAWMGDGNNVLHSLVEAAARFDFNVNIATP 198

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            GSEP+++Y++WAR  GA +    D  +A  GA C+ TDTW+SM QE  AR  +VF P+Q
Sbjct: 199 KGSEPKSQYIDWARANGAGIMSTTDPEKAASGADCIVTDTWVSMGQEDHARGHNVFIPYQ 258

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN +LM+ A P ALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QKAIL WC 
Sbjct: 259 VNANLMAKADPKALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKAILAWCL 316


>gi|157829642|pdb|1A1S|A Chain A, Ornithine Carbamoyltransferase From Pyrococcus Furiosus
          Length = 314

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 150/304 (49%), Positives = 199/304 (65%), Gaps = 5/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +    L + ++  +  I+E AK  K   +    ++ L GK LAMIF+KPSTRTRVSFEVA
Sbjct: 7   RDLLCLQDYTAEEIWTILETAKMFKIWQKIGKPHRLLEGKTLAMIFQKPSTRTRVSFEVA 66

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M HLGG  ++L+  ++QL R ETI DTA+VLSRYVDAI+ R  +H  + +L +YATVPVI
Sbjct: 67  MAHLGGHALYLNAQDLQLRRGETIADTARVLSRYVDAIMARVYDHKDVEDLAKYATVPVI 126

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D +HPCQ +AD MT  E +G++KG    + GDGNN+ HSL+    +    + +ATP
Sbjct: 127 NGLSDFSHPCQALADYMTIWEKKGTIKGVKVVYVGDGNNVAHSLMIAGTKLGADVVVATP 186

Query: 186 IGSEPRNEYLNWARNQGAS----VALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHV 240
            G EP  + + WA    A       L HD V+AVK A  ++TD W SM QE +A     +
Sbjct: 187 EGYEPDEKVIKWAEQNAAESGGSFELLHDPVKAVKDADVIYTDVWASMGQEAEAEERRKI 246

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+PFQVN  L+  A PD +FMHCLPAHRGEEV ++V+D P SVV+D+AENRLH QKA+L 
Sbjct: 247 FRPFQVNKDLVKHAKPDYMFMHCLPAHRGEEVTDDVIDSPNSVVWDQAENRLHAQKAVLA 306

Query: 301 WCFG 304
              G
Sbjct: 307 LVMG 310


>gi|319898298|ref|YP_004158391.1| Ornithine carbamoyltransferase (OTCase) [Bartonella clarridgeiae
           73]
 gi|319402262|emb|CBI75801.1| Ornithine carbamoyltransferase (OTCase) [Bartonella clarridgeiae
           73]
          Length = 310

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 184/303 (60%), Positives = 237/303 (78%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M    +HF D+S ++      +I+ AK +K + +    +KP +GK LAMIFEKPSTRTRV
Sbjct: 1   MTNALRHFTDISILTPQQARALIDYAKILKTAFKAGESSKPFAGKTLAMIFEKPSTRTRV 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF++ M+ LGG+TI L+GSEMQLG +ETI DTA+VLSR+V+ I++RTT H R+LEL +YA
Sbjct: 61  SFDLGMRQLGGETIMLTGSEMQLGNSETIADTARVLSRFVEIIILRTTAHHRMLELAQYA 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
            +P+INALTD+THPCQI+ADI+T+EEHRG + GK F+W GDGNN+LHSLIE  A FN+ L
Sbjct: 121 QIPIINALTDDTHPCQILADILTYEEHRGPIVGKTFAWMGDGNNVLHSLIEATAIFNFHL 180

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
           +IATP GSEP+ +Y+NWAR +GA + L  +  +A +   C+ TDTW+SM QEF+AR   +
Sbjct: 181 HIATPQGSEPQEKYVNWARERGAHIMLTQNPQKAAENVDCIITDTWVSMGQEFRARGRSI 240

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           FQP+QVN +LM+ A PDALFMHCLPAHRGEEV++ V+DGP SVVFDEAENRLH QKAIL 
Sbjct: 241 FQPYQVNEALMAYAKPDALFMHCLPAHRGEEVVDAVIDGPNSVVFDEAENRLHAQKAILS 300

Query: 301 WCF 303
           WC 
Sbjct: 301 WCL 303


>gi|209547785|ref|YP_002279702.1| ornithine carbamoyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533541|gb|ACI53476.1| ornithine carbamoyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 304

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 213/302 (70%), Positives = 255/302 (84%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           PKHF DLS ++S++L  I+  A   K + +    +KPL+GK+LAMIFEKPSTRTRVSF+V
Sbjct: 3   PKHFLDLSAVTSADLRTIMNDALARKQAFKAGKGDKPLAGKMLAMIFEKPSTRTRVSFDV 62

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M+ LGG+T+FLSG+EMQLGRAETIGDTAKVLSRYVDAI++RTT HSRL EL E+ATVPV
Sbjct: 63  GMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTEHSRLKELAEHATVPV 122

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALTD+THPCQI+ADIMTFEEHRG +KGK  +W+GDGNN+LHSL+EGAARF Y +N+A 
Sbjct: 123 INALTDDTHPCQIMADIMTFEEHRGPIKGKTIAWTGDGNNVLHSLVEGAARFGYRMNMAV 182

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P+GSEP++ YLNWARN+GA + L HDA +AV G  CV TDTW+SMNQE +AR  +VFQP+
Sbjct: 183 PLGSEPKDHYLNWARNEGAEIMLCHDADRAVDGVDCVVTDTWVSMNQEHRARGHNVFQPY 242

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QVN +LM+ A  DALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK+IL WC G
Sbjct: 243 QVNAALMAKAGSDALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKSILAWCLG 302

Query: 305 II 306
            I
Sbjct: 303 AI 304


>gi|54288320|gb|AAV31608.1| ornithine carbamoyltransferase [uncultured alpha proteobacterium
           EBAC2C11]
          Length = 329

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 151/303 (49%), Positives = 194/303 (64%), Gaps = 2/303 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKP-LSGKVLAMIFEKPSTRTRV 60
           MT  +HF DL + S+  L  I++V   +K   ++   ++   SGK +AMIFEKPSTRTRV
Sbjct: 25  MTPMRHFLDLKDFSTDTLQSILDVGLSMKVKQKSGDSHELSFSGKTVAMIFEKPSTRTRV 84

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFEV +  LGG  + LS S++Q+GR E+I DTA+VLSRYV+AIV+R   H  LL L ++A
Sbjct: 85  SFEVGITQLGGTPLVLSASDLQIGRGESIEDTARVLSRYVNAIVIRCYKHETLLTLAKHA 144

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +VPVINALT+ +HPCQ++AD+MT  E+ G + G+  +W GDGNN+  S IE A  F + L
Sbjct: 145 SVPVINALTNWSHPCQLMADLMTMIEYHGPLAGQTVAWLGDGNNVAVSWIEAAVHFGFHL 204

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            IA P    P    L WAR  G  + L  D   A+     V TD W+      +      
Sbjct: 205 RIAGPQRYAPPAGLLAWARANGGDIMLTDDVSLAIDKVQTVVTDVWV-SMGADEGSRRKD 263

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F P+QVN  LM  A  DA+FMHCLPA RG EV  EV+DGPQS VFDEAENRLH QKA++L
Sbjct: 264 FAPYQVNAKLMKSAAGDAIFMHCLPAQRGMEVTAEVIDGPQSAVFDEAENRLHAQKAVML 323

Query: 301 WCF 303
           WC 
Sbjct: 324 WCL 326


>gi|326204297|ref|ZP_08194156.1| ornithine carbamoyltransferase [Clostridium papyrosolvens DSM 2782]
 gi|325985572|gb|EGD46409.1| ornithine carbamoyltransferase [Clostridium papyrosolvens DSM 2782]
          Length = 305

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 141/305 (46%), Positives = 205/305 (67%), Gaps = 5/305 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH   L+++S+  +  ++++++K+K  ++   ++  L GK L MIF K STRTRVSFEV
Sbjct: 1   MKHLLSLNDLSTDEIHDLLKLSEKLKRQTKEGVQHHLLKGKTLGMIFTKSSTRTRVSFEV 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG ++FLS +++QLGR E+I DTA VLSRY+D I++RT   S + +L +Y T+PV
Sbjct: 61  GMYQLGGYSLFLSSNDIQLGRGESIFDTANVLSRYIDGIMIRTFKQSDVEDLAKYGTIPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD  HPCQI+AD++T  EH+G ++G   ++ GDGNN+ HSL+ G A+    + IA+
Sbjct: 121 INGLTDEMHPCQILADLLTVYEHKGKLEGLKLAYIGDGNNVAHSLLHGCAKTGMDIAIAS 180

Query: 185 PIGSEPRNEYLNWARNQGA----SVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREEH 239
           P G E  + Y++ A+         + L  D V+A+  A  V+ DTWISM QE  K  + +
Sbjct: 181 PKGYECDSRYVDEAKEAAKASGSKIVLTQDPVEAIANADVVYADTWISMGQEEQKEEKLN 240

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           +F P+Q+N  L + A  DA+F+HCLPA+RG EV  +V+DG QSV+FDEAENRLH QKA++
Sbjct: 241 IFMPYQINSQLFAKAKEDAIFLHCLPAYRGYEVTEDVIDGAQSVIFDEAENRLHAQKAVM 300

Query: 300 LWCFG 304
               G
Sbjct: 301 ATLMG 305


>gi|212223581|ref|YP_002306817.1| ornithine carbamoyltransferase [Thermococcus onnurineus NA1]
 gi|212008538|gb|ACJ15920.1| ornithine carbamoyltransferase [Thermococcus onnurineus NA1]
          Length = 315

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 140/304 (46%), Positives = 195/304 (64%), Gaps = 5/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +    L + +   +  I++ A+ +K  ++    ++ L GK LAMIF+KPSTRTR+SFEV 
Sbjct: 8   RDLLCLQDFTREEIETILKTAEMMKIWNKIGKPHRVLEGKTLAMIFQKPSTRTRISFEVG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  ++L+ +++QL R ETI DTA+VLSRYVD I+ R  +H  +++L +YA VPVI
Sbjct: 68  IYQLGGYGLYLNANDLQLRRGETIADTARVLSRYVDGIMARVFDHQDVVDLAKYADVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D +HPCQ +AD  T  E +G ++G    + GDGNN+ HSL+    +    + +ATP
Sbjct: 128 NGLSDFSHPCQALADYQTILEKKGRIQGLKVVYVGDGNNVAHSLMIAGTKLGAHVVVATP 187

Query: 186 IGSEPRNEYLNWARNQGAS----VALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHV 240
            G EP    + WA    A       L HD V+AVK A  ++TD W SM QE +A     +
Sbjct: 188 EGYEPDKRVIKWAEQNAAESGGSFELLHDPVKAVKDADVIYTDVWASMGQEAEAEERRKI 247

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+PFQVN  L+  A PD +FMHCLPAHRG+EV ++V+D P SVVFDEAENRLH QKA++ 
Sbjct: 248 FKPFQVNKDLVKHAKPDYIFMHCLPAHRGDEVTDDVIDSPNSVVFDEAENRLHAQKAVMA 307

Query: 301 WCFG 304
              G
Sbjct: 308 LVMG 311


>gi|327190080|gb|EGE57196.1| ornithine carbamoyltransferase [Rhizobium etli CNPAF512]
          Length = 304

 Score =  237 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 214/302 (70%), Positives = 257/302 (85%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           PKHF DLS ++S++L  I+  A   K + +    +KPL+GK+LAMIFEKPSTRTRVSF+V
Sbjct: 3   PKHFLDLSAVTSADLRTIMNDALARKQAFKAGQGDKPLAGKMLAMIFEKPSTRTRVSFDV 62

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M+ LGG+T+FLSG+EMQLGRAETIGDTAKVLSRYVDAI++RTT HSRLLEL E+ATVPV
Sbjct: 63  GMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTEHSRLLELAEHATVPV 122

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALTD+THPCQI+ADIMTFEEHRG +KGK  +W+GDGNN+LHSL+EGAARF Y +N+A 
Sbjct: 123 INALTDDTHPCQIMADIMTFEEHRGPIKGKTIAWTGDGNNVLHSLVEGAARFGYRMNMAV 182

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P+GSEP++ YLNWARN+GA + L HDA +AV+G  CV TDTW+SMNQE +AR  +VFQP+
Sbjct: 183 PLGSEPKDHYLNWARNEGAEIMLCHDADRAVEGVDCVVTDTWVSMNQEHRARGHNVFQPY 242

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QVN +LM+ A  DALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK+IL WC G
Sbjct: 243 QVNAALMAKAGSDALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKSILAWCLG 302

Query: 305 II 306
            I
Sbjct: 303 AI 304


>gi|239831154|ref|ZP_04679483.1| ornithine carbamoyltransferase [Ochrobactrum intermedium LMG 3301]
 gi|239823421|gb|EEQ94989.1| ornithine carbamoyltransferase [Ochrobactrum intermedium LMG 3301]
          Length = 312

 Score =  237 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 199/298 (66%), Positives = 240/298 (80%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF DLS + +S L  I+E AK  K   +     KP +GKVLAMIFEKPSTRTRVSF+V 
Sbjct: 8   KHFIDLSAVPASELRAIMEDAKARKARLKAGEMEKPFAGKVLAMIFEKPSTRTRVSFDVG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+GSEMQLGR+ETI DTAKVLSRYVDAI++RTT+H R+LEL EYATVPVI
Sbjct: 68  MRQLGGETIMLTGSEMQLGRSETIADTAKVLSRYVDAIMIRTTSHDRMLELAEYATVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+THPCQI+AD++T+EEHRG +KGK F+W GDGNN+LHSL+E AARF++ +NIATP
Sbjct: 128 NALTDDTHPCQIMADVLTYEEHRGPIKGKTFAWMGDGNNVLHSLVEAAARFDFNVNIATP 187

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            GSEP+++Y++WA+  GA++    D  +A  GA C+ TDTW+SM QE  AR  +VF P+Q
Sbjct: 188 EGSEPKSQYVDWAKANGANIMSTTDPERAASGADCIVTDTWVSMGQEDHARGHNVFMPYQ 247

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN  LM  A P ALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QKAIL WC 
Sbjct: 248 VNARLMEKADPKALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKAILAWCL 305


>gi|86356171|ref|YP_468063.1| ornithine carbamoyltransferase [Rhizobium etli CFN 42]
 gi|86280273|gb|ABC89336.1| ornithine carbamoyltransferase protein [Rhizobium etli CFN 42]
          Length = 304

 Score =  237 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 214/302 (70%), Positives = 257/302 (85%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           PKHF DLS ++S++L  I+  A   K + +    +KPL+GK+LAMIFEKPSTRTRVSF+V
Sbjct: 3   PKHFLDLSAVTSADLRTIMNDALSRKQAFKAGKGDKPLAGKMLAMIFEKPSTRTRVSFDV 62

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M+ LGG+T+FLSG+EMQLGRAETIGDTAKVLSRYVDAI++RTT HSRLLEL E+ATVPV
Sbjct: 63  GMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTEHSRLLELAEHATVPV 122

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALTD+THPCQI+ADIMTFEEHRG +KGK  +W+GDGNN+LHSL+EGAARF Y +N+A 
Sbjct: 123 INALTDDTHPCQIMADIMTFEEHRGPIKGKTIAWTGDGNNVLHSLVEGAARFGYRMNMAV 182

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P+GSEP++ YLNWARN+GA + L HDA +AV+G  CV TDTW+SMNQE +AR  +VFQP+
Sbjct: 183 PLGSEPKDHYLNWARNEGAEIMLCHDADRAVEGVDCVVTDTWVSMNQEHRARGHNVFQPY 242

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QVN +LM+ A  DALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK+IL WC G
Sbjct: 243 QVNAALMAKAGSDALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKSILAWCLG 302

Query: 305 II 306
            I
Sbjct: 303 AI 304


>gi|15964271|ref|NP_384624.1| ornithine carbamoyltransferase [Sinorhizobium meliloti 1021]
 gi|307307008|ref|ZP_07586747.1| ornithine carbamoyltransferase [Sinorhizobium meliloti BL225C]
 gi|307320662|ref|ZP_07600075.1| ornithine carbamoyltransferase [Sinorhizobium meliloti AK83]
 gi|32699470|sp|Q92S99|OTC_RHIME RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|15073448|emb|CAC45090.1| Probable ornithine carbamoyltransferase [Sinorhizobium meliloti
           1021]
 gi|306893697|gb|EFN24470.1| ornithine carbamoyltransferase [Sinorhizobium meliloti AK83]
 gi|306901948|gb|EFN32547.1| ornithine carbamoyltransferase [Sinorhizobium meliloti BL225C]
          Length = 303

 Score =  237 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 214/305 (70%), Positives = 260/305 (85%), Gaps = 2/305 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT  +HF DLS +++++L  II+ A+  K++++     KPL+GK+LAMIFEKPSTRTRVS
Sbjct: 1   MT--RHFLDLSAMTATDLRTIIDDARVRKSATKAGTAEKPLAGKMLAMIFEKPSTRTRVS 58

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V M+ LGG+T+FLSG+EMQLGRAETIGDTAKVLSRYVDAI++RTT+H RLLE+ E+AT
Sbjct: 59  FDVGMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTDHRRLLEMAEHAT 118

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD+THPCQI+ADI+TFEEHRG VKGK  +W+GDGNN+LHSLIEG+ARF Y +N
Sbjct: 119 VPVINGLTDDTHPCQIMADILTFEEHRGPVKGKTIAWTGDGNNVLHSLIEGSARFGYRMN 178

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +A P+GSEP +++LNWARN GA V L H+A QAV GAHCV TDTWISMNQE +AR  +VF
Sbjct: 179 MAVPLGSEPHDKFLNWARNNGAEVLLSHEAEQAVAGAHCVVTDTWISMNQEHRARGHNVF 238

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+QVN +LM  A PDALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK+IL W
Sbjct: 239 QPYQVNGALMKHAAPDALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKSILAW 298

Query: 302 CFGII 306
           C G +
Sbjct: 299 CMGAV 303


>gi|116747513|ref|YP_844200.1| ornithine carbamoyltransferase [Syntrophobacter fumaroxidans MPOB]
 gi|116696577|gb|ABK15765.1| ornithine carbamoyltransferase [Syntrophobacter fumaroxidans MPOB]
          Length = 312

 Score =  237 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 125/302 (41%), Positives = 182/302 (60%), Gaps = 2/302 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             +    + ++S+  +  +I  A+ +K         + L  KV+A+IF KPSTRTRVSFE
Sbjct: 1   MKRDLLSIRDLSADEIVALISRAETMKRELAEGNLRQSLRNKVVALIFVKPSTRTRVSFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
            A+  LGG +IF+S  + Q+ R E + DTA+VL+RYVDAIV+RT     + EL  YA++P
Sbjct: 61  AAIYRLGGHSIFMSARDTQISRQEPLADTARVLARYVDAIVIRTFAQEDVTELARYASIP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD THPCQ++ D++T +E RG+++G   +W GDGNN+ HS I  AAR  + +++A
Sbjct: 121 VINGLTDRTHPCQVLGDLLTIKEKRGTLEGLHVAWIGDGNNVAHSWINAAARLGFTVSLA 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA--REEHVF 241
            P    P  E L+WA  QG    +   + +    +         +   + +       +F
Sbjct: 181 CPSQYLPDREILDWADTQGKGKVIMAASPKEAVASADAIYTDVWASMGQEEEADARRSIF 240

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           +PFQVN  L+S A   A+ +HCLPAHRGEE+ N V++GP S +FD+AENRLH Q A+L W
Sbjct: 241 RPFQVNEELLSAAPAHAIVLHCLPAHRGEEITNAVMEGPHSAIFDQAENRLHIQMALLDW 300

Query: 302 CF 303
             
Sbjct: 301 LL 302


>gi|85713647|ref|ZP_01044637.1| ornithine carbamoyltransferase [Nitrobacter sp. Nb-311A]
 gi|85699551|gb|EAQ37418.1| ornithine carbamoyltransferase [Nitrobacter sp. Nb-311A]
          Length = 308

 Score =  237 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 167/304 (54%), Positives = 217/304 (71%), Gaps = 2/304 (0%)

Query: 2   MTY-PKHFADLSNISSSNLSCIIEVAKKIKNSSENI-FENKPLSGKVLAMIFEKPSTRTR 59
           M+  P+HF DL ++ +  L  I++ +  +K   +     +KPL GK LAMIF+KPSTRTR
Sbjct: 1   MSKAPRHFLDLLDMGTGELRAILDASVAMKQRRKQGLIADKPLEGKTLAMIFDKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V M+ LGG+ I L+G+EMQLGR ETI DTA+VLSR+VD I++R  +H  L EL  +
Sbjct: 61  VSFDVGMRQLGGEAIMLTGAEMQLGRGETIADTARVLSRFVDIIMIRILSHDALTELATH 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ATVPVIN LT  +HPCQ++AD++TFEEHRG +KG+  +W+GD NN+L S    A RF++ 
Sbjct: 121 ATVPVINGLTRRSHPCQVMADVLTFEEHRGPIKGRTVAWTGDDNNVLASWAHAAERFSFN 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           LNIATP    P     +W R+ GAS+ +  D   AV+GA CV TDTW+SM  +      +
Sbjct: 181 LNIATPRELAPNKLLKDWIRSSGASIRVGTDPEAAVRGADCVVTDTWVSMGDKDGEHRHN 240

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + +P+QVN  LM +A P+ALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK IL
Sbjct: 241 LLRPYQVNAELMRLAKPEALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKGIL 300

Query: 300 LWCF 303
            WC 
Sbjct: 301 AWCL 304


>gi|14590603|ref|NP_142671.1| ornithine carbamoyltransferase [Pyrococcus horikoshii OT3]
 gi|6647686|sp|O58457|OTC_PYRHO RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|3257134|dbj|BAA29817.1| 317aa long hypothetical ornithine carbamoyltransferase [Pyrococcus
           horikoshii OT3]
          Length = 317

 Score =  237 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 149/306 (48%), Positives = 196/306 (64%), Gaps = 5/306 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             +    L + +   +  I+E AK  K   +    ++ L GK LAMIF+KPSTRTRVSFE
Sbjct: 6   KGRDLLCLQDYTPEEIWTILETAKMFKIWQKIGKPHRLLEGKTLAMIFQKPSTRTRVSFE 65

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VAM HLGG  ++L+  ++QL R ETI DTA+VLSRYVDAI+ R   H  + +L +YA+VP
Sbjct: 66  VAMAHLGGHALYLNAQDLQLRRGETIADTARVLSRYVDAIMARVYAHKDVEDLAKYASVP 125

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN L+D +HPCQ +AD MT  E +G++KG    + GDGNN+ HSL+    +    + +A
Sbjct: 126 VINGLSDFSHPCQALADYMTIWEKKGTIKGVKVVYVGDGNNVCHSLMIAGTKLGADVVVA 185

Query: 184 TPIGSEPRNEYLNWARNQGAS----VALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REE 238
           TP G EP  + + WA    A       L HD V+AVK A  ++TD W SM QE +A    
Sbjct: 186 TPEGYEPDKKVIKWAEQNAAESGGSFELLHDPVKAVKDADVIYTDVWASMGQEAEAEERR 245

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
            +F+PFQVN  L+  A  D +FMHCLPAHRGEEV ++V+D P SVV+DEAENRLH QKA+
Sbjct: 246 KIFRPFQVNKDLVKHAKSDYMFMHCLPAHRGEEVTDDVIDSPNSVVWDEAENRLHAQKAV 305

Query: 299 LLWCFG 304
           L    G
Sbjct: 306 LALLLG 311


>gi|163853474|ref|YP_001641517.1| ornithine carbamoyltransferase [Methylobacterium extorquens PA1]
 gi|254563403|ref|YP_003070498.1| ornithine carbamoyltransferase [Methylobacterium extorquens DM4]
 gi|163665079|gb|ABY32446.1| ornithine carbamoyltransferase [Methylobacterium extorquens PA1]
 gi|254270681|emb|CAX26685.1| ornithine carbamoyltransferase [Methylobacterium extorquens DM4]
          Length = 330

 Score =  236 bits (602), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 163/301 (54%), Positives = 218/301 (72%), Gaps = 2/301 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFE--NKPLSGKVLAMIFEKPSTRTRVSFE 63
           +HF DL ++S+  L  +++ +  +K           +PL+GK+LAM+F++PSTRTRVSF+
Sbjct: 27  RHFLDLKDLSAETLRGVLDTSAAMKRVRVKGQRAAERPLTGKMLAMVFDRPSTRTRVSFD 86

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VAM+ LGGDT+ L+G EMQLGR ET+ DTA+VLSR+VDAIV+RT +H  ++EL E+A VP
Sbjct: 87  VAMRELGGDTLMLTGKEMQLGRGETVSDTARVLSRFVDAIVIRTLDHGLVMELAEHAEVP 146

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINALT  +HPCQI+AD++TFEEHRG ++G+  +WSGD NN+L S +  AARF++ LN+A
Sbjct: 147 VINALTKASHPCQIMADLLTFEEHRGPIQGRTVAWSGDANNVLASWVHAAARFDFTLNVA 206

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQP 243
            P         ++WA+ +GA V    DA  AV+GA  V TD W+SM  + +    ++  P
Sbjct: 207 APRELAMPPALVDWAKREGARVNATTDAYAAVEGADLVVTDCWVSMGDDDEHFRHNLLSP 266

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           ++V+ +LM  A  DALFMHCLPAHRGEEV  EV+DGPQSVVFDEAENRLH QK IL WC 
Sbjct: 267 YRVDAALMKAASKDALFMHCLPAHRGEEVTAEVIDGPQSVVFDEAENRLHAQKGILAWCL 326

Query: 304 G 304
           G
Sbjct: 327 G 327


>gi|227820737|ref|YP_002824707.1| ornithine carbamoyltransferase [Sinorhizobium fredii NGR234]
 gi|227339736|gb|ACP23954.1| ornithine carbamoyltransferase [Sinorhizobium fredii NGR234]
          Length = 305

 Score =  236 bits (602), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 209/305 (68%), Positives = 257/305 (84%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT  +HF DLS ++ ++L  II+ A+  K +++     KPL+GK+LAMIFEKPSTRTRVS
Sbjct: 1   MTATRHFLDLSAMTGADLRTIIDDARVRKTATKAGTAEKPLAGKMLAMIFEKPSTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V M+ LGG+T+FLSG+EMQLGRAETIGDTAKVLSRYVDAI++RTT+H RLLEL E+AT
Sbjct: 61  FDVGMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTDHRRLLELAEHAT 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD+THPCQI+ADIMTFEEHRG V+GK  +W+GDGNN+LHSLIEG+ARF Y +N
Sbjct: 121 VPVINGLTDDTHPCQIMADIMTFEEHRGPVQGKTIAWTGDGNNVLHSLIEGSARFGYRMN 180

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +A P+GSEP++++LNWARN G  + L H+A QAV GAHCV TDTW+SMNQE +AR  +VF
Sbjct: 181 MAVPLGSEPQDKFLNWARNNGGEILLCHEAEQAVAGAHCVVTDTWVSMNQEHRARGHNVF 240

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+QVN +LM  A P+A+FMHCLPAHRGEEV +EV+DGPQSVVFD AENRLH QK+IL W
Sbjct: 241 QPYQVNAALMKHAVPEAVFMHCLPAHRGEEVTDEVIDGPQSVVFDAAENRLHAQKSILAW 300

Query: 302 CFGII 306
           C G +
Sbjct: 301 CLGAV 305


>gi|298674823|ref|YP_003726573.1| ornithine carbamoyltransferase [Methanohalobium evestigatum Z-7303]
 gi|298287811|gb|ADI73777.1| ornithine carbamoyltransferase [Methanohalobium evestigatum Z-7303]
          Length = 303

 Score =  236 bits (602), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 131/301 (43%), Positives = 191/301 (63%), Gaps = 1/301 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH   ++++S   +  +++ A+ +K         + L  K LAMIFEKPSTRTRVSFEV
Sbjct: 1   MKHLISMADLSDEVIHELLDSAQDLKEKRARDKVTELLKNKSLAMIFEKPSTRTRVSFEV 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           AM  LGG  ++L+  ++QL R E I DTA VLSRYV  I  R  +H  + ++ +Y+TVPV
Sbjct: 61  AMSDLGGHGLYLNYKDIQLDRGEPISDTAAVLSRYVHGIAGRVNSHDTIKQMAKYSTVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INAL+D  HPCQI+AD++T +E++   K   F+W GDGNN+ +S I G A     + +A 
Sbjct: 121 INALSDMEHPCQILADLLTIQEYKNRTKNLKFAWVGDGNNVCNSAILGCAIVGMDIVVAC 180

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQP 243
           P G EP +  +   +  G +V + HD  +A + A  ++TD WISM  E +  +  +    
Sbjct: 181 PEGYEPNSYIVEQGKKIGGNVTITHDPAEAAENADILYTDVWISMGDEEEREKRLNDLGG 240

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +Q+N +L+++A  D + MHCLPAHRGEE+  +VL+G  SV+FD+AENRLH QKA++L   
Sbjct: 241 YQINSNLVNLAKRDVIVMHCLPAHRGEEITEDVLNGSHSVIFDQAENRLHAQKALILKLM 300

Query: 304 G 304
           G
Sbjct: 301 G 301


>gi|315229813|ref|YP_004070249.1| ornithine carbamoyltransferase [Thermococcus barophilus MP]
 gi|315182841|gb|ADT83026.1| ornithine carbamoyltransferase [Thermococcus barophilus MP]
          Length = 315

 Score =  236 bits (602), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 144/304 (47%), Positives = 193/304 (63%), Gaps = 5/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +    L + +   +  I+E AK +K  ++    ++ L GK LAMIF+KPSTRTR+SFEV 
Sbjct: 8   RDILCLQDFTREEIETILETAKMMKIWNKIGKPHRVLEGKTLAMIFQKPSTRTRISFEVG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  ++L+  ++QL R ETI DTA+VLSRYVD I+ R   H  + +L +YA+VPVI
Sbjct: 68  MYQLGGYALYLNAQDLQLRRGETIADTARVLSRYVDGIMARVYAHKDVEDLAKYASVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D +HPCQ +AD MT  E +G ++G    + GDGNN+ HSL+    +    + +ATP
Sbjct: 128 NGLSDFSHPCQALADYMTIWEKKGRIQGIKVVYVGDGNNVAHSLMIAGTKLGADVVVATP 187

Query: 186 IGSEPRNEYLNWARNQGAS----VALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHV 240
            G EP  + + WA    A       L HD V AVK A  ++TD W SM QE +A     +
Sbjct: 188 EGYEPNEKVIKWAEKNAAESGGSFELLHDPVNAVKDADVIYTDVWASMGQEAEAEMRRKI 247

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+PFQVN  L+  A PD +FMHCLPAHRGEEV ++V+D P SVV+D+AENRLH QKA L 
Sbjct: 248 FKPFQVNKELVKHAKPDYIFMHCLPAHRGEEVTDDVIDSPNSVVWDQAENRLHAQKAALA 307

Query: 301 WCFG 304
              G
Sbjct: 308 LVMG 311


>gi|241202940|ref|YP_002974036.1| ornithine carbamoyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240856830|gb|ACS54497.1| ornithine carbamoyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 304

 Score =  236 bits (602), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 213/305 (69%), Positives = 258/305 (84%), Gaps = 1/305 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M+ PKHF DLS ++S++L  I+  A   K + +    +KPL+GK+LAMIFEKPSTRTRVS
Sbjct: 1   MS-PKHFLDLSAVTSADLRTIMNDALARKQAFKAGQGDKPLAGKMLAMIFEKPSTRTRVS 59

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V M+ LGG+T+FLSG+EMQLGRAETIGDTAKVLSRYVDAI++RTT HSRL+EL ++AT
Sbjct: 60  FDVGMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTEHSRLVELAQHAT 119

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVINALTD+THPCQI+ADIMTFEEHRG +KGK  +W+GDGNN+LHSL+EGAARF Y +N
Sbjct: 120 VPVINALTDDTHPCQIMADIMTFEEHRGPIKGKTIAWTGDGNNVLHSLVEGAARFGYRMN 179

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +A P+GSEP++ YLNWARN+GA + L HDA +AV G  CV TDTW+SMNQE +AR  +VF
Sbjct: 180 MAVPLGSEPKDHYLNWARNEGAEIMLCHDADRAVAGVDCVVTDTWVSMNQEHRARGHNVF 239

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+QVN +LM+ A  DALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK+IL W
Sbjct: 240 QPYQVNAALMAKAGNDALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKSILAW 299

Query: 302 CFGII 306
           C G I
Sbjct: 300 CLGAI 304


>gi|153007740|ref|YP_001368955.1| ornithine carbamoyltransferase [Ochrobactrum anthropi ATCC 49188]
 gi|151559628|gb|ABS13126.1| ornithine carbamoyltransferase [Ochrobactrum anthropi ATCC 49188]
          Length = 312

 Score =  236 bits (602), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 199/298 (66%), Positives = 241/298 (80%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF DLS + +S L  I+E AK  K   +     +P +GKVLAMIFEKPSTRTRVSF+V 
Sbjct: 8   KHFIDLSAVPASELRAIMEDAKARKARLKAGEIERPFAGKVLAMIFEKPSTRTRVSFDVG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+GSEMQLGR+ETI DTAKVLSRYVDAI++RTT+H R+LEL EYATVPVI
Sbjct: 68  MRQLGGETIMLTGSEMQLGRSETIADTAKVLSRYVDAIMIRTTSHERMLELAEYATVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+THPCQI+AD++T+EEHRG +KGK F+W GDGNN+LHSL+E AARF++ +NIATP
Sbjct: 128 NALTDDTHPCQIMADVLTYEEHRGPIKGKTFAWMGDGNNVLHSLVEAAARFDFNVNIATP 187

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            GSEP+++Y++WA+  GAS+    D  +A  GA C+ TDTW+SM QE  AR  +VF P+Q
Sbjct: 188 EGSEPKSQYVDWAKANGASIMSTIDPERAANGADCIVTDTWVSMGQEDHARGHNVFMPYQ 247

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN  LM+ A P ALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QKAIL WC 
Sbjct: 248 VNARLMAKADPKALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKAILAWCL 305


>gi|18976966|ref|NP_578323.1| ornithine carbamoyltransferase [Pyrococcus furiosus DSM 3638]
 gi|20141649|sp|Q51742|OTC_PYRFU RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|40889330|pdb|1PVV|A Chain A, Refined Structure Of Pyrococcus Furiosus Ornithine
           Carbamoyltransferase At 1.87 A
 gi|18892590|gb|AAL80718.1| ornithine carbamoyltransferase [Pyrococcus furiosus DSM 3638]
          Length = 315

 Score =  236 bits (602), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 150/304 (49%), Positives = 199/304 (65%), Gaps = 5/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +    L + ++  +  I+E AK  K   +    ++ L GK LAMIF+KPSTRTRVSFEVA
Sbjct: 8   RDLLCLQDYTAEEIWTILETAKMFKIWQKIGKPHRLLEGKTLAMIFQKPSTRTRVSFEVA 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M HLGG  ++L+  ++QL R ETI DTA+VLSRYVDAI+ R  +H  + +L +YATVPVI
Sbjct: 68  MAHLGGHALYLNAQDLQLRRGETIADTARVLSRYVDAIMARVYDHKDVEDLAKYATVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D +HPCQ +AD MT  E +G++KG    + GDGNN+ HSL+    +    + +ATP
Sbjct: 128 NGLSDFSHPCQALADYMTIWEKKGTIKGVKVVYVGDGNNVAHSLMIAGTKLGADVVVATP 187

Query: 186 IGSEPRNEYLNWARNQGAS----VALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHV 240
            G EP  + + WA    A       L HD V+AVK A  ++TD W SM QE +A     +
Sbjct: 188 EGYEPDEKVIKWAEQNAAESGGSFELLHDPVKAVKDADVIYTDVWASMGQEAEAEERRKI 247

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+PFQVN  L+  A PD +FMHCLPAHRGEEV ++V+D P SVV+D+AENRLH QKA+L 
Sbjct: 248 FRPFQVNKDLVKHAKPDYMFMHCLPAHRGEEVTDDVIDSPNSVVWDQAENRLHAQKAVLA 307

Query: 301 WCFG 304
              G
Sbjct: 308 LVMG 311


>gi|116250322|ref|YP_766160.1| ornithine carbamoyltransferase [Rhizobium leguminosarum bv. viciae
           3841]
 gi|226739204|sp|Q1MLV9|OTC_RHIL3 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|115254970|emb|CAK06044.1| putative ornithine carbamoyltransferase [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 304

 Score =  236 bits (602), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 213/305 (69%), Positives = 258/305 (84%), Gaps = 1/305 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M+ PKHF DLS ++S++L  I+  A   K + +    +KPL+GK+LAMIFEKPSTRTRVS
Sbjct: 1   MS-PKHFLDLSAVTSADLRTIMNDALARKQAFKAGTGDKPLAGKMLAMIFEKPSTRTRVS 59

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V M+ LGG+T+FLSG+EMQLGRAETIGDTAKVLSRYVDAI++RTT HSRLLEL ++AT
Sbjct: 60  FDVGMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTEHSRLLELAQHAT 119

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVINALTD+THPCQI+ADIMTFEEHRG +KGK  +W+GDGNN+LHSL+EGAARF Y +N
Sbjct: 120 VPVINALTDDTHPCQIMADIMTFEEHRGPIKGKTIAWTGDGNNVLHSLVEGAARFGYRMN 179

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +A P+GSEP++ YLNWARN+GA + L HDA +AV G  CV TDTW+SMNQE +AR  +VF
Sbjct: 180 MAVPLGSEPKDHYLNWARNEGAEIMLCHDADRAVAGVDCVVTDTWVSMNQEHRARGHNVF 239

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+QVN +LM+ A  DALFMHCLPAHRGEEV ++V+DGPQSVVFDEAENRLH QK+IL W
Sbjct: 240 QPYQVNAALMAKAGNDALFMHCLPAHRGEEVTDDVIDGPQSVVFDEAENRLHAQKSILAW 299

Query: 302 CFGII 306
           C G I
Sbjct: 300 CLGAI 304


>gi|1430923|emb|CAA67609.1| ornithine carbamoyltransferase [Pyrococcus furiosus]
          Length = 314

 Score =  236 bits (601), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 150/303 (49%), Positives = 199/303 (65%), Gaps = 4/303 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +    L + ++  +  I+E AK  K   +    ++ L GK LAMIF+KPSTRTRVSFEVA
Sbjct: 8   RDLLCLQDYTAEEIWTILETAKMFKIWQKIGKPHRLLEGKTLAMIFQKPSTRTRVSFEVA 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M HLGG  ++L+  ++QL R ETI DTA+VLSRYVDAI+ R  +H  + +L +YATVPVI
Sbjct: 68  MAHLGGHALYLNAQDLQLRRGETIADTARVLSRYVDAIMARVYDHKDVEDLAKYATVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D +HPCQ +AD MT  E +G++KG    + GDGNN+ HSL+    +    + +ATP
Sbjct: 128 NGLSDFSHPCQALADYMTIWEKKGTIKGVKVVYVGDGNNVAHSLMIAGTKLGADVVVATP 187

Query: 186 IGSEPRNEYLNWARNQ---GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHVF 241
            G EP  + + WA        S  L HD V+AVK A  ++TD W SM QE +A     +F
Sbjct: 188 EGYEPDEKVIKWAEQNAAESGSFELLHDPVKAVKDADVIYTDVWASMGQEAEAEERRKIF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           +PFQVN  L+  A PD +FMHCLPAHRGEEV ++V+D P SVV+D+AENRLH QKA+L  
Sbjct: 248 RPFQVNKDLVKHAKPDYMFMHCLPAHRGEEVTDDVIDSPNSVVWDQAENRLHAQKAVLAL 307

Query: 302 CFG 304
             G
Sbjct: 308 VMG 310


>gi|156743016|ref|YP_001433145.1| ornithine carbamoyltransferase [Roseiflexus castenholzii DSM 13941]
 gi|156234344|gb|ABU59127.1| ornithine carbamoyltransferase [Roseiflexus castenholzii DSM 13941]
          Length = 313

 Score =  236 bits (601), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 141/313 (45%), Positives = 195/313 (62%), Gaps = 11/313 (3%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK------PLSGKVLAMIFEKPSTR 57
             +HF   ++++ + +  +++ A+ +K    N    +      PL GK LA++FEKPS R
Sbjct: 1   MVRHFLSAADLTRAEVEALLDRAQTLKAEWRNGGHPRDANGALPLQGKTLALVFEKPSLR 60

Query: 58  TRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELT 117
           TRV+FE  M  LGG   +LS +++ +G  E++ D A+ LSR+V AI  R   H+ +  L 
Sbjct: 61  TRVAFEAGMTQLGGHGSYLSANDIDMGGRESVPDVARNLSRWVQAIAARVFRHATVETLA 120

Query: 118 EYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFN 177
            YATVPVINAL+D  HPCQ +AD++T  EH G ++G   ++ GDGNN+ HSL+   A   
Sbjct: 121 RYATVPVINALSDREHPCQALADMLTLHEHYGRLEGLTLAYVGDGNNVAHSLMLLGATLG 180

Query: 178 YLLNIATPIGSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF 233
             + I  P+   P  E L      A  +G SV +    V+AV GA  V+TD W SM QE 
Sbjct: 181 VNVRIGCPLDYRPDPEILALAERRAIERGVSVEVTPSPVEAVLGADAVYTDVWTSMGQEH 240

Query: 234 KA-REEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRL 292
           +A R   VFQP+QVN +LM+ A   ALFMHCLPAHRGEEV  +V+DGPQSVVF++AENRL
Sbjct: 241 EAARRRPVFQPYQVNAALMTHARSGALFMHCLPAHRGEEVTPDVIDGPQSVVFEQAENRL 300

Query: 293 HTQKAILLWCFGI 305
           H QKA++L   G+
Sbjct: 301 HVQKALILTLLGL 313


>gi|222054222|ref|YP_002536584.1| ornithine carbamoyltransferase [Geobacter sp. FRC-32]
 gi|221563511|gb|ACM19483.1| ornithine carbamoyltransferase [Geobacter sp. FRC-32]
          Length = 303

 Score =  236 bits (601), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 130/303 (42%), Positives = 179/303 (59%), Gaps = 2/303 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K F  LS  S S L  I  + +++K   +   E+  L GK LAMIFEK STRTRVSFE
Sbjct: 1   MNKDFLALSQFSKSELDAIFTLTRELKQKQKRGEEHHLLKGKTLAMIFEKSSTRTRVSFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M  LGG  +F+S  + Q+GR E I DTA+V++RY D +++RT     + E   Y++VP
Sbjct: 61  VGMYQLGGHPLFISTKDSQMGRGEPIKDTARVMARYCDGVMIRTYGQEIVEEFARYSSVP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           +IN LTD  HPCQI+AD+ T  EHRGS +G   +W GDGNN+ ++ IE AA F + L +A
Sbjct: 121 IINGLTDLHHPCQIMADLFTVIEHRGSYEGLKIAWVGDGNNMANTWIEAAAIFGFDLTLA 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWI--SMNQEFKAREEHVF 241
            P G EP    + WA     S  +  D  Q       V           +  + + E  F
Sbjct: 181 CPKGYEPDAAAMQWALANATSSIVLTDDPQEAVKDADVVNTDVWASMGQEAEQNKREKDF 240

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
             +Q+N +L+ +A  + + +HCLPAHRGEE+ ++V++GP S V+DEAENRLH QKAI+  
Sbjct: 241 AGYQLNEALLDLAKGNCMVLHCLPAHRGEEITDDVIEGPHSAVWDEAENRLHVQKAIMAT 300

Query: 302 CFG 304
             G
Sbjct: 301 LMG 303


>gi|62289296|ref|YP_221089.1| ornithine carbamoyltransferase [Brucella abortus bv. 1 str. 9-941]
 gi|82699226|ref|YP_413800.1| ornithine carbamoyltransferase [Brucella melitensis biovar Abortus
           2308]
 gi|161511125|ref|NP_540537.2| ornithine carbamoyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|189023549|ref|YP_001934317.1| ornithine carbamoyltransferase [Brucella abortus S19]
 gi|225851848|ref|YP_002732081.1| ornithine carbamoyltransferase [Brucella melitensis ATCC 23457]
 gi|254688614|ref|ZP_05151868.1| ornithine carbamoyltransferase [Brucella abortus bv. 6 str. 870]
 gi|254693096|ref|ZP_05154924.1| ornithine carbamoyltransferase [Brucella abortus bv. 3 str. Tulya]
 gi|254696737|ref|ZP_05158565.1| ornithine carbamoyltransferase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254729647|ref|ZP_05188225.1| ornithine carbamoyltransferase [Brucella abortus bv. 4 str. 292]
 gi|256044029|ref|ZP_05446940.1| ornithine carbamoyltransferase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256112825|ref|ZP_05453746.1| ornithine carbamoyltransferase [Brucella melitensis bv. 3 str.
           Ether]
 gi|256256862|ref|ZP_05462398.1| ornithine carbamoyltransferase [Brucella abortus bv. 9 str. C68]
 gi|256264637|ref|ZP_05467169.1| ornithine carbamoyltransferase [Brucella melitensis bv. 2 str.
           63/9]
 gi|260545949|ref|ZP_05821690.1| ornithine carbamoyltransferase [Brucella abortus NCTC 8038]
 gi|260563389|ref|ZP_05833875.1| ornithine carbamoyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|260754086|ref|ZP_05866434.1| ornithine carbamoyltransferase [Brucella abortus bv. 6 str. 870]
 gi|260757307|ref|ZP_05869655.1| ornithine carbamoyltransferase [Brucella abortus bv. 4 str. 292]
 gi|260761130|ref|ZP_05873473.1| ornithine carbamoyltransferase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883113|ref|ZP_05894727.1| ornithine carbamoyltransferase [Brucella abortus bv. 9 str. C68]
 gi|261213332|ref|ZP_05927613.1| ornithine carbamoyltransferase [Brucella abortus bv. 3 str. Tulya]
 gi|265990441|ref|ZP_06102998.1| ornithine carbamoyltransferase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265994269|ref|ZP_06106826.1| ornithine carbamoyltransferase [Brucella melitensis bv. 3 str.
           Ether]
 gi|297247713|ref|ZP_06931431.1| ornithine carbamoyltransferase [Brucella abortus bv. 5 str. B3196]
 gi|32699464|sp|Q8YFA2|OTC_BRUME RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|75497348|sp|Q57F56|OTC_BRUAB RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|123546920|sp|Q2YPH2|OTC_BRUA2 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|62195428|gb|AAX73728.1| ArgF, ornithine carbamoyltransferase [Brucella abortus bv. 1 str.
           9-941]
 gi|82615327|emb|CAJ10288.1| Aspartate carbamoyltransferase:Ornithine
           carbamoyltransferase:Aspartate/ornithine
           carbamoyltransferase:Aspartate/ornithine ca [Brucella
           melitensis biovar Abortus 2308]
 gi|189019121|gb|ACD71843.1| ornithine carbamoyltransferase [Brucella abortus S19]
 gi|225640213|gb|ACO00127.1| ornithine carbamoyltransferase [Brucella melitensis ATCC 23457]
 gi|260097356|gb|EEW81231.1| ornithine carbamoyltransferase [Brucella abortus NCTC 8038]
 gi|260153405|gb|EEW88497.1| ornithine carbamoyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|260667625|gb|EEX54565.1| ornithine carbamoyltransferase [Brucella abortus bv. 4 str. 292]
 gi|260671562|gb|EEX58383.1| ornithine carbamoyltransferase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260674194|gb|EEX61015.1| ornithine carbamoyltransferase [Brucella abortus bv. 6 str. 870]
 gi|260872641|gb|EEX79710.1| ornithine carbamoyltransferase [Brucella abortus bv. 9 str. C68]
 gi|260914939|gb|EEX81800.1| ornithine carbamoyltransferase [Brucella abortus bv. 3 str. Tulya]
 gi|262765382|gb|EEZ11171.1| ornithine carbamoyltransferase [Brucella melitensis bv. 3 str.
           Ether]
 gi|263001225|gb|EEZ13800.1| ornithine carbamoyltransferase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263095004|gb|EEZ18712.1| ornithine carbamoyltransferase [Brucella melitensis bv. 2 str.
           63/9]
 gi|297174882|gb|EFH34229.1| ornithine carbamoyltransferase [Brucella abortus bv. 5 str. B3196]
 gi|326408344|gb|ADZ65409.1| ornithine carbamoyltransferase [Brucella melitensis M28]
 gi|326538058|gb|ADZ86273.1| ornithine carbamoyltransferase [Brucella melitensis M5-90]
          Length = 312

 Score =  236 bits (601), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 197/298 (66%), Positives = 239/298 (80%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF DLS + ++ L  I+E AK  K   +     +P +GKVLAMIFEK STRTRVSF+V 
Sbjct: 8   KHFIDLSTVPATELRAILEDAKARKARLKAGEVERPYAGKVLAMIFEKLSTRTRVSFDVG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+GSEMQLGR+ETI DTAKVLSRYVDAI++RTT H R+LEL EYATVPVI
Sbjct: 68  MRQLGGETIMLTGSEMQLGRSETIADTAKVLSRYVDAIMIRTTAHERMLELAEYATVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+THPCQI+AD++T+EEHRG +KGK F+W GDGNN+LHSL+E AARF++ +NIATP
Sbjct: 128 NALTDDTHPCQIMADVLTYEEHRGPIKGKTFAWMGDGNNVLHSLVEAAARFDFNVNIATP 187

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            GSEP+++Y++WAR  GA +    D  +A  GA C+ TDTW+SM QE  AR  +VF P+Q
Sbjct: 188 KGSEPKSQYIDWARANGAGIMSTTDPEKAASGADCIVTDTWVSMGQEDHARGHNVFIPYQ 247

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN +LM+ A P ALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QKAIL WC 
Sbjct: 248 VNANLMAKADPKALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKAILAWCL 305


>gi|3341473|emb|CAA73260.1| ornithine carbamoyltransferase [Pyrococcus furiosus DSM 3638]
          Length = 315

 Score =  235 bits (600), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 150/304 (49%), Positives = 199/304 (65%), Gaps = 5/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +    L + ++  +  I+E AK  K   +    ++ L GK LAMIF+KPSTRTRVSFEVA
Sbjct: 8   RDLLCLQDYTAEEIWTILETAKMFKIWQKIGKPHRLLEGKTLAMIFQKPSTRTRVSFEVA 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M HLGG  ++L+  ++QL R ETI DTA+VLSRYVDAI+ R  +H  + +L +YATVPVI
Sbjct: 68  MAHLGGHALYLNAQDLQLRRGETIADTARVLSRYVDAIMARVYDHKDVEDLAKYATVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D +HPCQ +AD MT  E +G++KG    + GDGNN+ HSL+    +    + +ATP
Sbjct: 128 NGLSDFSHPCQALADYMTIWEKKGTIKGVKVVYVGDGNNVAHSLMIAGTKLGADVVVATP 187

Query: 186 IGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHV 240
            G EP  + + WA         S  L HD V+AVK A  ++TD W SM QE +A     +
Sbjct: 188 EGYEPDEKVIKWAEQNAAERSGSFELLHDPVKAVKDADVIYTDVWASMGQEAEAEERRKI 247

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+PFQVN  L+  A PD +FMHCLPAHRGEEV ++V+D P SVV+D+AENRLH QKA+L 
Sbjct: 248 FRPFQVNKDLVKHAKPDYMFMHCLPAHRGEEVTDDVIDSPNSVVWDQAENRLHAQKAVLA 307

Query: 301 WCFG 304
              G
Sbjct: 308 LVMG 311


>gi|322421563|ref|YP_004200786.1| ornithine carbamoyltransferase [Geobacter sp. M18]
 gi|320127950|gb|ADW15510.1| ornithine carbamoyltransferase [Geobacter sp. M18]
          Length = 303

 Score =  235 bits (600), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 133/302 (44%), Positives = 193/302 (63%), Gaps = 2/302 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K F  LS  + + L  +  + K++K  +++  E+  L GK LAMIFEK STRTR+SFE
Sbjct: 1   MKKDFLALSQFTKAELDAMFALTKELKEKTKSGVEHHLLKGKTLAMIFEKSSTRTRISFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M  LGG  +F+S  + Q+GR E I D+A+V++RY D +++RT   + + E  +YA+VP
Sbjct: 61  VGMYQLGGHPLFISSKDSQMGRGEPIKDSARVMARYCDGVMIRTFAQATVEEFAKYASVP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           +IN LTD  HPCQI+AD+ T  E +GS  G  F+W GDGNN+ +S IE AA F + L +A
Sbjct: 121 IINGLTDLHHPCQIMADVFTVIEQKGSYDGLKFAWIGDGNNMANSWIEAAAIFGFDLTLA 180

Query: 184 TPIGSEPRNEYLNWARNQ-GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVF 241
            P G +P  + L WA+    + + +  D  +A + A  + TD W SM QE + +  E  F
Sbjct: 181 CPQGYDPNPQVLAWAQKNATSRIVITRDPKEAAQDADVLNTDVWASMGQEEEQKIREQAF 240

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
             +Q+N  L+ +A  +A+ +HCLPAHRGEE+ ++V++GP S V+DEAENRLH QKAI+  
Sbjct: 241 AGYQLNEELLDLAKGNAMVLHCLPAHRGEEISDDVIEGPHSAVWDEAENRLHVQKAIMAT 300

Query: 302 CF 303
             
Sbjct: 301 LM 302


>gi|284163618|ref|YP_003401897.1| ornithine carbamoyltransferase [Haloterrigena turkmenica DSM 5511]
 gi|284013273|gb|ADB59224.1| ornithine carbamoyltransferase [Haloterrigena turkmenica DSM 5511]
          Length = 309

 Score =  235 bits (600), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 134/302 (44%), Positives = 188/302 (62%), Gaps = 2/302 (0%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           T P+HF D+ +++ + L  I+E A + K +     +++ L G+ L MIF+KPSTRTRVSF
Sbjct: 8   TEPRHFLDVDDVTPAELDAILERAAEYKRAQHAGEDHEDLEGQTLGMIFQKPSTRTRVSF 67

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E  M  LGG  +FL   ++QLGR E + DT++ LSRYVDA++ R   H  +  L EY++V
Sbjct: 68  ETGMTQLGGHAVFLGEDDIQLGRGEPLKDTSRTLSRYVDAVMARVFKHGNMEVLAEYSSV 127

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PV+N LTD+ HPCQ +AD++T  E  G  +    +W GDGNN+  S   GAA  +  L +
Sbjct: 128 PVVNGLTDDAHPCQTLADLLTIREQEGGFEDVSAAWIGDGNNVAQSFAVGAALTDIDLTV 187

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVF 241
           ATP G    +  L  AR+ G      HD V+A   A  ++TD WISM QE +     + F
Sbjct: 188 ATPEGYGIDDAVLERARDLGGDPTTTHDPVEAATDADIIYTDVWISMGQEDERDVRMNDF 247

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           + FQ++  L+     DA  MHCLPAHRGEE+ ++V++  +SVVFD+AENRLH QKA+L W
Sbjct: 248 EGFQISADLLEHTA-DASVMHCLPAHRGEEITDDVIESDRSVVFDQAENRLHAQKALLSW 306

Query: 302 CF 303
             
Sbjct: 307 LL 308


>gi|328544889|ref|YP_004304998.1| Ornithine carbamoyltransferase (OTCase) [polymorphum gilvum
           SL003B-26A1]
 gi|326414631|gb|ADZ71694.1| Ornithine carbamoyltransferase (OTCase) [Polymorphum gilvum
           SL003B-26A1]
          Length = 309

 Score =  235 bits (600), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 166/300 (55%), Positives = 215/300 (71%), Gaps = 1/300 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-PLSGKVLAMIFEKPSTRTRVSFEV 64
           +HF DL+      L  I+E  K++K     +   + PL+GKVLAMIFE+PSTRTR+SF+V
Sbjct: 8   RHFLDLTEFDGDQLRAILERGKQLKAVRNGVRRGEGPLAGKVLAMIFEQPSTRTRISFDV 67

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M+ LGG+T+ L+G+EMQLGR ETI DTA+VLSR+VDAI++R  + + L EL   ATVPV
Sbjct: 68  GMRELGGETLMLTGAEMQLGRGETIADTARVLSRFVDAIMIRILDDNDLRELAANATVPV 127

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LT  +HPCQI+AD+MTFEEHRG +KG+  +W+GD NN+L S +  A R ++ L IAT
Sbjct: 128 INGLTKKSHPCQIMADLMTFEEHRGPIKGRSVAWTGDSNNVLASWVHAAPRMDFELRIAT 187

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P    P  + ++ AR +GAS+ +  D  +AVKG+ CV TD W+SM  +      ++  P+
Sbjct: 188 PPELSPPADLIDRARAEGASIMVTDDPFEAVKGSDCVVTDCWVSMGDDDTQSRHNLLSPY 247

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QVN  LM+ AH DALFMHCLPAHRGEEV +EV+DGP SVVFDEAENRLH QK IL WC G
Sbjct: 248 QVNARLMAHAHKDALFMHCLPAHRGEEVTSEVMDGPNSVVFDEAENRLHAQKGILAWCLG 307


>gi|190890220|ref|YP_001976762.1| ornithine carbamoyltransferase [Rhizobium etli CIAT 652]
 gi|190695499|gb|ACE89584.1| ornithine carbamoyltransferase protein [Rhizobium etli CIAT 652]
          Length = 304

 Score =  235 bits (600), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 215/302 (71%), Positives = 258/302 (85%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           PKHF DLS ++S++L  I+  A   K + +    +KPL+GK+LAMIFEKPSTRTRVSF+V
Sbjct: 3   PKHFLDLSAVTSADLRTIMNDALVRKQAFKAGQGDKPLAGKMLAMIFEKPSTRTRVSFDV 62

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M+ LGG+T+FLSG+EMQLGRAETIGDTAKVLSRYVDAI++RTT HSRLLEL E+ATVPV
Sbjct: 63  GMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTEHSRLLELAEHATVPV 122

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALTD+THPCQI+ADIMTFEEHRGS+KGK  +W+GDGNN+LHSL+EGAARF Y +N+A 
Sbjct: 123 INALTDDTHPCQIMADIMTFEEHRGSIKGKTIAWTGDGNNVLHSLVEGAARFGYRMNMAV 182

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P+GSEP++ YLNWARN+GA + L HDA +AV+G  CV TDTW+SMNQE +AR  +VFQP+
Sbjct: 183 PLGSEPKDHYLNWARNEGAEIMLCHDADRAVEGVDCVVTDTWVSMNQEHRARGHNVFQPY 242

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QVN +LM+ A  DALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK+IL WC G
Sbjct: 243 QVNAALMAKAGSDALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKSILAWCLG 302

Query: 305 II 306
            I
Sbjct: 303 AI 304


>gi|150395356|ref|YP_001325823.1| ornithine carbamoyltransferase [Sinorhizobium medicae WSM419]
 gi|150026871|gb|ABR58988.1| ornithine carbamoyltransferase [Sinorhizobium medicae WSM419]
          Length = 303

 Score =  235 bits (600), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 211/305 (69%), Positives = 258/305 (84%), Gaps = 2/305 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT  +HF DLS +++++L  II+ A+  K++++     KPL+GK+LAMIFEKPSTRTRVS
Sbjct: 1   MT--RHFLDLSAMAATDLRTIIDDARVRKSATKAGTAEKPLAGKMLAMIFEKPSTRTRVS 58

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V M+ LGG+T+FLSG+EMQLGRAETIGDTAKVLSRYVDAI++RTT+H RLLE+ E+AT
Sbjct: 59  FDVGMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTDHRRLLEMAEHAT 118

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD+THPCQI+ADI+TFEEHRG VKGK  +W+GDGNN+LHSLIEG+ARF Y +N
Sbjct: 119 VPVINGLTDDTHPCQIMADILTFEEHRGPVKGKTIAWTGDGNNVLHSLIEGSARFGYRMN 178

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +A P+GSEP +++LNWARN G  V L H+  QAV GAHCV TDTWISMNQE +AR  +VF
Sbjct: 179 MAVPLGSEPHDKFLNWARNNGGEVLLSHEPEQAVAGAHCVVTDTWISMNQEHRARGHNVF 238

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+QVN +LM  A PDA+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK+IL W
Sbjct: 239 QPYQVNGALMKHAAPDAVFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKSILAW 298

Query: 302 CFGII 306
           C G +
Sbjct: 299 CMGAV 303


>gi|284161509|ref|YP_003400132.1| ornithine carbamoyltransferase [Archaeoglobus profundus DSM 5631]
 gi|284011506|gb|ADB57459.1| ornithine carbamoyltransferase [Archaeoglobus profundus DSM 5631]
          Length = 305

 Score =  235 bits (599), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 140/302 (46%), Positives = 194/302 (64%), Gaps = 1/302 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH   +++++   L  I+++A+K+K           L  K LAMIFE PSTRTR+SFEV
Sbjct: 1   MKHLISMADLTPEELEEILKLAEKLKEERYKGRVTDYLKNKSLAMIFELPSTRTRISFEV 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           AM  LGG  ++L+ +++QLGR E I DTA+VLSRYV A++MR   H  +LE  +Y+TVPV
Sbjct: 61  AMTDLGGHALYLNWNDLQLGRGEPIKDTARVLSRYVHAVMMRVRKHETILEFAKYSTVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN L+D  HPCQ+IAD++T +E++G +K    +W GDGNN+ +SLI  +A     + + T
Sbjct: 121 INGLSDLEHPCQVIADLLTIKEYKGDLKSVRLTWIGDGNNVCNSLILASALTGMEMVVCT 180

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQP 243
           P G EP  E +  A   GA +    D ++AV+ A  ++TD W+SM QE + R     F  
Sbjct: 181 PKGYEPNKEIVEKALKMGAKLTFESDPLKAVENADVIYTDVWVSMGQERERRKRLKAFTG 240

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +QV   L+  A  + + MHCLPAHRGEE+  EVL+G  S+VFD+AENRLH QKAILL   
Sbjct: 241 YQVTQKLVDSAKTNVVVMHCLPAHRGEEITEEVLEGEHSIVFDQAENRLHAQKAILLKLI 300

Query: 304 GI 305
           G 
Sbjct: 301 GK 302


>gi|319785567|ref|YP_004145043.1| ornithine carbamoyltransferase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317171455|gb|ADV14993.1| ornithine carbamoyltransferase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 303

 Score =  235 bits (599), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 188/299 (62%), Positives = 232/299 (77%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF DLS +S  +L  +++ A   K   +     KPL GKVLAMIF+KPSTRTRVSF+V 
Sbjct: 4   RHFTDLSTVSEGDLRLMLDDAVVRKARLKAGERTKPLEGKVLAMIFDKPSTRTRVSFDVG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+G+EMQLGR+ETI DTAKVLSRYVDAI++RTT+H RLLELTE ATVPVI
Sbjct: 64  MRQLGGETIMLTGTEMQLGRSETIADTAKVLSRYVDAIMIRTTSHERLLELTENATVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+THPCQ++ADIMTFEEHRG V GK  +W+GDGNN+LHSL+E +ARF + LN+A P
Sbjct: 124 NGLTDDTHPCQLMADIMTFEEHRGPVAGKTIAWTGDGNNVLHSLLEASARFRFNLNVAVP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            GSEP  ++++W++  G  +       +AV  A C+ TD W+SM QE +AR  +VF P+Q
Sbjct: 184 EGSEPAQKHIDWSQAHGGKLHFTRSPEEAVDQADCIVTDCWVSMGQEHRARGHNVFSPYQ 243

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           VN  LM+ A PDALFMHCLPAHRGEEV +EV+DGP SVVFDEAENRLH QKA+L WC G
Sbjct: 244 VNAKLMARAKPDALFMHCLPAHRGEEVTDEVIDGPHSVVFDEAENRLHAQKAVLAWCLG 302


>gi|289581426|ref|YP_003479892.1| ornithine carbamoyltransferase [Natrialba magadii ATCC 43099]
 gi|289530979|gb|ADD05330.1| ornithine carbamoyltransferase [Natrialba magadii ATCC 43099]
          Length = 323

 Score =  235 bits (599), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 133/302 (44%), Positives = 190/302 (62%), Gaps = 2/302 (0%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           + P+HF ++ ++S   L  ++  A + K + +    ++ LSG+ L MIF+KPSTRTRVSF
Sbjct: 22  SQPRHFLEIDDLSHEELLTVLVRAAEFKRAQQEGTAHEALSGQTLGMIFQKPSTRTRVSF 81

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E  M  LGG  +FL   ++QLGR E + DT++ LSRYVDA++ R   H  +  L E+++V
Sbjct: 82  ETGMTQLGGHAVFLGEDDIQLGRGEPLKDTSRTLSRYVDAVMARVFRHENIEVLAEHSSV 141

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           P+IN LTD+ HPCQ +AD++T  E  G  +    +W GDGNN+  S + GAA  +  + +
Sbjct: 142 PIINGLTDDAHPCQTLADLLTIREEMGGFENVSVAWVGDGNNVGQSFVIGAAMTDMDVTV 201

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVF 241
           ATP G    +  ++ AR  G    + HD V+AV  A  ++TD WISM QE +       F
Sbjct: 202 ATPPGYSMDDAVIDRARELGGDPTVTHDPVEAVTDADIIYTDVWISMGQEDERDVRMDAF 261

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           + FQV   L++ A PDA  MHCLPAHRGEE+ +E ++  QS+VFD+AENRLH QKA+L W
Sbjct: 262 EGFQVCSDLLAHA-PDASVMHCLPAHRGEEITDEAIESDQSIVFDQAENRLHAQKALLHW 320

Query: 302 CF 303
             
Sbjct: 321 LL 322


>gi|219852931|ref|YP_002467363.1| ornithine carbamoyltransferase [Methanosphaerula palustris E1-9c]
 gi|219547190|gb|ACL17640.1| ornithine carbamoyltransferase [Methanosphaerula palustris E1-9c]
          Length = 303

 Score =  235 bits (599), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 134/301 (44%), Positives = 190/301 (63%), Gaps = 1/301 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             +    + ++ + +L  I++ A  +K   +   E+  L+GK LAMIFEKPSTRTR+SFE
Sbjct: 1   MKRDLISILDLKAEDLEQIMQDAATLKTLRKEGKEHPVLAGKNLAMIFEKPSTRTRISFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M  LGG  + L+  +MQLGR E + DTA+V+SRY   +++R   HS + E   ++T+P
Sbjct: 61  VGMNDLGGHALHLNHKDMQLGRGEEVRDTARVISRYASGVMIRAFLHSTITEFAAHSTIP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN L+D  HPCQ++ADI T  E+ GS +    +W GDGNN+ +SLI  +      L +A
Sbjct: 121 VINGLSDKEHPCQLLADIFTIREYFGSTEDIRVAWVGDGNNVCNSLILASGLTGMDLRVA 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREEHVFQ 242
           TP G  P    +   R  G  V +F+   +AVK A  +FTDTWISM ++  +A+    F 
Sbjct: 181 TPDGYRPDPAVVERGRTVGGKVTVFNSPEEAVKDAEVIFTDTWISMGDETQQAQRVKAFA 240

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            + V+ +L+  A PDA+ MHCLPAHRG+E+ +EVLDGP S V+DEAENRLH QKA+L+  
Sbjct: 241 GYTVDEALLKKADPDAIVMHCLPAHRGQEITDEVLDGPHSAVWDEAENRLHVQKAVLVNL 300

Query: 303 F 303
            
Sbjct: 301 L 301


>gi|294495280|ref|YP_003541773.1| ornithine carbamoyltransferase [Methanohalophilus mahii DSM 5219]
 gi|292666279|gb|ADE36128.1| ornithine carbamoyltransferase [Methanohalophilus mahii DSM 5219]
          Length = 301

 Score =  235 bits (599), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 138/301 (45%), Positives = 196/301 (65%), Gaps = 1/301 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH   ++++S  ++  I+E  + +K           L  K LAMIFEK STRTRVSFEV
Sbjct: 1   MKHVLSMTDLSKEDIMDILETGEDLKEKRIKGKVTDLLKNKSLAMIFEKSSTRTRVSFEV 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           AM  +GG +++L+  +MQ+GR ET+ DTAKVLSRYV AI  R  +HS + EL E+ATVPV
Sbjct: 61  AMSDMGGHSLYLNQRDMQIGRGETVADTAKVLSRYVSAITARVNSHSTVEELAEHATVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INAL+D  HPCQI+AD++T +E++ +++G+  +W GDGNN+ +S+I G       + +A 
Sbjct: 121 INALSDKEHPCQILADLLTIKEYKSTLEGQKLTWVGDGNNVCNSMILGCVIVGMEIAVAC 180

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQP 243
           P G EP ++ +  AR  G  V +  D ++A   A  ++TD WISM  E +  +       
Sbjct: 181 PDGYEPDDDIVKMAREMGGKVEILRDPIEASTDADVLYTDVWISMGDEEERDKRLSDLAD 240

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +Q+N +L+ +A  D + MHCLPAHRGEE+  EV+DG  SVVFD+AENRLH QKA++L   
Sbjct: 241 YQINSTLLDVAKNDVIIMHCLPAHRGEEISAEVMDGTHSVVFDQAENRLHAQKALILKLI 300

Query: 304 G 304
           G
Sbjct: 301 G 301


>gi|296444942|ref|ZP_06886904.1| ornithine carbamoyltransferase [Methylosinus trichosporium OB3b]
 gi|296257610|gb|EFH04675.1| ornithine carbamoyltransferase [Methylosinus trichosporium OB3b]
          Length = 316

 Score =  235 bits (599), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 167/302 (55%), Positives = 218/302 (72%), Gaps = 3/302 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFEN--KPLSGKVLAMIFEKPSTRTRVSFE 63
           +HF DLS I ++ L  I++ A  IK        +  +PL+GK LAMIF+KPSTRTRVSF+
Sbjct: 11  RHFLDLSQIPATELRRILDNAAAIKARRVKGAPSAFRPLAGKALAMIFDKPSTRTRVSFD 70

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           +AM+ LGGDTI L+G EMQLGR ETI DTA+VLSR+VDAIV+R   H +L EL  ++TVP
Sbjct: 71  LAMRELGGDTIMLTGQEMQLGRGETIADTARVLSRFVDAIVIRILEHDQLTELARFSTVP 130

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LT  +HPCQ++AD++TFEEHRG + G+  +W+GD NN+L S +  A RF++ +N+A
Sbjct: 131 VINGLTKLSHPCQVMADVLTFEEHRGPIAGRTVAWTGDANNVLASWVHAAERFSFKINVA 190

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREEHVFQ 242
           TP    P    +++AR  G ++ L  D  +AV GA  V +D W+SM ++E +AR   +  
Sbjct: 191 TPPELAPSGALVDFARANGVALNLTADPYEAVAGADAVISDCWVSMGDEEEEARRHALLF 250

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           PFQVN  LM+ A   A+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK +L WC
Sbjct: 251 PFQVNAKLMAAADKHAIFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKGVLAWC 310

Query: 303 FG 304
           FG
Sbjct: 311 FG 312


>gi|118589320|ref|ZP_01546726.1| ornithine carbamoyltransferase [Stappia aggregata IAM 12614]
 gi|118438020|gb|EAV44655.1| ornithine carbamoyltransferase [Stappia aggregata IAM 12614]
          Length = 309

 Score =  235 bits (598), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 166/300 (55%), Positives = 220/300 (73%), Gaps = 1/300 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-PLSGKVLAMIFEKPSTRTRVSFEV 64
           ++F DL++     L  I++ ++KIK+S   +   + PL+GK+LAMIFE+PSTRTR+SF+V
Sbjct: 8   RNFLDLTDFEGDELRAILDTSRKIKSSRNGVHRGQGPLAGKILAMIFEQPSTRTRISFDV 67

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M+ LGG+T+ L+G+EMQLGR ETI DTA+VLSR+VDAI++R  +H+ L EL E ATVPV
Sbjct: 68  GMRELGGETLMLTGAEMQLGRGETIADTARVLSRFVDAIMIRILDHNDLRELAENATVPV 127

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LT  +HPCQI+AD++TFEEHRGS+KGK  +W+GD NN+L S +  A RF++ L IAT
Sbjct: 128 INGLTKLSHPCQIMADLLTFEEHRGSIKGKSVAWTGDSNNVLASWVHAAPRFDFELRIAT 187

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P    P  + +  AR +G S+ +  D  +AVKG  CV TD W+SM  +      ++   +
Sbjct: 188 PGELAPPMDLIEAARAKGGSIQVTTDPYEAVKGTDCVVTDCWVSMGDDDAESRHNLLSAY 247

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QVN  LM+ A+ DALFMHCLPAHRGEEV ++V+DGP SVVFDEAENRLH QK IL WCFG
Sbjct: 248 QVNKRLMAEANQDALFMHCLPAHRGEEVTSDVMDGPNSVVFDEAENRLHAQKGILAWCFG 307


>gi|296131893|ref|YP_003639140.1| ornithine carbamoyltransferase [Thermincola sp. JR]
 gi|296030471|gb|ADG81239.1| ornithine carbamoyltransferase [Thermincola potens JR]
          Length = 313

 Score =  235 bits (598), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 156/306 (50%), Positives = 197/306 (64%), Gaps = 5/306 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K    L  ++   ++ I++ A ++K   +    +  L+GK LAMIF K STRTRVSFE
Sbjct: 8   KGKDLLALYELTREEITEILKFAAELKQKQKEGIPHPLLAGKTLAMIFTKSSTRTRVSFE 67

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VAM  LGG  +FL+G E+QLGR ETI DTA+VLSRYVD I++RT  HS + EL  YA VP
Sbjct: 68  VAMYQLGGYPLFLNGQELQLGRGETIADTARVLSRYVDGIMIRTFAHSDVEELARYADVP 127

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQI+AD  T  EH+G ++G   ++ GDGNN+ HSL+ G A+    +++A
Sbjct: 128 VINGLTDLNHPCQILADFQTIIEHKGRLEGLKLAYVGDGNNVCHSLLNGCAKVGMHISVA 187

Query: 184 TPIGSEPRNEYLNWARNQGA----SVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REE 238
           TP G EP  E +  A          V +  D  QAVK A  ++TD W SM QE +     
Sbjct: 188 TPKGYEPDAEIVRKAMADARLSGAVVEILEDPCQAVKDADVIYTDVWASMGQEAEHAERL 247

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
            +F+P+QVN  L+  A PD LFMHCLPAHRGEEV  EV+DGP SVVFDEAENRLH QKA+
Sbjct: 248 KIFRPYQVNSDLVKRARPDYLFMHCLPAHRGEEVAAEVIDGPNSVVFDEAENRLHAQKAV 307

Query: 299 LLWCFG 304
           L    G
Sbjct: 308 LALTMG 313


>gi|218532331|ref|YP_002423147.1| ornithine carbamoyltransferase [Methylobacterium chloromethanicum
           CM4]
 gi|218524634|gb|ACK85219.1| ornithine carbamoyltransferase [Methylobacterium chloromethanicum
           CM4]
          Length = 316

 Score =  235 bits (598), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 163/301 (54%), Positives = 218/301 (72%), Gaps = 2/301 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFE--NKPLSGKVLAMIFEKPSTRTRVSFE 63
           +HF DL ++S+  L  +++ +  +K           +PL+GK+LAM+F++PSTRTRVSF+
Sbjct: 13  RHFLDLKDLSAETLRGVLDTSAAMKRVRVKGQRAAERPLTGKMLAMVFDRPSTRTRVSFD 72

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VAM+ LGGDT+ L+G EMQLGR ET+ DTA+VLSR+VDAIV+RT +H  ++EL E+A VP
Sbjct: 73  VAMRELGGDTLMLTGKEMQLGRGETVSDTARVLSRFVDAIVIRTLDHGLVMELAEHAEVP 132

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINALT  +HPCQI+AD++TFEEHRG ++G+  +WSGD NN+L S +  AARF++ LN+A
Sbjct: 133 VINALTKASHPCQIMADLLTFEEHRGPIQGRTVAWSGDANNVLASWVHAAARFDFTLNVA 192

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQP 243
            P         ++WA+ +GA V    DA  AV+GA  V TD W+SM  + +    ++  P
Sbjct: 193 APRELAMPPALVDWAKREGARVNATTDAYAAVEGADLVVTDCWVSMGDDDEHFRHNLLSP 252

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           ++V+ +LM  A  DALFMHCLPAHRGEEV  EV+DGPQSVVFDEAENRLH QK IL WC 
Sbjct: 253 YRVDAALMKAASKDALFMHCLPAHRGEEVTAEVIDGPQSVVFDEAENRLHAQKGILAWCL 312

Query: 304 G 304
           G
Sbjct: 313 G 313


>gi|240140893|ref|YP_002965373.1| ornithine carbamoyltransferase [Methylobacterium extorquens AM1]
 gi|240010870|gb|ACS42096.1| ornithine carbamoyltransferase [Methylobacterium extorquens AM1]
          Length = 316

 Score =  235 bits (598), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 163/301 (54%), Positives = 218/301 (72%), Gaps = 2/301 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFE--NKPLSGKVLAMIFEKPSTRTRVSFE 63
           +HF DL ++S+  L  +++ +  +K           +PL+GK+LAM+F++PSTRTRVSF+
Sbjct: 13  RHFLDLKDLSAETLRGVLDTSAAMKRVRVKGQRAVERPLTGKMLAMVFDRPSTRTRVSFD 72

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VAM+ LGGDT+ L+G EMQLGR ET+ DTA+VLSR+VDAIV+RT +H  ++EL E+A VP
Sbjct: 73  VAMRELGGDTLMLTGKEMQLGRGETVSDTARVLSRFVDAIVIRTLDHGLVMELAEHAEVP 132

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINALT  +HPCQI+AD++TFEEHRG ++G+  +WSGD NN+L S +  AARF++ LN+A
Sbjct: 133 VINALTKASHPCQIMADLLTFEEHRGPIRGRTVAWSGDANNVLASWVHAAARFDFTLNVA 192

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQP 243
            P         ++WA+ +GA V    DA  AV+GA  V TD W+SM  + +    ++  P
Sbjct: 193 APRELAMPPALVDWAKREGARVNATTDAYAAVEGADLVVTDCWVSMGDDDEHFRHNLLSP 252

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           ++V+ +LM  A  DALFMHCLPAHRGEEV  EV+DGPQSVVFDEAENRLH QK IL WC 
Sbjct: 253 YRVDAALMKAASKDALFMHCLPAHRGEEVTAEVIDGPQSVVFDEAENRLHAQKGILAWCL 312

Query: 304 G 304
           G
Sbjct: 313 G 313


>gi|313902362|ref|ZP_07835766.1| ornithine carbamoyltransferase [Thermaerobacter subterraneus DSM
           13965]
 gi|313467410|gb|EFR62920.1| ornithine carbamoyltransferase [Thermaerobacter subterraneus DSM
           13965]
          Length = 333

 Score =  234 bits (597), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 153/303 (50%), Positives = 201/303 (66%), Gaps = 5/303 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F  L + +   L  ++++A  +K   +     +PL GK LAMIFEKPSTRTRVSFEV 
Sbjct: 30  RDFLTLGDFTPDELVGLLDLAAALKQDWQAGRGGEPLYGKTLAMIFEKPSTRTRVSFEVG 89

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG  + LS  E+QL R ET+ DTA+VLSRYVDA+++R  +H+ + EL   AT+PVI
Sbjct: 90  MQQLGGRVLNLSPRELQLSRGETLADTARVLSRYVDALMVRAYSHATVEELAAAATIPVI 149

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ++AD++T  EH+G ++G   ++ GD NN+ H+ + GAA     L +A P
Sbjct: 150 NGLTDLYHPCQVMADLLTIREHKGRLRGIRVAYVGDSNNVAHTWLLGAALLGLHLRLACP 209

Query: 186 IGSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQE-FKAREEHV 240
            G EP  E L    + AR  GA+V + HD V AV+GA  V+TD W SM QE  +      
Sbjct: 210 PGYEPHPEILALAASLARGTGATVEVGHDPVTAVRGADVVYTDVWTSMGQEGEEEDRRRA 269

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F P+QVN  L++ A PD +FMHCLPAHRGEEV + VLDGP SVV+D+AENRLH QKAILL
Sbjct: 270 FAPYQVNAQLVAHAAPDYIFMHCLPAHRGEEVTSGVLDGPHSVVWDQAENRLHAQKAILL 329

Query: 301 WCF 303
              
Sbjct: 330 ALL 332


>gi|153876535|ref|ZP_02003805.1| ornithine carbamoyltransferase [Beggiatoa sp. PS]
 gi|152067001|gb|EDN66195.1| ornithine carbamoyltransferase [Beggiatoa sp. PS]
          Length = 303

 Score =  234 bits (597), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 153/302 (50%), Positives = 198/302 (65%), Gaps = 4/302 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           P+HF  L ++S   L  +I  A ++K         +P   KVLAMIFEK STRTRVSFE 
Sbjct: 3   PRHFLTLLDLSQDELQALIARAIELKAMQYANICYEPFKKKVLAMIFEKSSTRTRVSFET 62

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           AM   GG  IFLS  + QLGR E I DTA+VLS  V++I++RT  H ++    +Y+ VPV
Sbjct: 63  AMVQCGGSAIFLSPRDTQLGRGEPIEDTARVLSSMVNSIMVRTYEHKKIELFAKYSKVPV 122

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALTD  HPCQ++ADI T+ EHRGS++GK  +W GDGNN+ HS ++ A +F++ L +A 
Sbjct: 123 INALTDRHHPCQLLADIQTYVEHRGSIQGKKVAWIGDGNNMCHSYMQAAHQFDFELAVAC 182

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQP 243
           P   +P  E +         +    D  QAV GA  V TD W SM QE +  +   VF+P
Sbjct: 183 PPNYQPDAELVAQFDKHVNLIT---DPRQAVAGADLVSTDVWASMGQEEEQNQRLQVFEP 239

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +QVN  LMS+  PDALFMHCLPAHRGEEV  EV+DGPQSVV+D+AENRLH+QKA+L +  
Sbjct: 240 YQVNTQLMSLTKPDALFMHCLPAHRGEEVSAEVIDGPQSVVWDQAENRLHSQKALLEFLL 299

Query: 304 GI 305
            +
Sbjct: 300 SV 301


>gi|237814786|ref|ZP_04593784.1| ornithine carbamoyltransferase [Brucella abortus str. 2308 A]
 gi|17983638|gb|AAL52801.1| ornithine carbamoyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|237789623|gb|EEP63833.1| ornithine carbamoyltransferase [Brucella abortus str. 2308 A]
          Length = 323

 Score =  234 bits (597), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 197/298 (66%), Positives = 239/298 (80%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF DLS + ++ L  I+E AK  K   +     +P +GKVLAMIFEK STRTRVSF+V 
Sbjct: 19  KHFIDLSTVPATELRAILEDAKARKARLKAGEVERPYAGKVLAMIFEKLSTRTRVSFDVG 78

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+GSEMQLGR+ETI DTAKVLSRYVDAI++RTT H R+LEL EYATVPVI
Sbjct: 79  MRQLGGETIMLTGSEMQLGRSETIADTAKVLSRYVDAIMIRTTAHERMLELAEYATVPVI 138

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+THPCQI+AD++T+EEHRG +KGK F+W GDGNN+LHSL+E AARF++ +NIATP
Sbjct: 139 NALTDDTHPCQIMADVLTYEEHRGPIKGKTFAWMGDGNNVLHSLVEAAARFDFNVNIATP 198

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            GSEP+++Y++WAR  GA +    D  +A  GA C+ TDTW+SM QE  AR  +VF P+Q
Sbjct: 199 KGSEPKSQYIDWARANGAGIMSTTDPEKAASGADCIVTDTWVSMGQEDHARGHNVFIPYQ 258

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN +LM+ A P ALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QKAIL WC 
Sbjct: 259 VNANLMAKADPKALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKAILAWCL 316


>gi|39995263|ref|NP_951214.1| ornithine carbamoyltransferase [Geobacter sulfurreducens PCA]
 gi|56404386|sp|Q74GU2|OTC_GEOSL RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|39982025|gb|AAR33487.1| ornithine carbamoyltransferase [Geobacter sulfurreducens PCA]
 gi|298504268|gb|ADI82991.1| ornithine carbamoyltransferase [Geobacter sulfurreducens KN400]
          Length = 303

 Score =  234 bits (596), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 126/302 (41%), Positives = 194/302 (64%), Gaps = 2/302 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             +HF  L+  +   L  +  +++++K+  +    ++ L GK +A+IFEK STRTRVSFE
Sbjct: 1   MIRHFLALNQFTKEELDGLFTLSRELKDKQKQGVPHRLLEGKSVALIFEKSSTRTRVSFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V +  LG   +F+S +  Q+GR E I DTA+V++RY D +++RT     + E   Y++VP
Sbjct: 61  VGVAQLGAHPLFISSATSQMGRGEPIKDTARVMARYCDGVMIRTYGQEIVEEFARYSSVP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQI+AD+ T  E++G  +G  F+W GDGNN+ ++ IE AA   + L +A
Sbjct: 121 VINGLTDLFHPCQIMADLFTVIEYKGGYQGLKFAWVGDGNNMANTWIEAAAILGFDLALA 180

Query: 184 TPIGSEPRNEYLNWARNQ-GASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREEHVF 241
            P G EP  +  +WA+ +  +S+ +  D  +AV+ A  V TD W SM  ++ +   E  F
Sbjct: 181 CPTGYEPDRQVWDWAQQRATSSITITEDPEEAVRDADVVNTDVWASMGQEQEQKEREAAF 240

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           Q + ++ +L+++A PD + +HCLPAHRGEE+ + V++GP+S V+DEAENRLH QKAI+  
Sbjct: 241 QGYCLDDALVALARPDCMVLHCLPAHRGEEITDSVIEGPRSAVWDEAENRLHIQKAIMAS 300

Query: 302 CF 303
             
Sbjct: 301 LM 302


>gi|13474701|ref|NP_106270.1| ornithine carbamoyltransferase [Mesorhizobium loti MAFF303099]
 gi|32699476|sp|Q98BB6|OTC_RHILO RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|14025456|dbj|BAB52056.1| ornithine carbamoyltransferase [Mesorhizobium loti MAFF303099]
          Length = 303

 Score =  234 bits (596), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 188/299 (62%), Positives = 232/299 (77%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF DLS +S  +L  +++ A   K   +     +PL GKVLAMIF+KPSTRTRVSF+V 
Sbjct: 4   RHFTDLSTVSEGDLRFMLDDAVVRKARLKAGERTRPLEGKVLAMIFDKPSTRTRVSFDVG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+G+EMQLGR+ETI DTAKVLSRYVDAI++RTT+H RLLELTE ATVPVI
Sbjct: 64  MRQLGGETIMLTGTEMQLGRSETIADTAKVLSRYVDAIMIRTTSHDRLLELTENATVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+THPCQ++ADIMTFEEHRG V GK  +W+GDGNN+LHSL+E +ARF + LN+A P
Sbjct: 124 NGLTDDTHPCQLMADIMTFEEHRGPVAGKTIAWTGDGNNVLHSLLEASARFRFNLNVAVP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            GSEP  ++++W++  G  +       +AV  A CV TD W+SM QE +AR  +VF P+Q
Sbjct: 184 EGSEPAQKHIDWSKAHGGKLHFTRSPEEAVDQADCVVTDCWVSMGQEHRARGHNVFSPYQ 243

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           VN  LM+ A PDALFMHCLPAHRGEEV +EV+DGP SVVFDEAENRLH QKA+L WC G
Sbjct: 244 VNAKLMAHAKPDALFMHCLPAHRGEEVTDEVIDGPHSVVFDEAENRLHAQKAVLAWCLG 302


>gi|197119998|ref|YP_002140425.1| ornithine carbamoyltransferase [Geobacter bemidjiensis Bem]
 gi|197089358|gb|ACH40629.1| ornithine carbamoyltransferase [Geobacter bemidjiensis Bem]
          Length = 303

 Score =  234 bits (596), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 129/302 (42%), Positives = 182/302 (60%), Gaps = 2/302 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             + F  LS  S + L  I  + K++K   +   E+  L GK LAMIFEK STRTR+SFE
Sbjct: 1   MKRDFLALSQFSKAELDAIFLLTKELKEKQKKGVEHHLLKGKSLAMIFEKSSTRTRLSFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           + M  LGG  +F+S  + Q+GR E I DTA+V++RY D +++RT     + E  +YA+VP
Sbjct: 61  IGMYQLGGHPLFISSKDSQMGRGEPIKDTARVMARYCDGVMIRTFAQETVEEFAKYASVP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           +IN LTD  HPCQI+ADI T  EHRG  +G  F+W GDGNN+ +S IE AA F + L +A
Sbjct: 121 IINGLTDLHHPCQIMADIFTVIEHRGGYQGLKFAWIGDGNNMANSWIEAAAIFGFDLTLA 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR--EEHVF 241
            P G +P  + L WA+   +S  +     +       V      +   + + +   E  F
Sbjct: 181 CPEGYDPNPQVLEWAQKHASSKIVVTRDPKVAAQDADVLNTDVWASMGQEEEQKIREKAF 240

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
             FQ+N  L+ +A  +A+ +HCLPAHRGEE+ ++V++GP S V+DEAENRLH QKAI+  
Sbjct: 241 AGFQLNEELLDLAKGNAMVLHCLPAHRGEEITDDVIEGPHSAVWDEAENRLHVQKAIMAI 300

Query: 302 CF 303
             
Sbjct: 301 LM 302


>gi|300021558|ref|YP_003754169.1| ornithine carbamoyltransferase [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299523379|gb|ADJ21848.1| ornithine carbamoyltransferase [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 318

 Score =  233 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 157/309 (50%), Positives = 209/309 (67%), Gaps = 6/309 (1%)

Query: 2   MTY---PKHFADLSNISSSNLSCIIEVAKKIKNSSENIF---ENKPLSGKVLAMIFEKPS 55
           MT    P+HF D++++ S  L  II+ A  +K + + +      K +   VL +IFEKPS
Sbjct: 9   MTAKQGPRHFLDIADLDSKTLRKIIDNAHAMKRAGKRVPAELRPKGIEDDVLVLIFEKPS 68

Query: 56  TRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLE 115
           TRTRVSF+VAM+ LGG  + L+  ++QLGR E++ DTA+VLSRY D I++R   H+ L E
Sbjct: 69  TRTRVSFDVAMRQLGGQALTLNHDDLQLGRGESVADTARVLSRYADGIMIRANAHATLAE 128

Query: 116 LTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAAR 175
           L  +AT+PVIN LT+ +HPCQI+ADI TFEEH G +KG+  +W GDGNN+  S +  A R
Sbjct: 129 LARHATIPVINGLTEKSHPCQIMADIQTFEEHLGPIKGRTVAWVGDGNNVAVSWMHAAVR 188

Query: 176 FNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA 235
           F + L +A P    P  E L+W + +  +V +  D  +AVKGA CV TDTW+SM Q   A
Sbjct: 189 FGFKLRLACPKSLYPEAEALDWVQREKGNVEIGTDPSEAVKGADCVVTDTWVSMGQSGAA 248

Query: 236 REEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
           + + +  P+ V+  LMS A   A+FMHCLPA+RG EV  EVL+GPQSV+FDEAENRLH Q
Sbjct: 249 KRKKILAPYAVDAKLMSKASKSAIFMHCLPAYRGHEVSEEVLEGPQSVIFDEAENRLHAQ 308

Query: 296 KAILLWCFG 304
           KAIL WCFG
Sbjct: 309 KAILAWCFG 317


>gi|147676841|ref|YP_001211056.1| ornithine carbamoyltransferase [Pelotomaculum thermopropionicum SI]
 gi|146272938|dbj|BAF58687.1| ornithine carbamoyltransferase [Pelotomaculum thermopropionicum SI]
          Length = 313

 Score =  233 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 144/305 (47%), Positives = 202/305 (66%), Gaps = 5/305 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             +H   L + S   ++ I+++A ++K+  +    +  L GK+L MIF+K STRTRVSFE
Sbjct: 9   KGRHLLSLHDFSPDEIAYILDLAGELKDRQKKNIPHPYLRGKMLGMIFQKSSTRTRVSFE 68

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VAM  LGG  +FL+ +++QLGR ETI DTA+VLSRY+D I++RT +H+ + EL  +ATVP
Sbjct: 69  VAMYQLGGSAMFLNVNDLQLGRGETIADTARVLSRYLDGIMIRTYSHADVEELARHATVP 128

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQI+AD++T +E +G + G   ++ GDGNN+ HSL+ G A+    +++A
Sbjct: 129 VINGLTDLLHPCQILADLLTVKERKGRLAGLKLAYVGDGNNVCHSLLFGCAKTGMHISVA 188

Query: 184 TPIGSEPRNEYLNWARNQGAS----VALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREE 238
           +P G +P+ E +  A          + +    V+AV GA  V TD W SM QE + +R  
Sbjct: 189 SPEGYKPKEEIVRLAEKDAEQTGSRIEILTSPVEAVSGADVVVTDVWASMGQEVEQSRRV 248

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
            VF P+QVN  L   A PD +F+HCLPAHRGEEV +E++DGP S V+DEAENRLH QKA+
Sbjct: 249 RVFAPYQVNRQLTGHARPDYIFLHCLPAHRGEEVTDEIIDGPHSAVWDEAENRLHVQKAV 308

Query: 299 LLWCF 303
           L    
Sbjct: 309 LALLL 313


>gi|260461908|ref|ZP_05810153.1| ornithine carbamoyltransferase [Mesorhizobium opportunistum
           WSM2075]
 gi|259032155|gb|EEW33421.1| ornithine carbamoyltransferase [Mesorhizobium opportunistum
           WSM2075]
          Length = 303

 Score =  233 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 188/303 (62%), Positives = 234/303 (77%), Gaps = 1/303 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M+  +HF DLS +S  +L  ++  A   K   +    +KPL GKVLAMIF+KPSTRTRVS
Sbjct: 1   MSL-RHFTDLSAVSEGDLRFMLTDAVARKERLKAGERSKPLEGKVLAMIFDKPSTRTRVS 59

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V M+ LGG+TI L+G+EMQLGR+ETI DTAKVLSRYVDAI++RTT+H RLLELTE AT
Sbjct: 60  FDVGMRQLGGETIMLTGTEMQLGRSETIADTAKVLSRYVDAIMIRTTSHERLLELTENAT 119

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           +PVIN LTD+THPCQ++ADIMTFEEHRG V GK  +W+GDGNN+LHSL+E +ARF + LN
Sbjct: 120 IPVINGLTDDTHPCQLMADIMTFEEHRGPVAGKTIAWTGDGNNVLHSLLEASARFRFNLN 179

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +A P GSEP  ++++W++  G  +       +AV  A C+ TD W+SM QE +AR  +VF
Sbjct: 180 VAVPEGSEPAQKHIDWSQANGGKLHFTRSPEEAVDQADCIVTDCWVSMGQEHRARGHNVF 239

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
            P+QVN  LM+ A PDALFMHCLPAHRGEEV +EV+DGP SVVFDEAENRLH QKA+L W
Sbjct: 240 SPYQVNAKLMARAKPDALFMHCLPAHRGEEVTDEVIDGPHSVVFDEAENRLHAQKAVLAW 299

Query: 302 CFG 304
           C G
Sbjct: 300 CLG 302


>gi|146343542|ref|YP_001208590.1| ornithine carbamoyltransferase [Bradyrhizobium sp. ORS278]
 gi|146196348|emb|CAL80375.1| ornithine carbamoyltransferase (OTCase) [Bradyrhizobium sp. ORS278]
          Length = 308

 Score =  233 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 172/305 (56%), Positives = 221/305 (72%), Gaps = 1/305 (0%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFEN-KPLSGKVLAMIFEKPSTRTR 59
           M   P+HF DL+ +    L  ++ ++ ++K + ++   + KPL GKVLAMIF+KPSTRTR
Sbjct: 1   MGNPPRHFLDLTEMPVEELRNMLALSSRMKQTLKSNEPSRKPLEGKVLAMIFDKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V M+ LGG+ I L+G+EMQLGR ETI DTA+VLSRYVDAI++R  +H  LLEL  +
Sbjct: 61  VSFDVGMRQLGGEAIMLTGTEMQLGRGETIADTARVLSRYVDAIMIRILSHEALLELAAH 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ATVPVIN LT  +HPCQ++AD+MTFEEHRGS++G+  +W+GD NN+L S    A RF + 
Sbjct: 121 ATVPVINGLTRRSHPCQVMADVMTFEEHRGSIEGRTVAWTGDDNNVLASWAHAAERFKFR 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           LN+ATP    P     ++ R   A + L HD   AVK A CV TDTW+SM  +      +
Sbjct: 181 LNVATPPQLSPGKPMKDFIRATRADIHLGHDPEGAVKNADCVITDTWVSMGDKDGEHRHN 240

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + +P+QVN  LMS+A P+ALFMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK IL
Sbjct: 241 LLKPYQVNAKLMSLAKPEALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKGIL 300

Query: 300 LWCFG 304
            WCFG
Sbjct: 301 AWCFG 305


>gi|298294427|ref|YP_003696366.1| ornithine carbamoyltransferase [Starkeya novella DSM 506]
 gi|296930938|gb|ADH91747.1| ornithine carbamoyltransferase [Starkeya novella DSM 506]
          Length = 316

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 171/298 (57%), Positives = 219/298 (73%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF DL  +    L  ++ ++  +K+    I   KP +GKVLAM+F++PSTRTR+SF+VA
Sbjct: 14  KHFLDLDTLPPDELRALMRLSHDLKSRRHEIAAEKPFAGKVLAMVFDQPSTRTRISFDVA 73

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+TI L+G+EMQLGR ETI DTAKVLSRYVDAI++R  +H  L EL  +ATVPVI
Sbjct: 74  MRQLGGETIMLTGAEMQLGRGETIADTAKVLSRYVDAIMIRILDHRALEELAAHATVPVI 133

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT  +HPCQI+AD+MTFEEH+G + G+  +W+GD NN+L S I  A RF++ LN+ATP
Sbjct: 134 NGLTRESHPCQIMADVMTFEEHKGPIAGRTVAWTGDANNVLASWIHAAQRFDFALNVATP 193

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
               PR   ++WAR+ GA V   +DA +AV+GA CV TDTW+SM      R  ++ +P+Q
Sbjct: 194 PELAPRPALVDWARSNGAKVRFGNDADEAVEGADCVVTDTWVSMGDAEYERRHNLLRPYQ 253

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN +LM  A P A+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK IL WC 
Sbjct: 254 VNGALMRRAAPGAIFMHCLPAHRGEEVTDEVMDGPQSVVFDEAENRLHAQKGILAWCL 311


>gi|125974373|ref|YP_001038283.1| ornithine carbamoyltransferase [Clostridium thermocellum ATCC
           27405]
 gi|256005548|ref|ZP_05430508.1| ornithine carbamoyltransferase [Clostridium thermocellum DSM 2360]
 gi|281418919|ref|ZP_06249937.1| ornithine carbamoyltransferase [Clostridium thermocellum JW20]
 gi|125714598|gb|ABN53090.1| ornithine carbamoyltransferase [Clostridium thermocellum ATCC
           27405]
 gi|255990456|gb|EEU00578.1| ornithine carbamoyltransferase [Clostridium thermocellum DSM 2360]
 gi|281407376|gb|EFB37636.1| ornithine carbamoyltransferase [Clostridium thermocellum JW20]
 gi|316941531|gb|ADU75565.1| ornithine carbamoyltransferase [Clostridium thermocellum DSM 1313]
          Length = 307

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 144/305 (47%), Positives = 197/305 (64%), Gaps = 5/305 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            +H   L +++  +   I ++A+K+K   +    +  L GK L MIF K STRTRVSFEV
Sbjct: 1   MEHLISLHDLTVEDFESIFKLAEKLKRQQKEGIPHHLLKGKTLGMIFTKSSTRTRVSFEV 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG  +FLS +++QLGR ETI DTA+VLSRYVD I++RT   S + +L  Y  VPV
Sbjct: 61  GMYQLGGYPLFLSANDIQLGRGETIYDTAQVLSRYVDGIMIRTFAQSDVEDLARYGNVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD  HPCQI+AD+ T  EH+G++KG   ++ GDGNN+ +SL+ G A+    + +A+
Sbjct: 121 INGLTDLMHPCQILADLFTIYEHKGTLKGLKLAYVGDGNNVANSLLHGCAKVGMDIAVAS 180

Query: 185 PIGSEPRNEYLNWARNQGA----SVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREEH 239
           P G E  +  +  A+        ++ L  D  +A+K A  V+TDTW+SM  +  K     
Sbjct: 181 PKGYECDSRIVEEAKEDAKASGANILLTEDPEEAIKDADVVYTDTWVSMGQESEKEERIK 240

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           VF P+QVN +L S AH DA+F+HCLPA+RG EV  +V+DG QSV+FDEAENRLH QKAI+
Sbjct: 241 VFMPYQVNNTLFSKAHEDAIFLHCLPAYRGYEVTEDVIDGSQSVIFDEAENRLHVQKAIM 300

Query: 300 LWCFG 304
               G
Sbjct: 301 ALLMG 305


>gi|114328937|ref|YP_746094.1| ornithine carbamoyltransferase [Granulibacter bethesdensis CGDNIH1]
 gi|114317111|gb|ABI63171.1| ornithine carbamoyltransferase [Granulibacter bethesdensis CGDNIH1]
          Length = 316

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 162/301 (53%), Positives = 214/301 (71%), Gaps = 4/301 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF DL +I    L  +++ A   K        ++PL+G+ LA+IFEKPSTRTR+SFE+A
Sbjct: 19  RHFLDLKDIEPDALRRMLDAAAGFK---RADTSSRPLAGRTLALIFEKPSTRTRISFELA 75

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGGD I LSG EMQLGR ET+ DTA+VLSRYVDA+++RT + ++L EL  +ATVPVI
Sbjct: 76  MRQLGGDVIMLSGKEMQLGRGETLADTARVLSRYVDAVMLRTGSSTKLHELARHATVPVI 135

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+ +HPCQI+ADI+TFEEHRG + G+  +W GDGNN+ HS IE AARF + L +A P
Sbjct: 136 NGLTELSHPCQIMADILTFEEHRGPIAGQTVAWIGDGNNVAHSWIEAAARFGFSLRLACP 195

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
              +P  + + WAR+ G  V L  D  +AV G  CV TD W+    +  +      +P+Q
Sbjct: 196 DTLQPHADIVAWARDNGGDVTLVADPKEAVAGVQCVVTDCWV-SMSDDPSGRHEKLRPYQ 254

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGI 305
           V+ +LM++A PDALFMHCLPAHRGEEV + V+DGP SVVFDEAENRLH QK +L+W  G+
Sbjct: 255 VDEALMALAAPDALFMHCLPAHRGEEVTDGVIDGPHSVVFDEAENRLHAQKGVLVWAMGM 314

Query: 306 I 306
           +
Sbjct: 315 L 315


>gi|323140992|ref|ZP_08075902.1| ornithine carbamoyltransferase [Phascolarctobacterium sp. YIT
           12067]
 gi|322414529|gb|EFY05338.1| ornithine carbamoyltransferase [Phascolarctobacterium sp. YIT
           12067]
          Length = 313

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 132/308 (42%), Positives = 184/308 (59%), Gaps = 5/308 (1%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M    K    + ++S   ++ I++VAKK+K   +    ++ L GK LAM+F K STRTR 
Sbjct: 1   MSLKDKDLISIHDLSVGEVATILDVAKKLKRKQKAGEPHQYLKGKTLAMLFSKASTRTRT 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFEV    LGG  I+LS S  Q+GR E I DTA+VLSR+VD I++RT +H  ++EL +YA
Sbjct: 61  SFEVGFWQLGGHPIYLSDSASQIGRGEPIRDTARVLSRFVDGIMIRTFSHDSVIELAKYA 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +VPVIN LTD  HPCQ + DI T +E    +KG+   + GDGNN+ HSL+   A+    +
Sbjct: 121 SVPVINGLTDLLHPCQALTDIFTIQEKMKVLKGRKLVYVGDGNNMAHSLMFACAKVGMNM 180

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFT--DTWISMNQEFKAREE 238
             A+P G +P  E L  A+   A         + +  A        T +  +   +A  E
Sbjct: 181 ICASPKGYQPDPEILRLAQEDAAQTGCSITVEEDIFKAAKGADVLYTDVWTSMGEEAERE 240

Query: 239 HVF---QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
             F     +Q+N +L++ A P+A+ +HCLPAHRGEE+  EVL+GPQSVVFD+AENRLH Q
Sbjct: 241 VRFKALHNYQINQALLNEARPEAIVLHCLPAHRGEEITEEVLEGPQSVVFDQAENRLHVQ 300

Query: 296 KAILLWCF 303
           KAI+    
Sbjct: 301 KAIMALLM 308


>gi|188583745|ref|YP_001927190.1| ornithine carbamoyltransferase [Methylobacterium populi BJ001]
 gi|179347243|gb|ACB82655.1| ornithine carbamoyltransferase [Methylobacterium populi BJ001]
          Length = 316

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 163/301 (54%), Positives = 215/301 (71%), Gaps = 2/301 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFE--NKPLSGKVLAMIFEKPSTRTRVSFE 63
           +HF DL + S+  L  +++ +  +K +         +PL+GK+LAM+F++PSTRTRVSF+
Sbjct: 13  RHFLDLKDFSAQTLRGVLDASAAMKRARVKGQPAAERPLTGKMLAMVFDRPSTRTRVSFD 72

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VAM+ LGGDT+ L+G EMQLGR ET+ DTA+VLSR+VDAIV+RT +H  ++EL E+A VP
Sbjct: 73  VAMRELGGDTLMLTGKEMQLGRGETVSDTARVLSRFVDAIVIRTLDHGLVMELAEHAEVP 132

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINALT  +HPCQI+AD++TFEEHRG +KG+  +WSGD NN+L S +  AARF++ LN+A
Sbjct: 133 VINALTKASHPCQIMADVLTFEEHRGPIKGRTIAWSGDANNVLASWVHAAARFDFTLNVA 192

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQP 243
            P           WA  +GA V    DA  AV+GA  V TD W+SM  + +    ++  P
Sbjct: 193 APNELAMPPALTAWAEREGARVHATTDAYAAVEGADAVVTDCWVSMGDDDEHFRHNLLSP 252

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           ++V+ +LM  A  DA+FMHCLPAHRGEEV  EV+DGPQSVVFDEAENRLH QK IL WC 
Sbjct: 253 YRVDAALMKAAAKDAIFMHCLPAHRGEEVTAEVIDGPQSVVFDEAENRLHAQKGILAWCL 312

Query: 304 G 304
           G
Sbjct: 313 G 313


>gi|170748735|ref|YP_001754995.1| ornithine carbamoyltransferase [Methylobacterium radiotolerans JCM
           2831]
 gi|170655257|gb|ACB24312.1| ornithine carbamoyltransferase [Methylobacterium radiotolerans JCM
           2831]
          Length = 326

 Score =  233 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 172/302 (56%), Positives = 224/302 (74%), Gaps = 2/302 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIF--ENKPLSGKVLAMIFEKPSTRTRVSF 62
           P+HF DL + S + L  +++ +  IK           +PL+GK LAM+F++PSTRTRVSF
Sbjct: 21  PRHFLDLKDFSGAELRRVLDASAAIKARRRKGELAAERPLTGKTLAMVFDRPSTRTRVSF 80

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           +VAM+ LGG+T+ L+GSEMQLGR ETIGDTA+VLSR+VDAI++R  +H ++LEL EYATV
Sbjct: 81  DVAMRELGGETLMLTGSEMQLGRGETIGDTAQVLSRFVDAIMIRILDHGQMLELAEYATV 140

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVINALT  +HPCQI+AD++TFEEHRG ++G+  +WSGD NN+L S +  AARF++ LNI
Sbjct: 141 PVINALTKVSHPCQIMADVLTFEEHRGPIRGRKVAWSGDANNVLASWVHAAARFDFTLNI 200

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQ 242
           A+P    P    L WA+ +GA V +  DA  AV G   V TD W+SM  + +A   ++  
Sbjct: 201 ASPPELAPPPALLAWAQQEGADVHVTTDAFAAVDGVDAVVTDCWVSMGDDDEAHRHNLLS 260

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           P+QVN +LM+ A+PDA+FMHCLPAHRGEEV  EV+DGP+SVVFDEAENRLH QK IL WC
Sbjct: 261 PYQVNDALMAAANPDAIFMHCLPAHRGEEVTAEVMDGPRSVVFDEAENRLHAQKGILAWC 320

Query: 303 FG 304
            G
Sbjct: 321 LG 322


>gi|206901864|ref|YP_002251492.1| ornithine carbamoyltransferase [Dictyoglomus thermophilum H-6-12]
 gi|206740967|gb|ACI20025.1| ornithine carbamoyltransferase [Dictyoglomus thermophilum H-6-12]
          Length = 309

 Score =  233 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 135/305 (44%), Positives = 183/305 (60%), Gaps = 7/305 (2%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFE-NKPLSGKVLAMIFEKPSTRTRVSF 62
             +    + ++S   +  I  +AK +K         +  L GK +A+ FEKPSTRTR+SF
Sbjct: 5   KGRDLLSILDLSREEIEQIFHLAKNLKLEYYAGKRIHDYLKGKTVALFFEKPSTRTRISF 64

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           EV +  LGG  ++L+  EMQL R ETI DTA+VL RYVD I+ R  +H  L+EL +Y+ +
Sbjct: 65  EVGVHQLGGYPLYLNAQEMQLKRGETIADTARVLERYVDGIMARVYSHDTLVELAQYSRI 124

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVIN L+D  HPCQ+IAD  T  E +G  K     + GDGNN+ +SLI         +  
Sbjct: 125 PVINGLSDLEHPCQVIADYFTIIEKKGF-KKLKVVYLGDGNNVANSLILAGVMLGMNVVC 183

Query: 183 ATPIGSEPRN----EYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-E 237
           ++P    P      E L  A+  G S+ +  D  +AVK A  ++TD W+SM QE +    
Sbjct: 184 SSPKEFMPPKKVLEEALVLAKRYGGSIEIIEDPKEAVKDADVLYTDVWVSMGQEDEKEIR 243

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
             V  P+Q+N  L+S+A  DA+ MHCLPAHRGEE+ +EV+DGP SVVFDEAENRLH QKA
Sbjct: 244 RRVLPPYQLNKELLSLAKEDAIVMHCLPAHRGEEITDEVMDGPNSVVFDEAENRLHVQKA 303

Query: 298 ILLWC 302
           I+   
Sbjct: 304 IMALL 308


>gi|121602135|ref|YP_989540.1| ornithine carbamoyltransferase [Bartonella bacilliformis KC583]
 gi|120614312|gb|ABM44913.1| ornithine carbamoyltransferase [Bartonella bacilliformis KC583]
          Length = 310

 Score =  233 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 185/303 (61%), Positives = 233/303 (76%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M    +HF DLS ++      +I+ AK +K + +    +KP  GK LAMIFEKPSTRTRV
Sbjct: 1   MTHALRHFTDLSILTPQTARTLIDYAKTLKKTFKEGKASKPFVGKTLAMIFEKPSTRTRV 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF++ M+ LGGDT+ L+GSEMQLG +ETI DTA+VLSR+VD I++RT  H R+LEL +YA
Sbjct: 61  SFDIGMRQLGGDTLMLTGSEMQLGHSETIADTARVLSRFVDIILLRTAAHHRMLELAQYA 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
            VPVINALTD+THPCQI+ADI+T+EEHRG +  K+F+W GDGNN+LHSLIE  A F++ L
Sbjct: 121 QVPVINALTDDTHPCQILADILTYEEHRGPIASKIFAWVGDGNNVLHSLIEATALFDFHL 180

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
             ATP GSEP+  Y+NWAR +GA +   H+  + V+ A C+ TDTWISM QEF+AR   +
Sbjct: 181 RFATPQGSEPQARYINWARERGAHITCTHNPQETVENADCIITDTWISMGQEFRARNHSI 240

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           FQP+QVN +L+ +A PDALFMHCLPAHRGEEV++ V+DGP SVVFDEAENRLH QKAIL 
Sbjct: 241 FQPYQVNEALIKLAKPDALFMHCLPAHRGEEVVDSVIDGPHSVVFDEAENRLHIQKAILS 300

Query: 301 WCF 303
           WC 
Sbjct: 301 WCL 303


>gi|163797271|ref|ZP_02191225.1| histidinol-phosphate aminotransferase [alpha proteobacterium
           BAL199]
 gi|159177566|gb|EDP62120.1| histidinol-phosphate aminotransferase [alpha proteobacterium
           BAL199]
          Length = 303

 Score =  233 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 161/302 (53%), Positives = 212/302 (70%), Gaps = 3/302 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M   +HF DL  + +  L  ++E AK  K    +    +PL GK+LAMIFEKPSTRTRVS
Sbjct: 1   MNAVRHFLDLDRLDAGTLRGMLEQAKAYKAG--DGVAARPLDGKILAMIFEKPSTRTRVS 58

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  MK LGG+ I LSG+++Q+GR ET+ DTA+VLSRYVD IV+RT  HS LLEL E+AT
Sbjct: 59  FESGMKRLGGEVIVLSGADLQIGRGETVSDTARVLSRYVDCIVIRTFLHSTLLELAEHAT 118

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD+THPCQ++AD+M FEEHRG +K ++ +WSGDGNN+  S I  A +F++ L 
Sbjct: 119 VPVINGLTDSTHPCQLLADVMAFEEHRGPIKDRVVAWSGDGNNMASSWIHAAVQFDFELR 178

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           IA P    P  E + WA+ +G  + + HD   AV+GA  V TDTW+    +      ++ 
Sbjct: 179 IACPPELMPPPEVIAWAKAKGGRITVLHDPAAAVRGADAVVTDTWV-SMGDEDTNRHNLL 237

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
             ++V+ +L++ A PDA+FMHCLPAHRGEEV   V+DGPQS+V+DEAENR+HTQ A+L W
Sbjct: 238 AAYRVDEALLAKAKPDAVFMHCLPAHRGEEVTAGVIDGPQSIVWDEAENRMHTQMAVLSW 297

Query: 302 CF 303
           C 
Sbjct: 298 CL 299


>gi|90022086|ref|YP_527913.1| ornithine carbamoyltransferase [Saccharophagus degradans 2-40]
 gi|89951686|gb|ABD81701.1| ornithine carbamoyltransferase [Saccharophagus degradans 2-40]
          Length = 303

 Score =  233 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 140/305 (45%), Positives = 188/305 (61%), Gaps = 3/305 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT P+HF  L ++S+  L  +I+ A  +K   +    ++P   +VL MIFEK STRTRVS
Sbjct: 1   MTKPRHFLTLEDLSAKELEEVIQRAIDLKAQHKAGTTDEPFKNQVLGMIFEKSSTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  IFLS  + QLGR E I D+A+VLSR VD +++RT  HS +    EY+ 
Sbjct: 61  FEAGMAQLGGSAIFLSSRDTQLGRGEPIEDSARVLSRMVDIVMIRTFEHSIVERFAEYSR 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPV+NALTD+ HPCQ++ADI TF EHRGS KGK  +W GDGNN+ HS I  A   ++ L 
Sbjct: 121 VPVMNALTDDYHPCQLLADIQTFVEHRGSPKGKTVAWVGDGNNMCHSYINAAKLCDFKLQ 180

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           IA P G +P  + +    ++     +  +AV+           +     ++ K +    F
Sbjct: 181 IACPEGFDPAPQLIAENSDRVTVTRIPEEAVKNADWVATDVWASM--GQEDEKKKRLAAF 238

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQ-SVVFDEAENRLHTQKAILL 300
             ++VN  LMS A  DA+FMHCLPAHRGEEV  E+L+    SVV+DEAENRLH QKA++L
Sbjct: 239 AGYEVNHKLMSHAKKDAIFMHCLPAHRGEEVSAELLEDENISVVWDEAENRLHAQKALML 298

Query: 301 WCFGI 305
           +  G 
Sbjct: 299 FLMGK 303


>gi|315497562|ref|YP_004086366.1| ornithine carbamoyltransferase [Asticcacaulis excentricus CB 48]
 gi|315415574|gb|ADU12215.1| ornithine carbamoyltransferase [Asticcacaulis excentricus CB 48]
          Length = 307

 Score =  233 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 156/305 (51%), Positives = 203/305 (66%), Gaps = 5/305 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNS-----SENIFENKPLSGKVLAMIFEKPSTRT 58
             KHF D+S++S+++L  I++ A   K +        +  + P   +VLAMIFEK STRT
Sbjct: 1   MVKHFLDISDLSATDLRAILDDAHARKKARLGWPKGRVDADAPAQDRVLAMIFEKNSTRT 60

Query: 59  RVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTE 118
           R SF+ A++ LGGD I  + ++MQLGR ETI DTAKVLSR VDAI++R   H  +  L  
Sbjct: 61  RFSFDAAIRQLGGDAIISTATDMQLGRGETIEDTAKVLSRMVDAIMIRANRHEDVERLAR 120

Query: 119 YATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNY 178
            A+VPVIN LT+ +HPCQI+AD+ T EEHRG +KGK  +W GDGNN+  S I  AARF++
Sbjct: 121 AASVPVINGLTNKSHPCQILADLQTIEEHRGDIKGKTLAWVGDGNNVCASFIHAAARFDF 180

Query: 179 LLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE 238
            LNIA P   +P N  + +A    A V +  D   AV+GA  V  DTW+SM         
Sbjct: 181 TLNIACPAKYKPSNADMVFAAESRARVTVTQDPEAAVRGADVVMADTWVSMGDLDHEERL 240

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F+P+QVN +LM +A PDALF+HCLPAHRGEEV + V+DGPQS V+DEAENR+H QKA+
Sbjct: 241 EAFEPYQVNEALMKLAGPDALFLHCLPAHRGEEVTDGVIDGPQSQVWDEAENRIHAQKAV 300

Query: 299 LLWCF 303
           L WC 
Sbjct: 301 LAWCL 305


>gi|253702330|ref|YP_003023519.1| ornithine carbamoyltransferase [Geobacter sp. M21]
 gi|251777180|gb|ACT19761.1| ornithine carbamoyltransferase [Geobacter sp. M21]
          Length = 303

 Score =  232 bits (592), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 132/302 (43%), Positives = 183/302 (60%), Gaps = 2/302 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             + F  LS  S + L  I  + K++K   +N  E+  L GK LAMIFEK STRTR+SFE
Sbjct: 1   MKRDFLALSQFSKAELDAIFLLTKELKEKQKNGVEHHLLKGKSLAMIFEKSSTRTRLSFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M  LGG  +F+S  + Q+GR E I DTA+V++RY D +++RT     + E  +YA+VP
Sbjct: 61  VGMYQLGGHPLFISSKDSQMGRGEPIKDTARVMARYCDGVMIRTFAQETVEEFAKYASVP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           +IN LTD  HPCQI+ADI T  EHRG  +G  F+W GDGNN+ +S IE AA F + L +A
Sbjct: 121 IINGLTDLHHPCQIMADIFTVIEHRGGYQGLKFAWIGDGNNMANSWIEAAAIFGFDLTLA 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR--EEHVF 241
            P G +P  + L WAR   +S  +     +       V      +   + + +   E  F
Sbjct: 181 CPEGYDPNPQVLEWARKHASSKIVVTRDPKQAAQDADVLNTDVWASMGQEEEQKIREKAF 240

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
             FQ+N  L+ +A  +A+ +HCLPAHRGEE+ ++V++GP S V+DEAENRLH QKAI+  
Sbjct: 241 AGFQLNEELLDLARGNAMVLHCLPAHRGEEITDDVIEGPHSAVWDEAENRLHVQKAIMAI 300

Query: 302 CF 303
             
Sbjct: 301 LM 302


>gi|46202842|ref|ZP_00208682.1| COG0078: Ornithine carbamoyltransferase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 316

 Score =  232 bits (592), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 162/304 (53%), Positives = 222/304 (73%), Gaps = 2/304 (0%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNS--SENIFENKPLSGKVLAMIFEKPSTRTRV 60
           ++ +HF DL + S+  L  +++ +  +K +       E +PL+GK+LAM+F++PSTRTRV
Sbjct: 10  SHVRHFLDLKDFSAETLRGVLDASAAMKRARVKGRRAEERPLTGKMLAMVFDRPSTRTRV 69

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF+VAM+ LGGDT+ L+G EMQLGR E++ DTA+VLSR+VDAIV+RT +H+ ++EL E+A
Sbjct: 70  SFDVAMRELGGDTLMLTGKEMQLGRGESVADTARVLSRFVDAIVIRTLDHTLMVELAEHA 129

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVINALT  +HPCQI+AD++TFEEHRG +KG+  +WSGD NN+L S +  AARF++ L
Sbjct: 130 TVPVINALTKVSHPCQIMADVLTFEEHRGPIKGRTIAWSGDANNVLASWVHAAARFDFTL 189

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
           N+A P         + WA  +GA V    DA  AV+GA  V TD W+SM  + +    ++
Sbjct: 190 NVAAPNELAMPPALVAWAEREGARVNATTDAYAAVEGADAVVTDCWVSMGDDDEHFRHNL 249

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
             P++V+ +LM+ A  DA+F+HCLPAHRGEEV  +V+DGPQSVVFDEAENRLH QK IL 
Sbjct: 250 LSPYRVDAALMAHAAKDAIFLHCLPAHRGEEVTADVIDGPQSVVFDEAENRLHAQKGILA 309

Query: 301 WCFG 304
           WC G
Sbjct: 310 WCLG 313


>gi|78221429|ref|YP_383176.1| ornithine carbamoyltransferase [Geobacter metallireducens GS-15]
 gi|123572912|sp|Q39Z73|OTC_GEOMG RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|78192684|gb|ABB30451.1| ornithine carbamoyltransferase [Geobacter metallireducens GS-15]
          Length = 303

 Score =  232 bits (592), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 126/304 (41%), Positives = 191/304 (62%), Gaps = 4/304 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT  +HF  L+  +   L  +  + +++K   +    ++ L GK +A+IFEK STRTR+S
Sbjct: 1   MT--RHFLALNQYTKEALDALFALTRELKEEQKKGIPHRILEGKSVALIFEKSSTRTRIS 58

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FEV +  LG   +F+S +  Q+GR E + DTA+V++RY D +++RT     + E   Y++
Sbjct: 59  FEVGVHQLGAHPLFISSATSQMGRGEPVRDTARVMARYCDGVMIRTYGQEIVEEFARYSS 118

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD  HPCQI+AD+ T  EH+G   G  F+W GDGNN+ ++ IE AA   + L 
Sbjct: 119 VPVINGLTDLFHPCQIMADLFTVIEHKGKYDGLKFAWVGDGNNMANTWIEAAAILGFDLA 178

Query: 182 IATPIGSEPRNEYLNWARNQ-GASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREEH 239
           +A P G EP     +WA+ +  +S+ +  D  +AV+ A  V TD W SM  ++ +   E 
Sbjct: 179 LACPEGYEPDRTVWDWAQKKATSSITITRDPKEAVRDADVVNTDVWASMGQEQEQKVREV 238

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ + ++  L+++A PD + +HCLPAHRGEE+ + V++GP+S V+DEAENRLH QKAI+
Sbjct: 239 AFKGYCLDDDLVALAKPDCMVLHCLPAHRGEEITDSVIEGPRSAVWDEAENRLHVQKAIM 298

Query: 300 LWCF 303
               
Sbjct: 299 ASLL 302


>gi|78044926|ref|YP_361070.1| ornithine carbamoyltransferase [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|123575554|sp|Q3A9W4|OTC_CARHZ RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|77997041|gb|ABB15940.1| ornithine carbamoyltransferase [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 311

 Score =  232 bits (592), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 148/304 (48%), Positives = 197/304 (64%), Gaps = 5/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F  +++++   +  ++++A ++K   +       L GK LAMIF K STRTRVSFEV 
Sbjct: 8   RDFLSMNDLTGEEIEEVLDLASELKIRQKKGISTPILKGKTLAMIFSKNSTRTRVSFEVG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +F++ ++ QL R E I DTA+VLSR VD I++RT +HS + EL  YA VPVI
Sbjct: 68  MVQLGGYPLFITATDSQLSRGEPIADTARVLSRMVDGIMIRTYSHSEVEELAYYADVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQI+AD++T +EH+G ++G   +W GDGNN+ HSL+ GAA+    + +ATP
Sbjct: 128 NGLTDYEHPCQIMADLLTIKEHKGQLRGLKVAWVGDGNNVCHSLMIGAAKVGMEVAVATP 187

Query: 186 IGSEPRNEYLNWARNQGASVALF----HDAVQAVKGAHCVFTDTWISMNQEFK-AREEHV 240
            G EP  +    A+ + +         HD V+AV GA  V TD W SM QE + A    V
Sbjct: 188 PGYEPDQKVSLIAQKETSRWGTKLLLTHDPVEAVTGADVVVTDVWASMGQEAESAERVKV 247

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+P+QVN  L+S A  D +F+HCLPAHRGEEV  EV+DG  SVVF EAENRLH QKAIL 
Sbjct: 248 FEPYQVNGELVSHAKQDFIFLHCLPAHRGEEVTAEVIDGEHSVVFAEAENRLHAQKAILT 307

Query: 301 WCFG 304
              G
Sbjct: 308 LLLG 311


>gi|77165891|ref|YP_344416.1| ornithine carbamoyltransferase [Nitrosococcus oceani ATCC 19707]
 gi|123593641|sp|Q3J8G0|OTC_NITOC RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|76884205|gb|ABA58886.1| ornithine carbamoyltransferase [Nitrosococcus oceani ATCC 19707]
          Length = 304

 Score =  232 bits (591), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 144/302 (47%), Positives = 190/302 (62%), Gaps = 3/302 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT P HF  L ++ +  +  ++  A  +K         +PL  +VL M+FEK STRTRVS
Sbjct: 1   MTVP-HFLTLFDLPADEIRQLVRRAIDLKALQRQGKIYEPLKNQVLGMLFEKSSTRTRVS 59

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FEV M  LGG+ +FLS  + QLGR E + DTA+VLSR VD +++RT +HS L   + Y+ 
Sbjct: 60  FEVGMIQLGGNAVFLSPRDTQLGRGEPLEDTARVLSRMVDCLMVRTFSHSMLEHFSAYSQ 119

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVINALTD+ HPCQ++ADI T+ EHRG ++G+  +W GDGNN+  S I  A +F++ L+
Sbjct: 120 VPVINALTDSYHPCQLLADIQTYFEHRGDIQGRTVAWIGDGNNMCQSYINAACQFDFQLH 179

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           IATP G  P    L  AR +   +A   +AV+           +     ++ K R     
Sbjct: 180 IATPAGYGPDPAILQMARERVQIIAEPREAVRGADLVVTDVWTSM--GQEKEKHRRLQDL 237

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
             +QVN  LMS+A  DALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA+L  
Sbjct: 238 ADYQVNGELMSLAKRDALFMHCLPAHRGEEVSAEVIDGPQSVVWDEAENRLHAQKALLEK 297

Query: 302 CF 303
             
Sbjct: 298 LL 299


>gi|118594730|ref|ZP_01552077.1| ornithine carbamoyltransferase [Methylophilales bacterium HTCC2181]
 gi|118440508|gb|EAV47135.1| ornithine carbamoyltransferase [Methylophilales bacterium HTCC2181]
          Length = 304

 Score =  232 bits (591), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 124/302 (41%), Positives = 174/302 (57%), Gaps = 2/302 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT  KHF   +++S+S +  I + AK IK+  +   +  PL  + L MIFEK STRTR+S
Sbjct: 1   MTI-KHFLKFNDLSASEIESIFDKAKWIKSKYKAYDKYWPLEDRTLVMIFEKASTRTRLS 59

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  I+L+  + QLGR E + D A+V+SR  D +++RT     +      + 
Sbjct: 60  FESGMHQLGGAAIYLNTRDSQLGRGEPVEDAAQVISRMCDVVMIRTFEQDIIERFARNSR 119

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LT+  HPCQI+ADI TF E RGS+KGK  +W GD NN+ ++ ++ A   ++ ++
Sbjct: 120 VPVINGLTNEYHPCQILADIFTFIEKRGSIKGKTVAWIGDSNNVCNTWLQAAELLDFNVH 179

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           ++TP G E   E      +                        T     +  K      F
Sbjct: 180 VSTPKGYEVELERAGLYSDDHFEQFDDPMDAAKGADIVTTDVWTS-MGFESEKKERIKDF 238

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
             +QV+  +M +A+ DALFMHCLPAHRGEEV +EV+DG QSVV++EAENRLH QKA+L +
Sbjct: 239 ADWQVDTDMMKLANKDALFMHCLPAHRGEEVTSEVIDGSQSVVWEEAENRLHVQKALLEY 298

Query: 302 CF 303
             
Sbjct: 299 LL 300


>gi|4185289|gb|AAD09004.1| ornithine carbamoyltransferase [Pyrococcus abyssi GE5]
          Length = 320

 Score =  232 bits (591), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 148/306 (48%), Positives = 197/306 (64%), Gaps = 5/306 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             +    L + +   +  I+E AK +K   +    ++ L GK LAMIF+KPSTRTRV FE
Sbjct: 6   KGRDLLCLQDYTPEEIWTILETAKMLKIWQKIGKPHRLLEGKTLAMIFQKPSTRTRVRFE 65

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VAM HLGG  ++L+  ++QL R ETI DTA+VLSRYVDAI+ R  +H  + +L +YA+VP
Sbjct: 66  VAMAHLGGHGLYLNAQDLQLRRGETIADTARVLSRYVDAIMARVYDHKDVEDLAKYASVP 125

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN L+D +HPCQ +AD MT  E +G++KG    + GDGNN+ HSL+    +    + +A
Sbjct: 126 VINGLSDFSHPCQALADYMTIWEKKGTIKGVKVIYVGDGNNVAHSLMIAGTKLGADVVVA 185

Query: 184 TPIGSEPRNEYLNWARNQGAS----VALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REE 238
           TP G EP  + + WA    A       L HD V+AVK A  ++TD W SM QE +A    
Sbjct: 186 TPEGYEPDEKVIKWADENAAESGGSFELLHDPVKAVKDADVIYTDVWASMGQEAEAEERR 245

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
            +F+PFQVN  L+  A P  +FMHCLPAHRGEEV ++V+D P SVV+DEAENRLH QKA+
Sbjct: 246 KIFRPFQVNKDLVKHAKPSYMFMHCLPAHRGEEVTDDVIDSPNSVVWDEAENRLHAQKAV 305

Query: 299 LLWCFG 304
           L    G
Sbjct: 306 LALLLG 311


>gi|310644303|ref|YP_003949062.1| ornithine carbamoyltransferase (argf) [Paenibacillus polymyxa SC2]
 gi|309249254|gb|ADO58821.1| Ornithine carbamoyltransferase (ArgF) [Paenibacillus polymyxa SC2]
          Length = 318

 Score =  232 bits (591), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 144/306 (47%), Positives = 196/306 (64%), Gaps = 5/306 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             + F +L + S   +  +I++A +IK   +N    +PL GK L +IFEK STRTRVSFE
Sbjct: 13  KGRDFLELDDYSPEEIQYLIDLAIEIKRKHKNGEAYQPLKGKTLGLIFEKSSTRTRVSFE 72

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M  LGG  +FLS +++QLGR E I D A+V+SRY+D I++RT  H  ++EL  YA+VP
Sbjct: 73  VGMYQLGGHALFLSKNDIQLGRGEPISDMAQVMSRYLDGIMIRTFGHDNVVELARYASVP 132

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN L+D  HPCQ++AD  T  E +G +KG   ++ GDGNN+ HSL+ G A+    ++IA
Sbjct: 133 VINGLSDLAHPCQVLADYQTLYEQKGKLKGLKLAYIGDGNNMAHSLLIGGAKLGVHVSIA 192

Query: 184 TPIGSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREE 238
           +P G EP    +      A+  G+ + +     +AVK A  ++TD W SM  E +    E
Sbjct: 193 SPAGYEPDPSVIAVSREIAKQTGSEIVITQSPQEAVKDADAIYTDVWASMGFEEEQKERE 252

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F  FQVN  L+ +A PD LF+HCLPAHRGEEV   V+DGP SV+FDEAENRLH QKA+
Sbjct: 253 LAFADFQVNEELVKLAKPDYLFLHCLPAHRGEEVSAGVIDGPNSVIFDEAENRLHAQKAL 312

Query: 299 LLWCFG 304
           L+   G
Sbjct: 313 LVALMG 318


>gi|300709564|ref|YP_003735378.1| ornithine carbamoyltransferase [Halalkalicoccus jeotgali B3]
 gi|299123247|gb|ADJ13586.1| ornithine carbamoyltransferase [Halalkalicoccus jeotgali B3]
          Length = 301

 Score =  232 bits (591), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 134/303 (44%), Positives = 182/303 (60%), Gaps = 5/303 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT  +HF D+ ++S+  L  +++ A   K        +  L  + L M+F+KPSTRTRVS
Sbjct: 1   MT--RHFIDIDDLSAEELEEVLDRAVAYKEKQHEGVSHPDLERQTLGMLFQKPSTRTRVS 58

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  +FL   ++QLG  E + DTA+ LS YVDAI+ R   H+ + EL  YAT
Sbjct: 59  FETGMTQLGGHAVFLGERDIQLGHGEPLKDTARALSGYVDAIMARVFEHANIEELARYAT 118

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD+ HPCQ +AD++T  E  G ++G   +W GD NN+  S   G A     L 
Sbjct: 119 VPVINGLTDDAHPCQTLADLLTIREAVGELEGTSVAWVGDANNVARSFALGCAIAGVDLT 178

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHV 240
           +ATP       +++  A + GA   +  D  +AV GA  V+TD WISM QE +       
Sbjct: 179 VATPPEYALDADHVERADSFGAVPTVTDDPAEAVAGADVVYTDVWISMGQEDQRDYRLAA 238

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+ FQVN  L+  A  DA  MHCLPAHRGEE+ +EV++G +S+VF++AENRLH QK +L 
Sbjct: 239 FEGFQVNEDLL--ADTDARVMHCLPAHRGEEITDEVVEGERSLVFEQAENRLHAQKGLLS 296

Query: 301 WCF 303
           W  
Sbjct: 297 WLL 299


>gi|222529531|ref|YP_002573413.1| ornithine carbamoyltransferase [Caldicellulosiruptor bescii DSM
           6725]
 gi|222456378|gb|ACM60640.1| ornithine carbamoyltransferase [Caldicellulosiruptor bescii DSM
           6725]
          Length = 308

 Score =  232 bits (591), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 141/308 (45%), Positives = 204/308 (66%), Gaps = 6/308 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            +HF  L+++S  ++  +IE+A K+K  ++  F    L  K L +IF K STRTRVSFEV
Sbjct: 1   MRHFLHLNDLSKEDILYLIELASKLKKEAKRGFYFPYLKNKALGLIFTKASTRTRVSFEV 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG +++L  +++QLGR ETI DTAKVLSRY+D IV+RT     +    +Y+++PV
Sbjct: 61  GIHQLGGYSLYLGKNDLQLGRGETIEDTAKVLSRYLDLIVIRTYEQKEVEAFAKYSSIPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD+ HP QIIAD  T  E +G +     ++ GDGNN+  +L+ GAA+    + +AT
Sbjct: 121 INGLTDDYHPTQIIADFQTIFEEKGRLSNLKIAYVGDGNNVAATLLVGAAKLGIDIAVAT 180

Query: 185 PIGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEH 239
           P G E + E +++    A+N  ++V   +   +AVK A  V+TDTW+SM QE +  +   
Sbjct: 181 PPGYEIKKEVVDFALDEAKNSKSNVIFTYSPKEAVKDADVVYTDTWVSMGQEEEKEKRIR 240

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ +QV+ +LM +A  DA+F+HCLPA+RG EV +EV+DGPQS VFDEAENRLH  KAI+
Sbjct: 241 DFEGYQVDSTLMKLAKDDAIFLHCLPAYRGFEVTSEVIDGPQSRVFDEAENRLHAHKAIM 300

Query: 300 LW-CFGII 306
           ++ C G I
Sbjct: 301 IFVCVGKI 308


>gi|84685278|ref|ZP_01013176.1| ornithine carbamoyltransferase [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84666435|gb|EAQ12907.1| ornithine carbamoyltransferase [Rhodobacterales bacterium HTCC2654]
          Length = 308

 Score =  232 bits (590), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 161/308 (52%), Positives = 211/308 (68%), Gaps = 7/308 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKP-----LSGKVLAMIFEKPSTRTR 59
            +HF D++    ++L  +++ A +IK    +  +  P     L+GKV+A+IFEKPSTRTR
Sbjct: 1   MRHFLDINATDPADLRTMLDEAHRIKAGRGDAAKGVPDDEQALAGKVVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V ++ +GG+T+ LSGSEMQLG  E+I DTA+VLSRYVD I++RT   S L EL E+
Sbjct: 61  VSFDVGVRQMGGETLVLSGSEMQLGHGESIPDTARVLSRYVDLIMIRTFEESALQELAEF 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ATVPVIN LT+ THPCQI+ADI+T+EEHRG + GK   W+GDGNN+  S I  A +  + 
Sbjct: 121 ATVPVINGLTNRTHPCQIMADILTYEEHRGPIAGKKVVWTGDGNNVCASFIHAAGQLGFD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L    P    P  E++  AR +G  + +  D   AVKGA  V TDTW+SM+     RE  
Sbjct: 181 LTYTGPERLGPDREFVEEARAKGVKIEIERDPHAAVKGADLVVTDTWVSMHDAPSTRERR 240

Query: 240 VF--QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
               + +QV+  LM+ A+PDALFMHCLPAHR EEV + V+DGPQSVVFDEAENRLH QKA
Sbjct: 241 HNLLRAYQVDDRLMAGANPDALFMHCLPAHRNEEVTDAVMDGPQSVVFDEAENRLHAQKA 300

Query: 298 ILLWCFGI 305
           I+ WC G+
Sbjct: 301 IMRWCLGV 308


>gi|296536734|ref|ZP_06898792.1| ornithine carbamoyltransferase [Roseomonas cervicalis ATCC 49957]
 gi|296262938|gb|EFH09505.1| ornithine carbamoyltransferase [Roseomonas cervicalis ATCC 49957]
          Length = 320

 Score =  232 bits (590), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 161/302 (53%), Positives = 221/302 (73%), Gaps = 6/302 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           P+HF +L++  ++ L  ++ +A   K         KPL+GK +A+IFEKPSTRTRVSFEV
Sbjct: 19  PRHFLELADFDAATLRHMLALAADAKAGR---VPEKPLAGKSVALIFEKPSTRTRVSFEV 75

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            ++ LGG  + LS  +MQLGR E++ DTA+VLSRYVDAI++RT + ++L  L E+ATVPV
Sbjct: 76  GIQKLGGHAVVLSARDMQLGRGESVADTARVLSRYVDAIMLRTDSVAKLRGLAEHATVPV 135

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD +HPCQ++ADI+TFEEHRG V GK+F+W+GDGNN+  S I+ AARF++ L +AT
Sbjct: 136 INGLTDVSHPCQLMADILTFEEHRGPVAGKVFAWTGDGNNVAQSFIQAAARFDFTLRLAT 195

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK---AREEHVF 241
           P    P  + ++WAR +GA V L  D V+AV+GA CV TDTW+SM+ E +   +   ++ 
Sbjct: 196 PPELAPPAQLVDWARREGARVELTSDPVEAVRGADCVVTDTWVSMSDEKEDGPSARHNML 255

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
            P+Q+N +L+  A P+A+ +HCLPAHRGEE+  EV++GPQSVVFDEAENRLH Q  +LLW
Sbjct: 256 APYQLNAALLRHAKPEAIVLHCLPAHRGEEITEEVIEGPQSVVFDEAENRLHAQNGVLLW 315

Query: 302 CF 303
             
Sbjct: 316 AL 317


>gi|83594606|ref|YP_428358.1| ornithine carbamoyltransferase [Rhodospirillum rubrum ATCC 11170]
 gi|83577520|gb|ABC24071.1| ornithine carbamoyltransferase [Rhodospirillum rubrum ATCC 11170]
          Length = 308

 Score =  232 bits (590), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 164/302 (54%), Positives = 211/302 (69%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M  P+HF +LS+  +  L  +++     K        + PL+GK LA+IFEKPSTRTRVS
Sbjct: 4   MKTPRHFLELSDFDAPALRAMLDRGLAFKAERRAGVVSAPLAGKTLALIFEKPSTRTRVS 63

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FEV M+ LGG +I LS +E QLGR ETI DTA+VLSRYVD I++RT + ++L +L++ A+
Sbjct: 64  FEVGMRQLGGSSITLSPTETQLGRGETIADTARVLSRYVDGIMLRTNDPAKLRDLSQNAS 123

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD  HPCQI+AD+MTFEEHRGS+ GK+ +W GDGNN+  S I+ +A F + + 
Sbjct: 124 VPVINGLTDAAHPCQIMADLMTFEEHRGSITGKVVTWVGDGNNVACSWIKASALFGFTMR 183

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +A P   EP    L+WAR  G +V +  D  +AV GA CV TDTW+SM  +  A    + 
Sbjct: 184 LACPAELEPPQGVLDWARANGGAVEVLRDPQEAVAGADCVVTDTWVSMGCDGAAARHALL 243

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           +P+QV   LM+ A  DALFMHCLPAHRGEEV  +V+DGPQSVV+DEAENRLH QK IL W
Sbjct: 244 RPYQVTAPLMAAAAADALFMHCLPAHRGEEVTEDVIDGPQSVVWDEAENRLHAQKGILAW 303

Query: 302 CF 303
           C 
Sbjct: 304 CM 305


>gi|258590899|emb|CBE67194.1| ornithine carbamoyltransferase (OTCase) [NC10 bacterium 'Dutch
           sediment']
          Length = 311

 Score =  231 bits (589), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 132/306 (43%), Positives = 181/306 (59%), Gaps = 5/306 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K    +S+++ S +  +  +A  +K        +  L GK L MIFEKPS RTRV+FE
Sbjct: 1   MKKDLLSISDLTVSEIDSLFFLAADLKAQQRKGVAHPLLPGKTLGMIFEKPSLRTRVTFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M  LGG  I+L+ +E+QLG  ET+ D AK L R+VD I+ RT  H  + EL  +A VP
Sbjct: 61  VGMAQLGGRAIYLAPAEIQLGVRETVKDVAKNLERWVDGIIARTFAHRTVEELAAHAAVP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN L+D THPCQI+AD+ T +E  G++ G   ++ GDGNN+ HS + GAAR    L++A
Sbjct: 121 VINGLSDLTHPCQILADLFTLQEKCGTLHGVKVAYIGDGNNVCHSWLYGAARTGIELHVA 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQ-----EFKAREE 238
            P G EP    +  +R +  +       +   + A       +  +          A+  
Sbjct: 181 CPKGYEPDAGIVAASRQEAEAAGGRITLLNDARAAAERADVLYTDVWTSMGQETETAKRR 240

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
           H F+ FQVN +L+ +A PD L MHCLPAHRGEE+ +EVLDGP S+V+DEAENRLH QKAI
Sbjct: 241 HDFRGFQVNAALVRLAKPDVLVMHCLPAHRGEEITDEVLDGPHSIVYDEAENRLHVQKAI 300

Query: 299 LLWCFG 304
           L+   G
Sbjct: 301 LVTLLG 306


>gi|319406504|emb|CBI80146.1| Ornithine carbamoyltransferase [Bartonella sp. 1-1C]
          Length = 313

 Score =  231 bits (589), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 186/303 (61%), Positives = 239/303 (78%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M    +HF D+S ++      +I+ AK +K + ++    KP +GK LAMIFEKPSTRTRV
Sbjct: 1   MTHTLRHFTDISILTPQRARALIDYAKTLKAAFKSGENLKPFAGKTLAMIFEKPSTRTRV 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF++ M+ LGG+TI L+GSEMQLG +ETI DTA+VLSR+V+AI++RTT H R+LEL +YA
Sbjct: 61  SFDLGMRQLGGETIMLTGSEMQLGHSETIADTARVLSRFVEAIIIRTTAHHRMLELAQYA 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
            +PVINALTD+THPCQI+ADI+T+EEHRG++ GK F+W GDGNN+LHSLIE  A FN+ L
Sbjct: 121 QIPVINALTDDTHPCQILADILTYEEHRGTIAGKTFAWMGDGNNVLHSLIEATALFNFHL 180

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
           +IATP GSEP+ +Y+NWAR +GA + L H+  +A +   C+ TDTW+SM QEF A+   +
Sbjct: 181 HIATPQGSEPQEKYINWARERGAHIMLTHNPQKAAENVDCIITDTWVSMGQEFHAKNYSI 240

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           FQP+QVN +LM+ A PDALFMHCLPAHRGEEV++ V+DGP SVVFDEAENRLH QKAIL 
Sbjct: 241 FQPYQVNEALMAFAKPDALFMHCLPAHRGEEVVDAVIDGPHSVVFDEAENRLHAQKAILS 300

Query: 301 WCF 303
           WC 
Sbjct: 301 WCL 303


>gi|292492306|ref|YP_003527745.1| ornithine carbamoyltransferase [Nitrosococcus halophilus Nc4]
 gi|291580901|gb|ADE15358.1| ornithine carbamoyltransferase [Nitrosococcus halophilus Nc4]
          Length = 304

 Score =  231 bits (589), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 152/298 (51%), Positives = 190/298 (63%), Gaps = 4/298 (1%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAM 66
           HF  L ++ +  L  ++  A  +K         +PL  KVL M+FEK STRTRVSFE  M
Sbjct: 5   HFLTLLDLPADELRQLVLRAMDLKTLQRQGKIYEPLKNKVLGMLFEKSSTRTRVSFEAGM 64

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
             LGG  IFLS  + QLGR E I DTA+VLSR VD +++RT +HS L     Y+ VPVIN
Sbjct: 65  AQLGGSAIFLSPQDTQLGRGEPIEDTARVLSRMVDCLMVRTFSHSMLERFAAYSRVPVIN 124

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI 186
           ALTD  HPCQ++ADI T+ EHRG ++G+  +W GDGNN+  S I  A +F++ L IATP+
Sbjct: 125 ALTDGYHPCQLLADIQTYLEHRGGIQGRTIAWIGDGNNMCQSYINAACQFDFQLRIATPV 184

Query: 187 GSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHVFQPFQ 245
           G EP    L  A  +   +    D  +A KGA  V TD W SM QE +  R    F  +Q
Sbjct: 185 GYEPDPTILQTAGERAQIMI---DPREAAKGADLVVTDVWTSMGQEKEKLRRLQDFADYQ 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +N  LM++A  DALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA+L    
Sbjct: 242 INSKLMALAQEDALFMHCLPAHRGEEVTAEVIDGPQSVVWDEAENRLHAQKALLEKLL 299


>gi|254472066|ref|ZP_05085467.1| ornithine carbamoyltransferase [Pseudovibrio sp. JE062]
 gi|211959268|gb|EEA94467.1| ornithine carbamoyltransferase [Pseudovibrio sp. JE062]
          Length = 312

 Score =  231 bits (589), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 169/304 (55%), Positives = 222/304 (73%), Gaps = 1/304 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-PLSGKVLAMIFEKPSTRTRV 60
           +T P+HF D+S+ SS  L  I++V+K+IK++   +   + PL+GKVLAM+FE+PSTRTR+
Sbjct: 4   LTKPQHFLDISDFSSDELRHIMDVSKQIKSTRNGVHRGQGPLAGKVLAMVFEQPSTRTRI 63

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF+V M+ LGG+T+ L+G+EMQLGR E+I DTA+VLSR+VD I++R  +H  + EL EYA
Sbjct: 64  SFDVGMRELGGETLMLTGAEMQLGRGESIPDTARVLSRFVDMIMIRMLDHDAVRELAEYA 123

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVIN LT  +HPCQI+ADIMTFEEHRGS+KGK  SW GD NN+L+S IE A++F++ +
Sbjct: 124 TVPVINGLTKISHPCQIMADIMTFEEHRGSIKGKTVSWVGDSNNVLYSWIEAASKFDFKI 183

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
           N+A P       E++  A   GA +++  D   AVK + CV TD W+SM         ++
Sbjct: 184 NVAAPNELTVPLEWIEKAYTSGAELSVTDDPFAAVKNSDCVITDCWVSMGDSDAETRHNM 243

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
              +QVN  LMS A+  ALFMHCLPAHRGEEV NEV+DGP SVVFDEAENRLH QK I+ 
Sbjct: 244 LAAYQVNERLMSEANDSALFMHCLPAHRGEEVTNEVIDGPHSVVFDEAENRLHAQKGIMA 303

Query: 301 WCFG 304
           WC G
Sbjct: 304 WCMG 307


>gi|254434875|ref|ZP_05048383.1| ornithine carbamoyltransferase [Nitrosococcus oceani AFC27]
 gi|207091208|gb|EDZ68479.1| ornithine carbamoyltransferase [Nitrosococcus oceani AFC27]
          Length = 306

 Score =  231 bits (588), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 144/302 (47%), Positives = 190/302 (62%), Gaps = 3/302 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT P HF  L ++ +  +  ++  A  +K         +PL  +VL M+FEK STRTRVS
Sbjct: 3   MTVP-HFLTLFDLPADEIRQLVRRAIDLKALQRQGKIYEPLKNQVLGMLFEKSSTRTRVS 61

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FEV M  LGG+ +FLS  + QLGR E + DTA+VLSR VD +++RT +HS L   + Y+ 
Sbjct: 62  FEVGMIQLGGNAVFLSPRDTQLGRGEPLEDTARVLSRMVDCLMVRTFSHSMLEHFSAYSQ 121

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVINALTD+ HPCQ++ADI T+ EHRG ++G+  +W GDGNN+  S I  A +F++ L+
Sbjct: 122 VPVINALTDSYHPCQLLADIQTYFEHRGDIQGRTVAWIGDGNNMCQSYINAACQFDFQLH 181

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           IATP G  P    L  AR +   +A   +AV+           +     ++ K R     
Sbjct: 182 IATPAGYGPDPAILQMARERVQIIAEPREAVRGADLVVTDVWTSM--GQEKEKHRRLQDL 239

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
             +QVN  LMS+A  DALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA+L  
Sbjct: 240 ADYQVNGELMSLAKRDALFMHCLPAHRGEEVSAEVIDGPQSVVWDEAENRLHAQKALLEK 299

Query: 302 CF 303
             
Sbjct: 300 LL 301


>gi|242399560|ref|YP_002994985.1| Ornithine carbamoyltransferase [Thermococcus sibiricus MM 739]
 gi|242265954|gb|ACS90636.1| Ornithine carbamoyltransferase [Thermococcus sibiricus MM 739]
          Length = 315

 Score =  231 bits (588), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 142/304 (46%), Positives = 193/304 (63%), Gaps = 5/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +    L + +   +  I++ A+ +K  ++    ++ L GK LAMIF+KPSTRTR+SFEV 
Sbjct: 8   RDILCLQDFTREEIETILKTAEMMKIWNKIGKPHRVLEGKTLAMIFQKPSTRTRISFEVG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  ++L+  ++QL R ETI DTA+VLSRYVD I+ R  +H  +++L +Y +VPVI
Sbjct: 68  IYQLGGYGLYLNAQDLQLRRGETIADTARVLSRYVDGIMARVFDHQDVVDLAKYGSVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D +HPCQ +AD MT +E +G ++G    + GDGNN+ HSL+    +    + +ATP
Sbjct: 128 NGLSDFSHPCQALADYMTIKEKKGRIEGIKVVYVGDGNNVAHSLMIAGTKLGANVVVATP 187

Query: 186 IGSEPRNEYLNWARNQGAS----VALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHV 240
            G EP    + WA    A       L HD VQAVK A  ++TD W SM QE +A     V
Sbjct: 188 EGYEPDARVIKWAEENAAESGGSFELLHDPVQAVKDADVIYTDVWASMGQEAEAEERRKV 247

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F PFQVN  L+  A  D +FMHCLPAHRGEEV ++V+D P SVVFDEAENRLH QKA + 
Sbjct: 248 FMPFQVNKDLVKHAKKDYIFMHCLPAHRGEEVTDDVVDSPNSVVFDEAENRLHAQKAAMA 307

Query: 301 WCFG 304
              G
Sbjct: 308 LIMG 311


>gi|255019821|ref|ZP_05291897.1| Ornithine carbamoyltransferase [Acidithiobacillus caldus ATCC
           51756]
 gi|254970750|gb|EET28236.1| Ornithine carbamoyltransferase [Acidithiobacillus caldus ATCC
           51756]
          Length = 313

 Score =  231 bits (588), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 131/304 (43%), Positives = 180/304 (59%), Gaps = 3/304 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT P+HF  L ++S + L+ ++  A ++K  +     + PL GK LAMIFEK STRTRVS
Sbjct: 1   MTTPRHFLRLQDLSRAELTALLHRAAELKRQTRAGEVHAPLRGKTLAMIFEKSSTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FEV M  LGG  +FLS  + QLGR E+I DTA+VLSR VD +++RT  H  LL     + 
Sbjct: 61  FEVGMAQLGGHALFLSPRDTQLGRGESIEDTARVLSRMVDLVMIRTFGHDNLLRFAAASR 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAAR-FNYLL 180
           VPVIN L+D+ HPCQ++AD++T +E  G ++G+  ++ GDG+N +      AA   ++ L
Sbjct: 121 VPVINGLSDDHHPCQLLADLLTAQELWGDLRGRRIAFIGDGSNNMARSWMEAADLLDFEL 180

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            I  P    P  E                 A +           +     +  +A  +  
Sbjct: 181 RIGAPRAFWPSAELRAAHAGHSHFFDSAAAAAEGAGMLVTDVWTSM--GQEAEQAARKAT 238

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F PFQVN  LM+ A P A+FMHCLPAHRGEEV  EVL+GP+S+V+DEAENRLH QKA++ 
Sbjct: 239 FGPFQVNAELMAKAAPGAVFMHCLPAHRGEEVTAEVLEGPRSLVWDEAENRLHAQKALME 298

Query: 301 WCFG 304
           +  G
Sbjct: 299 FLSG 302


>gi|34497448|ref|NP_901663.1| ornithine carbamoyltransferase [Chromobacterium violaceum ATCC
           12472]
 gi|56404396|sp|Q7NWJ6|OTC_CHRVO RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|34103303|gb|AAQ59665.1| ornithine carbamoyltransferase [Chromobacterium violaceum ATCC
           12472]
          Length = 307

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 125/302 (41%), Positives = 174/302 (57%), Gaps = 1/302 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT  +H+   S++S      + E ++ +K        ++PL GKV++M+FEK STRTRVS
Sbjct: 1   MTSVRHYLQFSDLSPDEYHHLFERSRVLKRRQSAGELHRPLVGKVMSMVFEKNSTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  +FL     Q+GR E I DTA+VLSR  D I++RT     +  L  ++ 
Sbjct: 61  FEAGMAQLGGHAMFLDTKSSQIGRGEPIEDTARVLSRMSDIIMIRTFEQGLVQRLAAHSR 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LT+  HPCQ++ADI T+ E  GS+KGK  +W GDGNN+  + ++ AA   + L 
Sbjct: 121 VPVINGLTNEYHPCQVLADIFTYVERHGSIKGKTVAWVGDGNNVCRTWLQAAAVLGFKLK 180

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +A+P+G E +        +    +                   T     +  +A     F
Sbjct: 181 VASPLGYELQTLDGRHYGSDVLEMTRDPARAVHGADIVTTDVFTS-MGFEAEQAARREAF 239

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           + +QV   LM  A P+ALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENR+H QKA++ +
Sbjct: 240 EGYQVTAELMKQAKPEALFMHCLPAHRGEEVAAEVIDGPQSVVWDEAENRMHVQKALIEY 299

Query: 302 CF 303
             
Sbjct: 300 LL 301


>gi|254492475|ref|ZP_05105647.1| ornithine carbamoyltransferase [Methylophaga thiooxidans DMS010]
 gi|224462367|gb|EEF78644.1| ornithine carbamoyltransferase [Methylophaga thiooxydans DMS010]
          Length = 298

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 141/298 (47%), Positives = 193/298 (64%), Gaps = 2/298 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            +HF  L ++SS  L  +I  A ++K    N    +PL  +VLAMIFEK STRTRVSFE 
Sbjct: 1   MRHFLTLKDLSSVELKQLINRASELKTMHHNGEIYQPLKNQVLAMIFEKSSTRTRVSFES 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           AM   GG +IFLS  + QLGR E + D+A+V+S  VDA+++RT  HS+L    ++++VPV
Sbjct: 61  AMIQFGGGSIFLSPDDTQLGRGEPVEDSARVISSMVDAVMIRTFEHSKLETFAKFSSVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALTD+ HPCQ++AD+ T++EHRGS+ GK   W GDGNN+ HS I  A +F + L+IAT
Sbjct: 121 INALTDDFHPCQLLADMQTYQEHRGSIDGKKVVWIGDGNNMCHSYINAAQQFGFELHIAT 180

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P G EP    ++  + +         A +           +     +E + + E  F  F
Sbjct: 181 PEGYEPNQSLIDSTQAEIQLFNDPIKATEGADLVVTDVWASM--GQEEEQRKREAAFASF 238

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           QV+ ++M++A  +ALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA+L + 
Sbjct: 239 QVDQAVMNVAAKNALFMHCLPAHRGEEVTAEVIDGPQSVVWDEAENRLHAQKALLEFL 296


>gi|312622239|ref|YP_004023852.1| ornithine carbamoyltransferase [Caldicellulosiruptor kronotskyensis
           2002]
 gi|312202706|gb|ADQ46033.1| ornithine carbamoyltransferase [Caldicellulosiruptor kronotskyensis
           2002]
          Length = 308

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 140/308 (45%), Positives = 204/308 (66%), Gaps = 6/308 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            +HF  L+++S  ++  ++E+A K+K  ++  F    L  K L +IF K STRTRVSFEV
Sbjct: 1   MRHFLHLNDLSKEDILYLVELASKLKKEAKRGFYFPYLKNKALGLIFTKASTRTRVSFEV 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG +++L  +++QLGR ETI DTAKVLSRY+D IV+RT     + E  +Y+++PV
Sbjct: 61  GIHQLGGYSLYLGKNDLQLGRGETIEDTAKVLSRYLDLIVIRTYEQKEVEEFAKYSSIPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD+ HP QIIAD  T  E +G +     ++ GDGNN+  +L+ GAA+    + +AT
Sbjct: 121 INGLTDDYHPTQIIADFQTIFEEKGRLSNLKIAYVGDGNNVAATLLVGAAKLGLDIAVAT 180

Query: 185 PIGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEH 239
           P G E + E +++    A+   +++   +   +AVK A  V+TDTW+SM QE +  +   
Sbjct: 181 PPGYEIKKEVVDFALDEAKKSKSNIIFTYSPKEAVKDADVVYTDTWVSMGQEEEKEKRIR 240

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ +QV+ SLM +A  DA+F+HCLPA+RG EV +EV+DGPQS VFDEAENRLH  KAI+
Sbjct: 241 DFEGYQVDSSLMKLAKDDAIFLHCLPAYRGFEVTSEVIDGPQSRVFDEAENRLHAHKAIM 300

Query: 300 LW-CFGII 306
           ++ C G I
Sbjct: 301 IFVCVGKI 308


>gi|217968170|ref|YP_002353676.1| ornithine carbamoyltransferase [Dictyoglomus turgidum DSM 6724]
 gi|217337269|gb|ACK43062.1| ornithine carbamoyltransferase [Dictyoglomus turgidum DSM 6724]
          Length = 309

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 136/305 (44%), Positives = 188/305 (61%), Gaps = 7/305 (2%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFE-NKPLSGKVLAMIFEKPSTRTRVSF 62
             +    + ++S  ++  I  +AK +K+      + +  L GK +A+ FEKPSTRTR+SF
Sbjct: 5   KGRDLLSILDLSREDMEQIFHLAKNLKSEYYAGKKIHDYLKGKTVALFFEKPSTRTRISF 64

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           EV +  LGG  ++L+  EMQL R ETI DTA+VL RYVD I+ R  +H  L+EL +++++
Sbjct: 65  EVGVYQLGGYPLYLNAQEMQLKRGETIADTARVLERYVDGIMARVYSHDTLVELAQHSSI 124

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVIN L+D  HPCQIIAD  T  E +G  K     + GDGNN+ +SLI   A     +  
Sbjct: 125 PVINGLSDLEHPCQIIADYFTIIEKKGFRK-LKVVYLGDGNNVANSLILAGAILGMNVVC 183

Query: 183 ATPIGSEPRNEYLNWARNQGASV----ALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-E 237
           ++P    P  + L+ A N          +  D  +AVKGA  ++TD W+SM QE +    
Sbjct: 184 SSPFQFMPPKKILDEANNLAKKYGGKVEIVEDPKEAVKGADVIYTDVWVSMGQEEEKELR 243

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
           + VF P+QVN  L+S+A  D + MHCLPAHRGEE+ +EV+DGP SVVFDEAENRLH QKA
Sbjct: 244 KRVFPPYQVNKELVSLAKEDVIVMHCLPAHRGEEITDEVIDGPNSVVFDEAENRLHVQKA 303

Query: 298 ILLWC 302
           I+   
Sbjct: 304 IMALL 308


>gi|124485142|ref|YP_001029758.1| ornithine carbamoyltransferase [Methanocorpusculum labreanum Z]
 gi|189036329|sp|A2SQ85|OTC_METLZ RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|124362683|gb|ABN06491.1| ornithine carbamoyltransferase [Methanocorpusculum labreanum Z]
          Length = 305

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 135/301 (44%), Positives = 195/301 (64%), Gaps = 1/301 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K F  ++++S+     I+ +A ++K        +  L+GK LAMIFEK STRTR+SF+
Sbjct: 1   MKKDFLSITDLSAEEYEDILTLAARLKRQRYAGVPHPLLAGKTLAMIFEKASTRTRMSFD 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M  LGG  ++L+  + QLGR ET+ DTA+V+SRYV   +MRT  H  + E  +YA++P
Sbjct: 61  VGMYDLGGYALYLNAKDTQLGRGETVADTARVMSRYVHGAIMRTYKHETITEFAKYASIP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINAL+D  HPCQI+AD +T +E  G + G   +W GDGNN+ +SLI  + +    + + 
Sbjct: 121 VINALSDKEHPCQIMADSLTLKEKFGELDGLKIAWIGDGNNVCNSLIMASVQTGMEIAVG 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREEHVFQ 242
           TP G EP    + +A+  G  V ++ D V+AV  AH ++TDTWISM +E  K  +   F 
Sbjct: 181 TPKGYEPDPAAVKFAKENGGKVTIYDDPVRAVSDAHAIYTDTWISMGEEDIKETKLKDFV 240

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            +Q++ +L++ A  DAL +HCLPAHRGEE+ +EV+D  QS V+D+AENRLH QKAIL+  
Sbjct: 241 GYQLDTALLNKAADDALVLHCLPAHRGEEITDEVIDSMQSGVWDQAENRLHAQKAILVRL 300

Query: 303 F 303
            
Sbjct: 301 M 301


>gi|114778319|ref|ZP_01453178.1| ornithine carbamoyltransferase [Mariprofundus ferrooxydans PV-1]
 gi|114551421|gb|EAU53977.1| ornithine carbamoyltransferase [Mariprofundus ferrooxydans PV-1]
          Length = 301

 Score =  230 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 154/300 (51%), Positives = 192/300 (64%), Gaps = 1/300 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KHF  L +I+      I++ A+K+K         +PL GK LAMIF+K STRTRVSFEV
Sbjct: 1   MKHFLTLLDITPDEARHILKRAEKMKRKLREGKAFRPLEGKTLAMIFDKASTRTRVSFEV 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG  +FL  +  QLGR E + D+A+VLS  VD +++RT  H  +    EY++VPV
Sbjct: 61  GMYQLGGHALFLHSATTQLGRGEPVEDSARVLSGMVDGVMIRTFAHDTIQRFAEYSSVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD THPCQI+ D+ T+EE RGS++GK  +W GDGNN+ HS I GA  F Y L IA 
Sbjct: 121 INGLTDLTHPCQILTDVFTYEEQRGSIEGKTVAWVGDGNNMAHSWINGAVTFGYQLRIAC 180

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQP 243
           P G  P ++ L+ AR  GA V L  D ++AV  A  V TD W SM QE + A     F  
Sbjct: 181 PPGYCPDDKTLSAARALGADVTLTDDPLEAVANADLVTTDVWASMGQEDEQAERVKAFAG 240

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           F V+   MS A PDALFMHCLPAHRGEEV  +V+DG QSVV+ EAENRLH QK +L +  
Sbjct: 241 FCVDARTMSYAGPDALFMHCLPAHRGEEVSADVIDGAQSVVWTEAENRLHAQKGLLEFLM 300


>gi|312876846|ref|ZP_07736823.1| ornithine carbamoyltransferase [Caldicellulosiruptor lactoaceticus
           6A]
 gi|311796361|gb|EFR12713.1| ornithine carbamoyltransferase [Caldicellulosiruptor lactoaceticus
           6A]
          Length = 308

 Score =  230 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 140/308 (45%), Positives = 204/308 (66%), Gaps = 6/308 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            +HF  L+++S  ++  ++E+A ++K  ++  F    L  K L +IF K STRTRVSFEV
Sbjct: 1   MRHFLHLNDLSKEDILYLVELASRLKKEAKRGFYFPYLKNKALGLIFTKASTRTRVSFEV 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG +++L  +++QLGR ETI DTAKVLSRY+D IV+RT     + E  +Y+++PV
Sbjct: 61  GIHQLGGYSLYLGKNDLQLGRGETIEDTAKVLSRYLDLIVIRTYEQKEVEEFAKYSSIPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD+ HP QIIAD  T  E +G +     ++ GDGNN+  +L+ GAA+    + +AT
Sbjct: 121 INGLTDDYHPTQIIADFQTIFEEKGRLSSLKIAYVGDGNNVAATLLVGAAKLGLDIAVAT 180

Query: 185 PIGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEH 239
           P G E + E +++    A+   ++V   +   +AVK A  V+TDTW+SM QE +  +   
Sbjct: 181 PPGYEIKKEVVDFALEEAKKSKSNVIFTYSPKEAVKDADVVYTDTWVSMGQEEEKEKRIR 240

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ +QV+ SLM +A  DA+F+HCLPA+RG EV +EV+DGPQS VFDEAENRLH  KAI+
Sbjct: 241 DFERYQVDTSLMRLAKDDAIFLHCLPAYRGFEVTSEVIDGPQSRVFDEAENRLHAHKAIM 300

Query: 300 LW-CFGII 306
           ++ C G I
Sbjct: 301 IFVCLGKI 308


>gi|312793755|ref|YP_004026678.1| ornithine carbamoyltransferase [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312180895|gb|ADQ41065.1| ornithine carbamoyltransferase [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 308

 Score =  230 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 140/308 (45%), Positives = 204/308 (66%), Gaps = 6/308 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            +HF  L+++S  ++  ++E+A ++K  ++  F    L  K L +IF K STRTRVSFEV
Sbjct: 1   MRHFLHLNDLSKEDILYLVELASRLKKEAKRGFYFPYLKNKALGLIFTKASTRTRVSFEV 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG +++L  +++QLGR ETI DTAKVLSRY+D IV+RT     + E  +Y+++PV
Sbjct: 61  GIHQLGGYSLYLGKNDLQLGRGETIEDTAKVLSRYLDLIVIRTYEQKEVEEFAKYSSIPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD+ HP QIIAD  T  E +G +     ++ GDGNN+  +L+ GAA+    + +AT
Sbjct: 121 INGLTDDYHPTQIIADFQTIFEEKGRLSSLKIAYVGDGNNVAATLLVGAAKLGLDIAVAT 180

Query: 185 PIGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEH 239
           P G E + E +++    A+   ++V   +   +AVK A  V+TDTW+SM QE +  +   
Sbjct: 181 PPGYEIKKEVVDFALDEAKKSKSNVIFTYSPKEAVKDADVVYTDTWVSMGQEEEKEKRIR 240

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ +QV+ SLM +A  DA+F+HCLPA+RG EV +EV+DGPQS VFDEAENRLH  KAI+
Sbjct: 241 DFERYQVDTSLMRLAKDDAIFLHCLPAYRGFEVTSEVIDGPQSRVFDEAENRLHAHKAIM 300

Query: 300 LW-CFGII 306
           ++ C G I
Sbjct: 301 IFVCLGKI 308


>gi|189426198|ref|YP_001953375.1| ornithine carbamoyltransferase [Geobacter lovleyi SZ]
 gi|189422457|gb|ACD96855.1| ornithine carbamoyltransferase [Geobacter lovleyi SZ]
          Length = 303

 Score =  230 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 135/304 (44%), Positives = 191/304 (62%), Gaps = 4/304 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT  +HF  L + +   L  ++ +A  +K   +N  E+  L GK LAMIFEK STRTR+S
Sbjct: 1   MT--RHFLALHDFTRQELDAMLALAADLKQKQKNGVEHHLLKGKTLAMIFEKASTRTRIS 58

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FEV +  LGG  +F+S +  Q+GR E I D+A+V++RY D +++RT     + E   Y+ 
Sbjct: 59  FEVGIYQLGGHGLFISSANSQMGRGEPIKDSARVMARYCDGVMIRTFGQEIVDEFARYSD 118

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD  HPCQI+AD+ T  E +G  +G  F+W GDGNN+ ++ IE AA F + L 
Sbjct: 119 VPVINGLTDLFHPCQIMADLQTVIEQKGGYQGLKFAWVGDGNNMANTWIEAAAIFGFDLA 178

Query: 182 IATPIGSEPRNEYLNWARNQ-GASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREEH 239
           +A P G EP      WA+ Q  A++++  D  +AV+ A  + TD W SM  +  + + E 
Sbjct: 179 LACPQGYEPDRHVWEWAQKQGTATISITEDPEEAVRDADVINTDVWASMGQESEQKQREF 238

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            FQ + VN  L++ A PD++ +HCLPAHRGEE+   V++G  SVV+DEAENRLH QKAI+
Sbjct: 239 AFQGYCVNDELLAAARPDSIVLHCLPAHRGEEISESVIEGKHSVVWDEAENRLHIQKAIM 298

Query: 300 LWCF 303
               
Sbjct: 299 ATLM 302


>gi|259418804|ref|ZP_05742721.1| ornithine carbamoyltransferase [Silicibacter sp. TrichCH4B]
 gi|259345026|gb|EEW56880.1| ornithine carbamoyltransferase [Silicibacter sp. TrichCH4B]
          Length = 308

 Score =  230 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 160/308 (51%), Positives = 221/308 (71%), Gaps = 7/308 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFE-----NKPLSGKVLAMIFEKPSTRTR 59
             HF D+   S ++L  II+ A ++K++     +     ++PL+G+++A+IFEKPSTRTR
Sbjct: 1   MNHFLDIHKTSPADLRTIIDQAGQMKSARLGRPKGTPDDDQPLAGRMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V ++ +GG+T+ LSG +MQLG  ETI DTA+V+SRYVD I++RT + + L E+ EY
Sbjct: 61  VSFDVGVRQMGGETMVLSGKDMQLGHGETIADTARVMSRYVDLIMIRTFDETVLTEMAEY 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           A VPVIN LTD THPCQI+ADI+T+EEHRG +KGK   W+GDGNN+  S I  A +F + 
Sbjct: 121 ADVPVINGLTDRTHPCQIMADILTYEEHRGPIKGKKVVWTGDGNNVCASFIHAAGQFGFD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKARE 237
           L    P   +P +E++  AR  G+ + +  DA +AV+GA  V  DTW+SM+  Q  K R 
Sbjct: 181 LTFTGPSQLDPEDEFIGLARRAGSKITIERDAAKAVEGADLVVADTWVSMHDSQSSKERR 240

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
            ++ +P+QVN +LM+ A PDALFMHCLPAHR EEV + V+DGPQSV+FDEAENRLH QKA
Sbjct: 241 HNMLRPYQVNDALMAHAKPDALFMHCLPAHREEEVTSAVMDGPQSVIFDEAENRLHAQKA 300

Query: 298 ILLWCFGI 305
           ++ WC G+
Sbjct: 301 VMRWCLGV 308


>gi|239907290|ref|YP_002954031.1| ornithine carbamoyltransferase [Desulfovibrio magneticus RS-1]
 gi|239797156|dbj|BAH76145.1| ornithine carbamoyltransferase [Desulfovibrio magneticus RS-1]
          Length = 302

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 142/301 (47%), Positives = 199/301 (66%), Gaps = 4/301 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
            P+HF  + + S    + I++ A  +K +      +  L+GK   +IFEK STRTRVSFE
Sbjct: 1   MPRHFLTILDFSRDEAARILDRAAAMKAADHR---SDLLAGKTCILIFEKASTRTRVSFE 57

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VA++HLGG  IF++ ++ QLGR E I DTA+VLSRY D +++RT  H +L++L  Y ++P
Sbjct: 58  VAVRHLGGWPIFMTQNDSQLGRDEPIRDTARVLSRYADCLIVRTFGHDKLVDLAGYGSIP 117

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           V+NAL+D  HPCQI+AD++T  EH G + G   ++ GDGNNI HS+I  AARF   + IA
Sbjct: 118 VVNALSDAYHPCQIMADLLTMREHSGRLDGLKLAYVGDGNNIAHSIINAAARFPIRVAIA 177

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQ 242
           +P G +P    +  AR QGA V +  D  +A  GA  ++TD W SM QE +      +F 
Sbjct: 178 SPDGYKPDPAVVAKAREQGADVTITTDPAEAAAGADYLYTDVWASMGQEAEHAARVKIFA 237

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            +Q+N +L++ A P A  +HCLPAHRGEE+ + V++GP S+V+DEAENRLH QKAIL W 
Sbjct: 238 GYQINDALLAKAAPGAKVLHCLPAHRGEEITDAVMEGPSSIVWDEAENRLHVQKAILEWV 297

Query: 303 F 303
           F
Sbjct: 298 F 298


>gi|258541824|ref|YP_003187257.1| ornithine carbamoyltransferase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632902|dbj|BAH98877.1| ornithine carbamoyltransferase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256635959|dbj|BAI01928.1| ornithine carbamoyltransferase [Acetobacter pasteurianus IFO
           3283-03]
 gi|256639014|dbj|BAI04976.1| ornithine carbamoyltransferase [Acetobacter pasteurianus IFO
           3283-07]
 gi|256642068|dbj|BAI08023.1| ornithine carbamoyltransferase [Acetobacter pasteurianus IFO
           3283-22]
 gi|256645123|dbj|BAI11071.1| ornithine carbamoyltransferase [Acetobacter pasteurianus IFO
           3283-26]
 gi|256648178|dbj|BAI14119.1| ornithine carbamoyltransferase [Acetobacter pasteurianus IFO
           3283-32]
 gi|256651231|dbj|BAI17165.1| ornithine carbamoyltransferase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654222|dbj|BAI20149.1| ornithine carbamoyltransferase [Acetobacter pasteurianus IFO
           3283-12]
          Length = 328

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 166/309 (53%), Positives = 216/309 (69%), Gaps = 6/309 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIF----ENKPLSGKVLAMIFEKPSTR 57
           +  P+HF DL ++ ++ L  I++VA  +K   +N        +PL+G+ L +I  KPSTR
Sbjct: 10  LATPRHFLDLKDLDAATLRQILDVAASMKRMQQNRRFPLHPRQPLAGRQLGLILSKPSTR 69

Query: 58  TRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELT 117
           TRVSFEV ++ LGGD + LS  EMQ+GR E+I DTA+VLSR+VDAI++RT N   + EL 
Sbjct: 70  TRVSFEVGIRQLGGDAVVLSPQEMQIGRGESIADTARVLSRFVDAIMLRTGNTKTMHELA 129

Query: 118 EYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFN 177
           +++TVPVIN LT ++HP QI+ADIMTFEEHRG V+G+ F+W+GDGNN+L SLIEGA RF 
Sbjct: 130 QWSTVPVINGLTPHSHPVQILADIMTFEEHRGPVRGRTFAWTGDGNNVLVSLIEGAVRFG 189

Query: 178 YLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKA 235
           + L  ATP   +P  + L+WAR +G  V    D   A KGA CV TDTWISM+   +  A
Sbjct: 190 FALRAATPADMKPPQDVLDWARAEGGDVEWTVDPKAAAKGADCVVTDTWISMSDSPKEAA 249

Query: 236 REEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
                 +P++VN  LM++A PDALFMHCLPAH GEEV  +V +GP SVVFDEAENRLH Q
Sbjct: 250 TRMSKLEPYRVNADLMALAAPDALFMHCLPAHIGEEVTKDVFEGPHSVVFDEAENRLHAQ 309

Query: 296 KAILLWCFG 304
           K +L W  G
Sbjct: 310 KGVLAWTMG 318


>gi|23097915|ref|NP_691381.1| ornithine carbamoyltransferase [Oceanobacillus iheyensis HTE831]
 gi|32699447|sp|Q8ET05|OTC_OCEIH RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|22776139|dbj|BAC12416.1| ornithine carbamoyltransferase [Oceanobacillus iheyensis HTE831]
          Length = 322

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 136/305 (44%), Positives = 188/305 (61%), Gaps = 5/305 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             + F  L++ +   ++ +I++A  +K   ++    +PL GK L MIFEK STRTRVSFE
Sbjct: 16  KGRDFLTLADYTKDEINYLIDLADYLKKQHKDGVIFEPLKGKTLGMIFEKSSTRTRVSFE 75

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
             +  LGG  IFLS  ++Q+GR ETI DTAKVLS Y+D I++RT     + EL ++A++P
Sbjct: 76  TGIYQLGGLGIFLSSKDIQIGRGETIADTAKVLSGYLDGIMIRTFAQEDVEELAKHASIP 135

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQ++AD+ T +E +G + G    + GDGNN+ HSL+ GAA+    +   
Sbjct: 136 VINGLTDLYHPCQVLADLQTIKEVKGKLHGVKLVYIGDGNNMTHSLMLGAAKTGMHMVAV 195

Query: 184 TPIGSEPRNEYLNWARNQGASV----ALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREE 238
           TP G  P  E L  A++             D   AV+ A  ++TD W SM  +E + + E
Sbjct: 196 TPDGYTPNKEVLTKAKSIANQHGAIIEWTSDIATAVQEADVIYTDVWASMGQEEEQQQRE 255

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F+ +QVN SL+  A  D +FMHCLPAHRGEEV   V+DG QSVVF +AENRLH QKA+
Sbjct: 256 KDFENYQVNESLLEKAKTDVIFMHCLPAHRGEEVTAGVIDGKQSVVFQQAENRLHAQKAL 315

Query: 299 LLWCF 303
           +    
Sbjct: 316 MTALM 320


>gi|297618322|ref|YP_003703481.1| ornithine carbamoyltransferase [Syntrophothermus lipocalidus DSM
           12680]
 gi|297146159|gb|ADI02916.1| ornithine carbamoyltransferase [Syntrophothermus lipocalidus DSM
           12680]
          Length = 315

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 141/305 (46%), Positives = 194/305 (63%), Gaps = 5/305 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             + F  + + +S  +  I+E+A+K+K   +    +  L+GK L MIF+KPSTRTRVSFE
Sbjct: 10  KGRDFLAIRDYTSEEVMEILELAQKLKKMQKEGIPHPLLAGKTLGMIFQKPSTRTRVSFE 69

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V +  LGG  +FLS +++Q+GR ETI DTA  LSRY+D I++RT     + EL  +A++P
Sbjct: 70  VGIYQLGGYGLFLSPNDLQMGRGETIKDTALTLSRYLDGIMIRTFAQEEVEELAYWASIP 129

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQI+ DI+T  E +G++KG   ++ GDGNN+ HSL+ G A+    + +A
Sbjct: 130 VINGLTDLLHPCQIMGDILTILEKKGTLKGLKCAFIGDGNNVCHSLLVGGAKVGMNVVVA 189

Query: 184 TPIGSEPRNEYLNWARNQGASV----ALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-E 238
            P G  P++E +  A            +  D  +AV GA  ++TD W SM QE +A E E
Sbjct: 190 CPPGFAPKHEIMAQALKDAEETGAKLWVVEDPAEAVDGADVIYTDVWASMGQEKEAHEKE 249

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F  +QVN SL+  A PD + MHCLPA RG E+ +EV+DGP SVVFDEAENRLH QKAI
Sbjct: 250 KHFARYQVNASLLGKAKPDVIVMHCLPAKRGREITDEVMDGPNSVVFDEAENRLHAQKAI 309

Query: 299 LLWCF 303
           +    
Sbjct: 310 MALVM 314


>gi|58039689|ref|YP_191653.1| ornithine carbamoyltransferase [Gluconobacter oxydans 621H]
 gi|58002103|gb|AAW60997.1| Ornithine carbamoyltransferase [Gluconobacter oxydans 621H]
          Length = 342

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 158/306 (51%), Positives = 213/306 (69%), Gaps = 4/306 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKN----SSENIFENKPLSGKVLAMIFEKPSTRTR 59
            P+HF DL + S   +  II+++ K+K       + +  ++PL G+ L +I  +PSTRTR
Sbjct: 34  TPRHFLDLRDFSPEVIRQIIDLSAKVKALQNGRRQPLHPDRPLEGRSLGLILAQPSTRTR 93

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSFEV M  LGG    LS  +MQLGR ET+ DTA+VLSR++D IV+RT N + L EL ++
Sbjct: 94  VSFEVGMGQLGGSVSVLSPGDMQLGRGETVADTARVLSRFLDVIVLRTGNDANLRELAKW 153

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ++VPVIN LT  +HP QI+A ++TFEEHRG ++GK  +W GDGNN+  SL+EGAA   + 
Sbjct: 154 SSVPVINGLTPVSHPIQILAGVLTFEEHRGPIRGKTLAWIGDGNNVATSLMEGAALLGFN 213

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           + +ATP G  P  + + WAR  GA++ +F D  +AV GA  V TDTW+SM  + + +   
Sbjct: 214 VRLATPEGFAPNPDAVAWARAHGATIEIFRDPAEAVAGADAVLTDTWVSMGDKDREKRLK 273

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           VFQP+QV+ +LM+ A PDALF+HCLPAH GEEV +EV +GP SVVFDEAENRLHTQK +L
Sbjct: 274 VFQPYQVDGALMAKAAPDALFLHCLPAHIGEEVTSEVFEGPASVVFDEAENRLHTQKGLL 333

Query: 300 LWCFGI 305
           LW  G 
Sbjct: 334 LWALGK 339


>gi|206889848|ref|YP_002248512.1| ornithine carbamoyltransferase [Thermodesulfovibrio yellowstonii
           DSM 11347]
 gi|206741786|gb|ACI20843.1| ornithine carbamoyltransferase [Thermodesulfovibrio yellowstonii
           DSM 11347]
          Length = 299

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 143/300 (47%), Positives = 202/300 (67%), Gaps = 3/300 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             + +  + +        +I+ A ++K++ +  +   PL GK + MIFEKPSTRTRVSFE
Sbjct: 1   MKRDYLRVFDFDKQEFLFLIKRAIELKSNKD--YLKYPLIGKCVGMIFEKPSTRTRVSFE 58

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VA+  LGG  ++LS  E+QL R ET+ DTA+VLSRY++A+V+RT +HS + E  +++ VP
Sbjct: 59  VAIYQLGGHPVYLSQRELQLSRGETVKDTAQVLSRYLNAVVIRTFSHSIIEEFAKWSDVP 118

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINALTD+ HPCQ +AD+MT  E +G ++G   ++ GDGNN+ +SLIE +A     +NIA
Sbjct: 119 VINALTDSHHPCQAMADMMTIFEKKGYLEGIKIAYIGDGNNVANSLIEASALTGAKINIA 178

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQP 243
           TP G EP  E +  A+N      LF+D  +A   A  ++TD W+SM +E    ++  F+ 
Sbjct: 179 TPQGFEPLEESVEKAKNMTEI-NLFNDPYEAALDADVIYTDVWLSMGEEQHTEKKEKFKN 237

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           FQ+N  L+  A  DA+ MHCLPAHRGEE+ +EVLDGPQSVV D+AENRLHT+KAIL +  
Sbjct: 238 FQINSILLKKAKKDAIVMHCLPAHRGEEITDEVLDGPQSVVLDQAENRLHTEKAILEFLL 297


>gi|332971693|gb|EGK10641.1| ornithine carbamoyltransferase [Desmospora sp. 8437]
          Length = 325

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 139/304 (45%), Positives = 193/304 (63%), Gaps = 5/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +    L + +   +  +++ A  +K + +    ++PL+GK LAMIF+KPSTRTR+SFE  
Sbjct: 22  RDCLTLLDFTPREIQGLVDEALGMKQAWKEGKADRPLTGKTLAMIFDKPSTRTRISFETG 81

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  + L+  ++QLGR E++ DTA+VLS YVDA+++RT +H  + EL  +A++P+I
Sbjct: 82  MAQLGGHPLHLNRGDLQLGRGESLPDTARVLSGYVDAVLIRTFSHEAVEELARHASIPII 141

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ +AD++T +E RG + G   ++ GDGNN+LHSL+E AA     L  ATP
Sbjct: 142 NGLTDLHHPCQALADLLTLKESRGRLAGLTLAYIGDGNNMLHSLLEAAAATGIHLRAATP 201

Query: 186 IGSEPRNEYLNWARNQGASV----ALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HV 240
            G EP    +  AR              D  +A  GA  ++TD W SM QE +       
Sbjct: 202 QGYEPDPAIIRRARKAATRTGADLYFTSDPREAATGADAIYTDVWASMGQEEEKERRIRD 261

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F  FQV+ +LMS+A PDALFMHCLPA+RG EV  EV+DGP+S+VF +AENRLH QKA+L 
Sbjct: 262 FAGFQVDPALMSLAKPDALFMHCLPAYRGLEVSAEVIDGPRSIVFPQAENRLHAQKALLA 321

Query: 301 WCFG 304
              G
Sbjct: 322 ALIG 325


>gi|253575901|ref|ZP_04853235.1| ornithine carbamoyltransferase [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251844695|gb|EES72709.1| ornithine carbamoyltransferase [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 320

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 137/309 (44%), Positives = 198/309 (64%), Gaps = 5/309 (1%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M    + F +L++ S+  +  +I++A ++K   +N    +PL GK + +IFEK STRTRV
Sbjct: 12  MNLSGRDFIELTDYSTDEIHYLIDLAIELKRKQKNGEVYQPLLGKTVGLIFEKSSTRTRV 71

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFEV    LGG  +FLS +++QLGR ETI DTA V+SRY+D I++RT  H ++++L  YA
Sbjct: 72  SFEVGTYQLGGHALFLSKNDIQLGRGETIADTAGVMSRYLDGIMIRTFGHDKVVDLARYA 131

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVIN L+D  HPCQ++AD  T  EH+G ++G   ++ GDGNN+ HSL+ G A+    +
Sbjct: 132 TVPVINGLSDLAHPCQVLADYQTLYEHKGKLQGLKLAYVGDGNNMAHSLMIGGAKLGVHV 191

Query: 181 NIATPIGSEPRNEYLNWARNQGA----SVALFHDAVQAVKGAHCVFTDTWISMNQEFK-A 235
           ++A+P G EP  + +  A+         + +  D   AV+ A  ++TD W SM  E +  
Sbjct: 192 SVASPEGYEPDPQIVADAQEIAKATGAVIEVVRDPKAAVQEADAIYTDVWASMGFEEEQK 251

Query: 236 REEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
             E  F+ +QV+  L   A PD +FMHCLPAHRGEEV   V+DGP S++FD+AENRLH Q
Sbjct: 252 IREEAFRNYQVDEQLARYAKPDYVFMHCLPAHRGEEVSEGVIDGPHSIIFDQAENRLHAQ 311

Query: 296 KAILLWCFG 304
           KA++    G
Sbjct: 312 KALMAALIG 320


>gi|138894348|ref|YP_001124801.1| ornithine carbamoyltransferase [Geobacillus thermodenitrificans
           NG80-2]
 gi|196248042|ref|ZP_03146744.1| ornithine carbamoyltransferase [Geobacillus sp. G11MC16]
 gi|134265861|gb|ABO66056.1| Ornithine carbamoyltransferase [Geobacillus thermodenitrificans
           NG80-2]
 gi|196212826|gb|EDY07583.1| ornithine carbamoyltransferase [Geobacillus sp. G11MC16]
          Length = 312

 Score =  230 bits (585), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 145/308 (47%), Positives = 204/308 (66%), Gaps = 5/308 (1%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M    + F  L + S+  +  ++ +A  +K   +      PL+GK +AMIFEKPSTRTRV
Sbjct: 5   MSLKGRDFLTLLDFSTEEIFDLLALAGDLKAKQKAGMPYTPLAGKTMAMIFEKPSTRTRV 64

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFEV M  LGG  ++L+ +++QLGR ETI DTA+VLS+YVD I++RT  H ++ EL EYA
Sbjct: 65  SFEVGMIQLGGSALYLNSNDLQLGRGETIADTARVLSQYVDVIMIRTFAHQKVEELAEYA 124

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           ++PVIN LTD+ HPCQ +AD++T  E + + +G   ++ GDGNN+ ++L+  AA+    +
Sbjct: 125 SIPVINGLTDDDHPCQALADLLTIYEVKKTFQGIKLAYVGDGNNVANALLAAAAKVGMDV 184

Query: 181 NIATPIGSEPRNEYLNWARNQGASV----ALFHDAVQAVKGAHCVFTDTWISMNQEFKAR 236
            IA P G EP+  Y+  AR  G        + HD ++AV GA  ++TD W SM QE ++ 
Sbjct: 185 AIACPPGYEPKAAYVEAARQIGEKTGAAVTVTHDPLEAVAGADAIYTDVWTSMGQESESD 244

Query: 237 EE-HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
           E   VFQP+QVN +L+  A PD +F+HCLPAHRGEEV   V+DGP S+VF++A NRLH Q
Sbjct: 245 ERLQVFQPYQVNEALVKAAKPDYIFLHCLPAHRGEEVTAGVMDGPNSMVFEQAGNRLHAQ 304

Query: 296 KAILLWCF 303
           KAIL+   
Sbjct: 305 KAILVSVL 312


>gi|312127410|ref|YP_003992284.1| ornithine carbamoyltransferase [Caldicellulosiruptor hydrothermalis
           108]
 gi|311777429|gb|ADQ06915.1| ornithine carbamoyltransferase [Caldicellulosiruptor hydrothermalis
           108]
          Length = 308

 Score =  230 bits (585), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 137/308 (44%), Positives = 202/308 (65%), Gaps = 6/308 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            +HF  L+++S  ++  ++E+A ++K  ++  F    L  K L +IF K STRTRVSFEV
Sbjct: 1   MRHFLHLNDLSKEDIMYLVELASRLKKEAKKGFYFPYLKNKALGLIFTKASTRTRVSFEV 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG +++L  +++QLGR ETI DTAKVLSRY+D IV+RT     + E  +Y+++PV
Sbjct: 61  GIHQLGGYSLYLGKNDLQLGRGETIEDTAKVLSRYLDLIVIRTYEQKEVEEFAKYSSIPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD+ HP QIIAD  T  E +G +     ++ GDGNN+  +L+ GAA+    + +AT
Sbjct: 121 INGLTDDYHPTQIIADFQTIFEEKGRLSNLKIAYVGDGNNVAATLLVGAAKLGLDIAVAT 180

Query: 185 PIGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEH 239
           P   E + E +++    A+   +++   +   +AVK A  V+TDTW+SM QE +  +   
Sbjct: 181 PPDYEIKKEVVDFSLDEAKKSKSNIIFTNSPKEAVKDADVVYTDTWVSMGQEEEKEKRIR 240

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ +QV+ SLM +A  DA+F+HCLPA+RG EV +EV+DG QS VFDEAENRLH  KAI+
Sbjct: 241 DFEGYQVDSSLMKLAKDDAIFLHCLPAYRGFEVTSEVIDGSQSRVFDEAENRLHAHKAIM 300

Query: 300 LW-CFGII 306
           ++ C G I
Sbjct: 301 IFVCLGKI 308


>gi|225016572|ref|ZP_03705764.1| hypothetical protein CLOSTMETH_00479 [Clostridium methylpentosum
           DSM 5476]
 gi|224950681|gb|EEG31890.1| hypothetical protein CLOSTMETH_00479 [Clostridium methylpentosum
           DSM 5476]
          Length = 301

 Score =  229 bits (584), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 123/301 (40%), Positives = 177/301 (58%), Gaps = 1/301 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH   L ++S   ++ ++++A K+K  +++  E+  L GK L MIF+K STRTRVSFE 
Sbjct: 1   MKHLLKLLDLSKEEITELLDLADKLKFENKHGIEHHLLKGKTLGMIFQKSSTRTRVSFET 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG  +FLS +++Q+GR E + DTA+VLSRY+D I++RT     + +L EY ++P+
Sbjct: 61  GMVQLGGYPLFLSSNDLQIGRGEPVQDTARVLSRYLDGIMIRTFAQQEVEDLAEYGSIPI 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD  HPCQ++AD+ T  EH+GS  G    + GDGNN+ +SLI G  +    + +A 
Sbjct: 121 INGLTDFCHPCQVLADLQTIREHKGSFDGLKMCYIGDGNNMANSLIVGGLKVGMQVAVAC 180

Query: 185 PIGSEPRNEYLNWARNQGASV-ALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQP 243
           P G EP  + L +A+ QG                         +    E + R       
Sbjct: 181 PKGYEPDEQVLAFAKEQGGFTLTEDPKQAAQDADVLFTDVWASMGQEGEAEKRRAVFEGI 240

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +Q+N  L++ AHPDA+  HCLPAHRGEE+  EV +     +FDEAENRLH QKA+L+   
Sbjct: 241 YQINDELLAAAHPDAMVQHCLPAHRGEEITAEVFEAHAQEIFDEAENRLHAQKAVLVKLL 300

Query: 304 G 304
           G
Sbjct: 301 G 301


>gi|219849220|ref|YP_002463653.1| ornithine carbamoyltransferase [Chloroflexus aggregans DSM 9485]
 gi|219543479|gb|ACL25217.1| ornithine carbamoyltransferase [Chloroflexus aggregans DSM 9485]
          Length = 309

 Score =  229 bits (584), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 135/310 (43%), Positives = 192/310 (61%), Gaps = 7/310 (2%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFEN-KPLSGKVLAMIFEKPSTRTRV 60
           MT  +HF   +++S +    +++ A ++K +      N +PL G+ LA++FEKPS RTRV
Sbjct: 1   MTL-RHFLSAADLSRAEAEALLDRAAELKAAWRAGVTNDRPLLGQTLALVFEKPSLRTRV 59

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           +FE  M  LGG   +LS +++ +G  E++ D A+ LSR+V  I  R   H+ +  L  YA
Sbjct: 60  AFEAGMTQLGGHPSYLSANDIDMGGRESVPDVARNLSRWVAIIAARVFKHATVETLARYA 119

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVINAL+D  HPCQ +AD++T  E  G ++G   ++ GDGNN+ HSL+   A     +
Sbjct: 120 TVPVINALSDREHPCQALADMLTLRERFGRLQGLTLAYVGDGNNVCHSLMLLGATLGVNV 179

Query: 181 NIATPIGSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA- 235
            +  P+   P  +        A    A++ +    V+AV GA  V+TD W SM QE +A 
Sbjct: 180 RVGCPVDYRPAPDITELTEQLANQHDATLTITTSPVEAVSGADAVYTDVWASMGQEHEAA 239

Query: 236 REEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
           R   VF P+QVN +LM+ A P AL MHCLPAHRGEEV  +V+DGPQSVVF++AENRLH Q
Sbjct: 240 RRRPVFTPYQVNAALMAHAAPHALAMHCLPAHRGEEVTADVIDGPQSVVFEQAENRLHVQ 299

Query: 296 KAILLWCFGI 305
           KA++L+  G 
Sbjct: 300 KALILFLLGK 309


>gi|116754282|ref|YP_843400.1| ornithine carbamoyltransferase [Methanosaeta thermophila PT]
 gi|116665733|gb|ABK14760.1| ornithine carbamoyltransferase [Methanosaeta thermophila PT]
          Length = 312

 Score =  229 bits (584), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 141/309 (45%), Positives = 199/309 (64%), Gaps = 7/309 (2%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIF-----ENKPLSGKVLAMIFEKPST 56
           M+  +    ++++S   +  +++ A+ +K            +  PL+GK +AMIFEKPST
Sbjct: 1   MS-NRSLISIADLSPEEIVALLDRAEDLKAERSGRGGCAFGDRLPLAGKSVAMIFEKPST 59

Query: 57  RTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLEL 116
           RTRVS EVA   LGG  ++LS +E+QLGR ETIGDTA+VLSRYV  I  R  +H  + EL
Sbjct: 60  RTRVSLEVAATELGGHPLYLSANELQLGRGETIGDTARVLSRYVHGITARVFSHRTVEEL 119

Query: 117 TEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARF 176
             +++VPVINAL+D  HP QI+AD+MT  EH G ++G   +W GDGNN+ +SLI  +A  
Sbjct: 120 AAHSSVPVINALSDQEHPLQILADMMTIREHFGYLEGLRIAWIGDGNNVCNSLILASAML 179

Query: 177 NYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKA 235
           N  + +A+P G EP+ + L  AR  G    +  +  +A   A  + TDTWISM ++  +A
Sbjct: 180 NMRMIVASPRGYEPKGQILERARELGGVPEITAEPSEAAHDADVLVTDTWISMGDEAEEA 239

Query: 236 REEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
                F  +Q+N  ++ +A  DA+ MHCLPAHRG+E+ +EV+DGPQSVV +EAENRLHT 
Sbjct: 240 ERLRSFSGYQINQRILEIAGRDAIVMHCLPAHRGQEITDEVMDGPQSVVLEEAENRLHTS 299

Query: 296 KAILLWCFG 304
           KA+L W  G
Sbjct: 300 KAVLEWMVG 308


>gi|149204776|ref|ZP_01881739.1| ornithine carbamoyltransferase [Roseovarius sp. TM1035]
 gi|149141745|gb|EDM29798.1| ornithine carbamoyltransferase [Roseovarius sp. TM1035]
          Length = 308

 Score =  229 bits (584), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 159/308 (51%), Positives = 225/308 (73%), Gaps = 7/308 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENI-----FENKPLSGKVLAMIFEKPSTRTR 59
             HF D+   + ++L  +I+ A+++K + +        +++PL+G+++A+IFEKPSTRTR
Sbjct: 1   MTHFLDIHKTTETDLRAMIDQARRMKEARQGRPRGTPDDDQPLAGRMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF++ ++ +GG ++ LSG++MQLG  ETI DTA+V+SRYVD I++RT + S LLE+ E+
Sbjct: 61  VSFDMGVRQMGGQSMVLSGADMQLGHGETIADTARVMSRYVDLIMIRTFDESVLLEMAEH 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           A VPVIN LTD THPCQI+ADI+T+EEHRG +KGK   WSGDGNN+  S++  A +F + 
Sbjct: 121 ADVPVINGLTDRTHPCQIMADILTYEEHRGPIKGKKVVWSGDGNNVCASMLHAAGQFGFD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKARE 237
           L    P+  +P  E++  AR  G+++ +  D  +AV GA  V TDTW+SM+  Q  K R 
Sbjct: 181 LTFTGPMQLDPEPEFIGLARKAGSTITIERDPFKAVDGADLVVTDTWVSMHDSQSTKERR 240

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
            ++ +P+QVN  LM+ A PDALFMHCLPAHRGEEV +EV+DGPQSV+FDEAENRLH QKA
Sbjct: 241 HNMLRPYQVNDKLMAAAKPDALFMHCLPAHRGEEVTSEVMDGPQSVIFDEAENRLHAQKA 300

Query: 298 ILLWCFGI 305
           ++ WC G+
Sbjct: 301 VMRWCLGV 308


>gi|331006661|ref|ZP_08329942.1| Ornithine carbamoyltransferase [gamma proteobacterium IMCC1989]
 gi|330419529|gb|EGG93914.1| Ornithine carbamoyltransferase [gamma proteobacterium IMCC1989]
          Length = 311

 Score =  229 bits (584), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 147/302 (48%), Positives = 200/302 (66%), Gaps = 4/302 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L+++S+  L+ II+ A ++K     +  +K L GKVL MIFEK STRTRVSFE  
Sbjct: 12  RHFLTLNDLSADELNIIIQRAIELKKIRSEVRLHKTLEGKVLGMIFEKSSTRTRVSFEAG 71

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  +FLS ++ QLGR E I D+A+V+S  VD +++RT  H  +    EY+ VP+I
Sbjct: 72  IAQLGGSGLFLSSNDTQLGRGEPIEDSARVISSMVDIVMIRTYAHQSIQTFAEYSKVPII 131

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NAL+D+ HPCQ++ADI T+ EHRG+ +GK   W GDGNN+ HS I  A   ++ L+IA P
Sbjct: 132 NALSDDYHPCQLLADIQTYTEHRGNPQGKTVVWVGDGNNMCHSYINAARLCDFTLHIACP 191

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQPF 244
            G EP  E +         + LFH+  +AVKGA  V TDTW SM QE + +  E  F  F
Sbjct: 192 KGYEPNAELM---AANADRIRLFHNTEEAVKGADWVVTDTWASMGQEEEKKIREDAFAAF 248

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QVN  LM +A+ DA+FMHCLPA+RG E+ + ++D P SVV+DEAENRLH QKA++ +  G
Sbjct: 249 QVNEELMQLANKDAIFMHCLPAYRGLEISDTIMDSPCSVVWDEAENRLHAQKALMEFLLG 308

Query: 305 II 306
            I
Sbjct: 309 AI 310


>gi|307941511|ref|ZP_07656866.1| ornithine carbamoyltransferase [Roseibium sp. TrichSKD4]
 gi|307775119|gb|EFO34325.1| ornithine carbamoyltransferase [Roseibium sp. TrichSKD4]
          Length = 309

 Score =  229 bits (584), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 164/299 (54%), Positives = 213/299 (71%), Gaps = 1/299 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-PLSGKVLAMIFEKPSTRTRVSFEV 64
           +HF DL+      +  I+E+ K+IK +   +   + PL+GKVLAM+FE+PSTRTR+SF+V
Sbjct: 8   RHFLDLTEFGGEEIRAILELGKEIKKTRNGVHRGQGPLAGKVLAMVFEQPSTRTRISFDV 67

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M+ LGG+T+ L+G+EMQLGR ETI DTA+VLSR+VDAI++R  +H  L EL E ATVPV
Sbjct: 68  GMRELGGETLMLTGAEMQLGRGETIADTARVLSRFVDAIMIRILDHDDLNELAEAATVPV 127

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LT  +HPCQI+ADIMT+EEHRGS+KGK  +W+GD NN+L S +  A R ++ + IAT
Sbjct: 128 INGLTKLSHPCQIMADIMTYEEHRGSIKGKSVAWTGDSNNVLASWVHAAPRLDFEMRIAT 187

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P    P  E L  AR  G  + +  D  +A KGA C+ TD W+SM  + + +  ++   +
Sbjct: 188 PKELAPPTELLEQARAAGGEIIVTDDPFEAAKGADCIVTDCWVSMGDDDEEQRHNLLGAY 247

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           QVN  LM  A  D+LFMHCLPAHRGEEV +EV+DGP SVVFDEAENRLH QK IL WCF
Sbjct: 248 QVNNRLMKEAKADSLFMHCLPAHRGEEVTSEVMDGPHSVVFDEAENRLHAQKGILAWCF 306


>gi|303257092|ref|ZP_07343106.1| ornithine carbamoyltransferase [Burkholderiales bacterium 1_1_47]
 gi|302860583|gb|EFL83660.1| ornithine carbamoyltransferase [Burkholderiales bacterium 1_1_47]
          Length = 305

 Score =  229 bits (584), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 128/300 (42%), Positives = 184/300 (61%), Gaps = 2/300 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K+F  L + S+  L+ ++  A K+K+  +     +P  GKVLAM+FEK STRTRVSFE
Sbjct: 1   MHKNFLCLKDCSADELNYLLRRAIKLKSRFKAGEVYRPFEGKVLAMLFEKASTRTRVSFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
             M  LGG +I+L+ SE QL   ETI DTA+ +SR VD +++RT  HSRL    + + VP
Sbjct: 61  AGMAQLGGTSIYLNTSETQLKNEETIEDTARAVSRMVDLVMIRTGPHSRLEAFAKESEVP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LT+++HPCQ++ DIM+F E RGS+KG + +W GD NN+L+S +  A+   + ++I+
Sbjct: 121 VINGLTNDSHPCQVMGDIMSFIEKRGSIKGAVVTWIGDANNVLYSWLYSASILGFKVHIS 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQP 243
            P G       +    +         +A +           +      E +A+ +     
Sbjct: 181 APPGYSINPTQVPDNDDCYDFFLSPEEAAEGADLVTTDNWRSC--GYDENQAKRQSKSAR 238

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +QVN ++M  A PDALFMHCLPA RG+EV +EV+DGPQSVV+DEAENRLH QKA++ +  
Sbjct: 239 WQVNETVMKAAKPDALFMHCLPAFRGQEVSSEVIDGPQSVVWDEAENRLHFQKALMEYLL 298


>gi|152997392|ref|YP_001342227.1| ornithine carbamoyltransferase [Marinomonas sp. MWYL1]
 gi|150838316|gb|ABR72292.1| ornithine carbamoyltransferase [Marinomonas sp. MWYL1]
          Length = 301

 Score =  229 bits (584), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 143/303 (47%), Positives = 197/303 (65%), Gaps = 5/303 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M+ P+HF  L ++SS  L  ++  A ++K         +PL  +VLAMIFEK STRTRVS
Sbjct: 1   MS-PRHFLTLKDLSSDELKQLLLRASELKKIHHEGTLFQPLKNRVLAMIFEKSSTRTRVS 59

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M   GG  +FLS  + QLGR E + D+A+V+S  VDA+++RT +H  +    +Y++
Sbjct: 60  FEAGMAQFGGHALFLSSRDTQLGRGEPVEDSARVISSMVDAVMIRTFDHKTVETFAKYSS 119

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVINALTD+ HPCQ++AD+ T++EHRGS++GK   W GDGNN+ +S I  AA  ++ L 
Sbjct: 120 VPVINALTDDYHPCQLLADMQTYQEHRGSIEGKKVVWVGDGNNMCNSYINAAAMLDFQLV 179

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHV 240
           +A P+G EP  + +         V + H+A +A  GA  + TD + SM QE +  +    
Sbjct: 180 VACPVGYEPNADLVAE---HADRVTVLHNAHEAATGADLIVTDVFASMGQEDEQEQRLKD 236

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F  FQVN  LM+ A+ DALFMHCLPAHRGEEV  +V+D P  VV+DEAENRLH QKA+L 
Sbjct: 237 FDGFQVNAELMAKANNDALFMHCLPAHRGEEVSADVIDHPDCVVWDEAENRLHAQKALLE 296

Query: 301 WCF 303
           +  
Sbjct: 297 FLL 299


>gi|217977016|ref|YP_002361163.1| ornithine carbamoyltransferase [Methylocella silvestris BL2]
 gi|217502392|gb|ACK49801.1| ornithine carbamoyltransferase [Methylocella silvestris BL2]
          Length = 317

 Score =  229 bits (584), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 161/300 (53%), Positives = 218/300 (72%), Gaps = 2/300 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFEN--KPLSGKVLAMIFEKPSTRTRVSFE 63
           +HFADLS+I++ +L  II+ +  +K        +  +PL GKVLAMIF+KPSTRTRVSF+
Sbjct: 13  RHFADLSDIAAGDLRRIIDSSLAMKAKRRKGRRSVDRPLEGKVLAMIFDKPSTRTRVSFD 72

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           +AM+ LGG+T+ L+G EMQLGR ETI DTA+VLSR+VDAI++R   H  ++EL  +A VP
Sbjct: 73  LAMRELGGETVMLTGKEMQLGRGETIADTARVLSRFVDAIMIRILEHRDMIELARHADVP 132

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LT  +HPCQ++AD+MTFEEHRG +KG+  +WSGD NN+L S +  A RF++ L++A
Sbjct: 133 VINGLTKKSHPCQVMADVMTFEEHRGPIKGRKIAWSGDANNVLASWVHAAQRFDFSLSVA 192

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQP 243
            P       + L+WAR  GA + +  D  +AV+GA  V +D W+SM  + + + + +  P
Sbjct: 193 APAEFGLPPQLLDWARRSGAKLEVTRDPFEAVRGADAVVSDCWVSMGDKDEQQRQGLLSP 252

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +QVN  LM+ A  +A+FMHCLPAHRGEEV +E++DGPQSVVFDEAENRLH QK IL WC 
Sbjct: 253 YQVNAKLMAAAGSEAIFMHCLPAHRGEEVTDEIIDGPQSVVFDEAENRLHAQKGILAWCL 312


>gi|300113409|ref|YP_003759984.1| ornithine carbamoyltransferase [Nitrosococcus watsonii C-113]
 gi|299539346|gb|ADJ27663.1| ornithine carbamoyltransferase [Nitrosococcus watsonii C-113]
          Length = 304

 Score =  229 bits (583), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 140/302 (46%), Positives = 187/302 (61%), Gaps = 3/302 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M  P HF  L ++ +  +  ++  A ++K         +PL  +VL M+FEK STRTRVS
Sbjct: 1   MAVP-HFLTLFDLPADEIKQLVRRAIELKALQRQGKIYEPLKNQVLGMLFEKSSTRTRVS 59

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FEV M  LGG+ +FLS  + QLGR E + DTA+VLSR V+ +++RT +HS L     Y+ 
Sbjct: 60  FEVGMIQLGGNAVFLSPRDTQLGRGEPLEDTARVLSRMVNCLMVRTFSHSMLEHFAAYSQ 119

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVINALTD+ HPCQ++ADI T+ EHRG ++G+  +W GDGNN+  S I  A +F++ L+
Sbjct: 120 VPVINALTDSYHPCQLLADIQTYFEHRGDIQGRTVAWIGDGNNMCQSYINAACQFDFQLH 179

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           IATP G  P    L  AR +   +A   +AV+           +     ++ K R     
Sbjct: 180 IATPTGYGPDPAILQIARERVQIMAEPQEAVRGADLIVTDVWTSM--GQEQEKHRRLQDL 237

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
             +QVN  LMS+A  DALFMHCLPAHRGEEV  EV+D  QSVV+DEAENRLH QKA+L  
Sbjct: 238 ADYQVNSELMSLAKRDALFMHCLPAHRGEEVSAEVMDSSQSVVWDEAENRLHAQKALLEK 297

Query: 302 CF 303
             
Sbjct: 298 LL 299


>gi|331000955|ref|ZP_08324592.1| ornithine carbamoyltransferase [Parasutterella excrementihominis
           YIT 11859]
 gi|329569914|gb|EGG51671.1| ornithine carbamoyltransferase [Parasutterella excrementihominis
           YIT 11859]
          Length = 305

 Score =  229 bits (583), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 128/300 (42%), Positives = 184/300 (61%), Gaps = 2/300 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K+F  L + S+  L+ ++  A K+K+  +     +P  GKVLAM+FEK STRTRVSFE
Sbjct: 1   MHKNFLCLKDCSADELNYLLRRAIKLKSRFKAGEVYRPFEGKVLAMLFEKASTRTRVSFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
             M  LGG +I+L+ SE QL   ETI DTA+ +SR VD +++RT  HSRL    + + VP
Sbjct: 61  AGMAQLGGTSIYLNTSETQLKNEETIEDTARAVSRMVDLVMIRTGPHSRLEAFAKESEVP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LT+++HPCQ++ DIM+F E RGS+KG + +W GD NN+L+S +  A+   + ++I+
Sbjct: 121 VINGLTNDSHPCQVMGDIMSFIEKRGSIKGAVVTWIGDANNVLYSWLYAASILGFKVHIS 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQP 243
            P G       +    +         +A +           +      E +A+ +     
Sbjct: 181 APPGYSINPTQVPDNDDCYDFFLSPEEAAEGADLVTTDNWRSC--GYDENQAKRQSKSAR 238

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +QVN ++M  A PDALFMHCLPA RG+EV +EV+DGPQSVV+DEAENRLH QKA++ +  
Sbjct: 239 WQVNETVMKAAKPDALFMHCLPAFRGQEVSSEVIDGPQSVVWDEAENRLHFQKALMEYLL 298


>gi|302871663|ref|YP_003840299.1| ornithine carbamoyltransferase [Caldicellulosiruptor obsidiansis
           OB47]
 gi|302574522|gb|ADL42313.1| ornithine carbamoyltransferase [Caldicellulosiruptor obsidiansis
           OB47]
          Length = 308

 Score =  229 bits (583), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 138/308 (44%), Positives = 203/308 (65%), Gaps = 6/308 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            +HF  L+++S  ++  ++E+A ++K  ++  F    L  K L +IF K STRTRVSFEV
Sbjct: 1   MRHFLHLNDLSKEDILYLVELASRLKKEAKKGFYFPYLKNKALGLIFTKASTRTRVSFEV 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG +++L  +++QLGR ETI DTAKVLSRY+D IV+RT     + E  +Y+++PV
Sbjct: 61  GIHQLGGYSLYLGKNDLQLGRGETIEDTAKVLSRYLDLIVIRTYEQKEVEEFAKYSSIPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD+ HP QIIAD  T  E +G +     ++ GDGNN+  +L+ GAA+    + IAT
Sbjct: 121 INGLTDDYHPTQIIADFQTIFEEKGRLSNLKIAYVGDGNNVAATLLVGAAKLGLDIAIAT 180

Query: 185 PIGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEH 239
           P G E + E +++    A+   ++V    +  +AVK A  V+TDTW+SM QE +  +   
Sbjct: 181 PPGYEIKKEVVDFALDEAKKNKSNVIFTENPKEAVKDADVVYTDTWVSMGQEEEKEKRIR 240

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ +QV+ SL+ +A  DA+F+HCLPA+RG EV ++V+DGPQS VFDEAENRLH  KAI+
Sbjct: 241 DFEGYQVDSSLLRLAKDDAIFLHCLPAYRGFEVTSDVIDGPQSRVFDEAENRLHAHKAIM 300

Query: 300 LWC-FGII 306
           ++   G I
Sbjct: 301 IFVSLGKI 308


>gi|146297227|ref|YP_001180998.1| ornithine carbamoyltransferase [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|189036317|sp|A4XLM2|OTC_CALS8 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|145410803|gb|ABP67807.1| ornithine carbamoyltransferase [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 308

 Score =  229 bits (583), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 138/308 (44%), Positives = 201/308 (65%), Gaps = 6/308 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            +HF  L+ ++   +  ++++A ++K+  +  F    L  K L +IF K STRTRVSFEV
Sbjct: 1   MRHFLSLNELTKDEILYLVDLACRLKSEVKRGFFFPYLKHKALGLIFTKASTRTRVSFEV 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG +++LS +++QLGR ETI DTAKVLSRY+D IV+RT   S + E  +Y+++PV
Sbjct: 61  GINQLGGYSLYLSKNDLQLGRGETIEDTAKVLSRYLDLIVIRTYAQSEVEEFAKYSSIPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD+ HP QIIAD  T  E +G +K    ++ GDGNN+  +L+ GA++    + +AT
Sbjct: 121 INGLTDDYHPTQIIADFQTIFEEKGRLKDLKIAYIGDGNNVAATLLVGASKLGLDIAVAT 180

Query: 185 PIGSEPRNEYLNWARNQGASV----ALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEH 239
           P G E + E +++A+++            +  +AVK A  V+TDTW+SM QE +  +   
Sbjct: 181 PKGYEIKKEVVDFAKDEAKRSGSNLIFTDNPKEAVKDADVVYTDTWVSMGQEEEKEKRIK 240

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ +QV   LM +A  DA+F+HCLPA+RG EV  EV+DGPQS VFDEAENRLH  KAI+
Sbjct: 241 DFEGYQVTQELMKLAKEDAIFLHCLPAYRGFEVTPEVIDGPQSKVFDEAENRLHAHKAIM 300

Query: 300 LW-CFGII 306
           ++ C G I
Sbjct: 301 VFVCLGRI 308


>gi|242279256|ref|YP_002991385.1| ornithine carbamoyltransferase [Desulfovibrio salexigens DSM 2638]
 gi|242122150|gb|ACS79846.1| ornithine carbamoyltransferase [Desulfovibrio salexigens DSM 2638]
          Length = 325

 Score =  229 bits (583), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 147/299 (49%), Positives = 201/299 (67%), Gaps = 4/299 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             +H   ++++  S L  ++  AK++K++      N  L GK + MIFEK STRTRVSF+
Sbjct: 1   MIRHLLKINDVPRSELGQLLLRAKELKDNK---IRNNALEGKTVIMIFEKASTRTRVSFD 57

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VA++ LGG +IF++ +E QLGR+E + DTA+VLSRY DA+V+RT    ++  L EY +VP
Sbjct: 58  VAIEQLGGHSIFMTPAESQLGRSEPLEDTAQVLSRYADALVVRTFGQDKVRTLAEYGSVP 117

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINALTD  HPCQ+++D++T  E    ++    +W GDGNN+ HS I  A  F + L +A
Sbjct: 118 VINALTDRYHPCQVLSDMLTIYERTPDLENVHVAWVGDGNNMAHSWINAAIYFPFYLTLA 177

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQ 242
            P G EP ++ L+ A + GA + L +D V+AVKGAH V TD + SM QE +  + E  F 
Sbjct: 178 FPKGYEPDHDILSRALSMGAKINLSYDPVEAVKGAHYVNTDVFASMGQEEEQKKRELAFA 237

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
            +QVN  L+  A PD   MHCLPAHRGEEV  EVLDGP+S++FD+AENRLH QKAIL W
Sbjct: 238 AYQVNDELLKHADPDCKVMHCLPAHRGEEVTAEVLDGPRSIIFDQAENRLHMQKAILEW 296


>gi|198282709|ref|YP_002219030.1| ornithine carbamoyltransferase [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218667835|ref|YP_002424901.1| ornithine carbamoyltransferase [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|198247230|gb|ACH82823.1| ornithine carbamoyltransferase [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218520048|gb|ACK80634.1| ornithine carbamoyltransferase [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 311

 Score =  229 bits (583), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 151/302 (50%), Positives = 203/302 (67%), Gaps = 5/302 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  LS++S S L  +++ A  +K    +     P +G+ LAMIFEK STRTRVSFE  
Sbjct: 4   RHFLRLSDLSPSELRALLQRAIALKKIQRDGERYAPCAGRTLAMIFEKSSTRTRVSFETG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLS  + QLGR E++ DTAKV+SR VD +++RT  H  LL     + VPVI
Sbjct: 64  MAQLGGHALFLSPRDTQLGRGESVEDTAKVISRMVDMVMIRTFGHDNLLRFAAASRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGD-GNNILHSLIEGAARFNYLLNIAT 184
           N L+D+ HPCQ++AD+MT  EH G ++G+  ++ GD  NN+ HS +E A  F++ L I +
Sbjct: 124 NGLSDDHHPCQLLADLMTATEHWGDLRGRTVAYIGDGSNNMAHSWMEAAQVFDFRLRIGS 183

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQP 243
           P G  P    L   ++ G  V + HDAV AV+GA+ + TD W SM QE + A  + +  P
Sbjct: 184 PAGYVPSAGML---QSGGDQVTVLHDAVAAVRGANLIVTDVWTSMGQEEEAAARKAILAP 240

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           FQVN +LM+ A PDALFMHCLPAHRGEEV  EV+DGP+SVV++EAENRLH QKA++ + F
Sbjct: 241 FQVNATLMAAAAPDALFMHCLPAHRGEEVSAEVIDGPRSVVWEEAENRLHAQKALMEFLF 300

Query: 304 GI 305
           GI
Sbjct: 301 GI 302


>gi|254504688|ref|ZP_05116839.1| ornithine carbamoyltransferase [Labrenzia alexandrii DFL-11]
 gi|222440759|gb|EEE47438.1| ornithine carbamoyltransferase [Labrenzia alexandrii DFL-11]
          Length = 309

 Score =  229 bits (583), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 167/300 (55%), Positives = 214/300 (71%), Gaps = 1/300 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-PLSGKVLAMIFEKPSTRTRVSFEV 64
           K+F DL+     +L  I+E  KKIK + + +   + PL+GKVLAMIFE+PSTRTR+SF+V
Sbjct: 8   KNFLDLTQFEGDDLRAILETGKKIKATRDGVRRGEGPLAGKVLAMIFEQPSTRTRISFDV 67

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M+ LGG+T+ L+G+EMQLGR ETI DTAKVLSR+VD +++R  +H  L EL E AT+PV
Sbjct: 68  GMRELGGETLMLTGAEMQLGRGETIADTAKVLSRFVDGVMIRILDHEALNELAENATIPV 127

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LT  +HPCQI+ADIMTFEEHRG + G+  +W+GD NN+L S +  A R ++ L IAT
Sbjct: 128 INGLTKISHPCQIMADIMTFEEHRGGISGRSIAWTGDSNNVLASWVHAAPRLDFELRIAT 187

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P    P  + +  AR +G S+ +  D  +AVKG  CV TD W+SM  +      ++   +
Sbjct: 188 PAELAPPQDLIETARAKGGSILVTDDPYEAVKGTDCVVTDCWVSMGDDDAESRHNLLSAY 247

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QVN  LM+ A+ DALFMHCLPAHRGEEV NEV+DGP SVVFDEAENRLH QK IL WCFG
Sbjct: 248 QVNERLMAEANGDALFMHCLPAHRGEEVTNEVMDGPNSVVFDEAENRLHAQKGILAWCFG 307


>gi|110833579|ref|YP_692438.1| ornithine carbamoyltransferase [Alcanivorax borkumensis SK2]
 gi|110646690|emb|CAL16166.1| ornithine carbamoyltransferase [Alcanivorax borkumensis SK2]
          Length = 302

 Score =  229 bits (583), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 143/302 (47%), Positives = 195/302 (64%), Gaps = 4/302 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT  +HF  L++++   L  +I+ A ++K    N   ++PL GK L MIFEK STRTRVS
Sbjct: 1   MT--RHFLTLTDLTPDELGYLIQRAIELKTMLRNGQNHEPLKGKTLGMIFEKSSTRTRVS 58

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FEVAM H GG +IFLS  + QLGR E I D+A+VLSR VDA+++RT +H+ L    +++ 
Sbjct: 59  FEVAMTHFGGSSIFLSPRDTQLGRGEPIEDSARVLSRMVDAVMIRTFDHATLQTFADHSA 118

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVINALTD+ HPCQ++AD+ TF EHRGS++GK   W GDGNN+  S I  A +F++ L 
Sbjct: 119 VPVINALTDDFHPCQLLADMQTFVEHRGSIQGKKVVWVGDGNNMCASYINAANQFDFELV 178

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           I+ P G  P N+ L     + +  A    AVQ           +     ++ +    + F
Sbjct: 179 ISCPDGFTPDNDLLGRYPERVSLEADVATAVQGAHLVVTDVWASM--GQEDEQQTRLNAF 236

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           + +QV   LM  A PDALFMHCLPAHRGEEV +E++D P++VV+DEAENRLH QKA+L +
Sbjct: 237 EGYQVTPELMDKADPDALFMHCLPAHRGEEVSHEMMDDPRAVVWDEAENRLHAQKALLEF 296

Query: 302 CF 303
             
Sbjct: 297 LL 298


>gi|329114399|ref|ZP_08243161.1| Ornithine carbamoyltransferase [Acetobacter pomorum DM001]
 gi|326696475|gb|EGE48154.1| Ornithine carbamoyltransferase [Acetobacter pomorum DM001]
          Length = 333

 Score =  228 bits (582), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 166/309 (53%), Positives = 216/309 (69%), Gaps = 6/309 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIF----ENKPLSGKVLAMIFEKPSTR 57
           +  P+HF DL ++ ++ L  I++VA  +K   +         +PL+G+ L +I  KPSTR
Sbjct: 15  LATPRHFLDLKDLDAATLRQILDVAASMKRMQQKRRFPLHPRQPLAGRQLGLILSKPSTR 74

Query: 58  TRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELT 117
           TRVSFEV ++ LGGD + LS  EMQ+GR E+I DTA+VLSR+VDAI++RT N   L EL 
Sbjct: 75  TRVSFEVGIRQLGGDAVVLSPQEMQIGRGESIADTARVLSRFVDAIMLRTGNTKTLHELA 134

Query: 118 EYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFN 177
           +++TVPVIN LT ++HP QI+ADIMTFEEHRG V+G+ F+W+GDGNN+L SLIEGA RF 
Sbjct: 135 QWSTVPVINGLTPHSHPVQILADIMTFEEHRGPVRGRTFAWTGDGNNVLVSLIEGAVRFG 194

Query: 178 YLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKA 235
           + L  ATP   +P  + L+WAR +G  V    D   AVKGA CV TDTWISM+   +  A
Sbjct: 195 FALRAATPADMKPPQDVLDWARAEGGDVEWTIDPKAAVKGADCVVTDTWISMSDSPKEAA 254

Query: 236 REEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
                 +P++VN  LM++A P+ALFMHCLPAH GEEV  +V +GP SVVFDEAENRLH Q
Sbjct: 255 SRMSKLEPYRVNADLMALAAPEALFMHCLPAHIGEEVTKDVFEGPHSVVFDEAENRLHAQ 314

Query: 296 KAILLWCFG 304
           K +L W  G
Sbjct: 315 KGVLAWTMG 323


>gi|254421074|ref|ZP_05034798.1| ornithine carbamoyltransferase [Brevundimonas sp. BAL3]
 gi|196187251|gb|EDX82227.1| ornithine carbamoyltransferase [Brevundimonas sp. BAL3]
          Length = 304

 Score =  228 bits (582), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 145/305 (47%), Positives = 197/305 (64%), Gaps = 8/305 (2%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSE-----NIFENKPLSGKVLAMIFEKPSTRT 58
             +HF D+  + +++L  I++ A   K + +         + P   +VLAMIFEK STRT
Sbjct: 1   MVRHFLDIHQLDAADLRSILDDAHARKAARKGWPQGRPDADAPGKDRVLAMIFEKNSTRT 60

Query: 59  RVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTE 118
           R SF+ A++ LGG  I  + S+MQLGR E + DTA+VLSR VDA+++R  +H  +     
Sbjct: 61  RFSFDAAIRQLGGAAIIATASDMQLGRGEPVEDTARVLSRMVDAVMIRANSHEDVERFAR 120

Query: 119 YATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNY 178
            +TVPVIN LTD +HPCQI+AD+ T EEH G V GK  +W GDGNN+ HS +  A RF +
Sbjct: 121 VSTVPVINGLTDRSHPCQILADLQTIEEHSGPVSGKTIAWIGDGNNVCHSFMHAAPRFGF 180

Query: 179 LLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE 238
            LN+A P    P    L    N G +V L  D  +AVKGA  V TDTW+SM  +      
Sbjct: 181 HLNVACPAAYHPD---LRDLANGGGAVTLTSDPREAVKGADVVVTDTWVSMGDQDYEARL 237

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F+ + V+ +LM++A PDA+F+HCLPAHRGEEV + V+DGP+S+V+DEAENR+H QKA+
Sbjct: 238 AAFEDYTVDEALMALADPDAVFLHCLPAHRGEEVTDAVIDGPRSLVWDEAENRIHAQKAV 297

Query: 299 LLWCF 303
           L WCF
Sbjct: 298 LAWCF 302


>gi|251799700|ref|YP_003014431.1| ornithine carbamoyltransferase [Paenibacillus sp. JDR-2]
 gi|247547326|gb|ACT04345.1| ornithine carbamoyltransferase [Paenibacillus sp. JDR-2]
          Length = 318

 Score =  228 bits (582), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 143/305 (46%), Positives = 194/305 (63%), Gaps = 5/305 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             + F  L + +   +  +I++A  +K   +     +PL GK L MIFEK STRTRVSFE
Sbjct: 14  KGRDFLMLLDYTPEEIRYLIDLAIDLKKKQKAGEVYQPLKGKTLGMIFEKSSTRTRVSFE 73

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V +  LGG  +FLSG+++Q+GR E I DTA+VLSRY+D I++RT  H  ++EL   AT+P
Sbjct: 74  VGIYQLGGQGLFLSGNDLQIGRGEPILDTAQVLSRYLDGIMIRTFAHRNVVELARGATIP 133

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD +HPCQ +AD  T  EH+G ++G   ++ GDGNN++HSL+ GAA+    ++IA
Sbjct: 134 VINGLTDLSHPCQALADYQTILEHKGRLEGLKLAYIGDGNNVVHSLMMGAAKLGVDISIA 193

Query: 184 TPIGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREE 238
           TP G EP  + L      A+  GA + L  D  +A+  A  V++D W SM  +  +   E
Sbjct: 194 TPEGYEPDADLLKQSIDNAKETGARIHLCRDPKEAIADADVVYSDVWASMGQESEQKDRE 253

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F  FQVN +L   A  D LFMHCLPAHRGEEV   V+DGP S++FD+AENRLH QKAI
Sbjct: 254 LAFANFQVNEALAKYAKKDYLFMHCLPAHRGEEVSEGVIDGPHSIIFDQAENRLHAQKAI 313

Query: 299 LLWCF 303
           +    
Sbjct: 314 MAAIM 318


>gi|53803891|ref|YP_114510.1| ornithine carbamoyltransferase [Methylococcus capsulatus str. Bath]
 gi|81681594|sp|Q606D8|OTC_METCA RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|53757652|gb|AAU91943.1| ornithine carbamoyltransferase [Methylococcus capsulatus str. Bath]
          Length = 298

 Score =  228 bits (582), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 139/300 (46%), Positives = 179/300 (59%), Gaps = 5/300 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
            P+HF  L ++SS+    +I  A  +K         +PL  KVL M+FEK STRTRVSFE
Sbjct: 2   KPRHFVTLRDLSSAEFRALIARAIDLKA---RKEPYEPLKNKVLGMVFEKSSTRTRVSFE 58

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M   GG +IFLS  + QLGR E I D+A+VLSR VD I++RT  H  +    EY+ VP
Sbjct: 59  VGMAQFGGSSIFLSPRDTQLGRGEPIEDSARVLSRMVDCIMLRTHAHRTVEIFAEYSRVP 118

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQ++AD+ T+ EHRG + GK  +W GDGNN+  + +  A   ++ L IA
Sbjct: 119 VINGLTDRFHPCQLLADMQTYFEHRGDIAGKTVAWIGDGNNMCQTYVHAAGLLDFRLRIA 178

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQP 243
            P G EP  E +  A            AV            +     +  +      F+ 
Sbjct: 179 CPPGYEPEAELVEAAGKCVEVGHDVRTAVNGADLVVTDVWASM--GQESEQTERTGAFRD 236

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +QVN +LM++AH DALFMHCLPAHRGEEV  EVL+GPQSVV+DEAENRLH QKA+L +  
Sbjct: 237 YQVNAALMALAHADALFMHCLPAHRGEEVSAEVLEGPQSVVWDEAENRLHAQKALLEFLL 296


>gi|148262310|ref|YP_001229016.1| ornithine carbamoyltransferase [Geobacter uraniireducens Rf4]
 gi|146395810|gb|ABQ24443.1| ornithine carbamoyltransferase [Geobacter uraniireducens Rf4]
          Length = 305

 Score =  228 bits (582), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 136/303 (44%), Positives = 189/303 (62%), Gaps = 2/303 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             + F  LS  + + L  I  + ++++   +   E+  L GK LAMIFEK STRTRVSFE
Sbjct: 1   MKRDFLALSQFTKTELDAIFALTRELQQKQKQGIEHHLLKGKTLAMIFEKSSTRTRVSFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M  LGG  +F+S  + Q+GR E I DTA+V++RY D +++RT     + E   Y+ VP
Sbjct: 61  VGMYQLGGHPLFISTKDSQMGRGEPIKDTARVMARYCDGVMIRTYGQEIVEEFARYSAVP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQI+AD+ T  EHRGS +G   +W GDGNN+ ++ IE AA F + L +A
Sbjct: 121 VINGLTDLHHPCQIMADLFTVIEHRGSYEGLKIAWVGDGNNMANTWIEAAAIFGFDLTLA 180

Query: 184 TPIGSEPRNEYLNWARNQGASVAL-FHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVF 241
            P G EP    + WA+ +  S  +   D  +AVK A  + TD W SM QE + +  E  F
Sbjct: 181 CPKGYEPDARVMAWAQAKATSRIVLTDDPHEAVKDADVINTDVWASMGQEAEQKAREKAF 240

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
             +Q+N +L+  A  + + +HCLPAHRGEE+ ++V++GP S V+DEAENRLH QKAI+  
Sbjct: 241 AGYQLNEALLDPARGNCMVLHCLPAHRGEEITDDVIEGPHSAVWDEAENRLHVQKAIMAT 300

Query: 302 CFG 304
             G
Sbjct: 301 LMG 303


>gi|303242111|ref|ZP_07328601.1| ornithine carbamoyltransferase [Acetivibrio cellulolyticus CD2]
 gi|302590298|gb|EFL60056.1| ornithine carbamoyltransferase [Acetivibrio cellulolyticus CD2]
          Length = 306

 Score =  228 bits (582), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 136/304 (44%), Positives = 201/304 (66%), Gaps = 5/304 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
             H   L++++   +  I+ +++K+K   +    +  L GK L MIF K STRTRVSFEV
Sbjct: 1   MDHLISLNDLTLEEIEQILNLSEKLKKQQQEGVTHHYLKGKTLGMIFTKSSTRTRVSFEV 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG  +FLS +++Q+GR ETI DTA+VLSRY+D I++RT  HS + +L +Y  +P+
Sbjct: 61  GMYQLGGYALFLSSNDIQIGRGETIYDTAQVLSRYIDGIMIRTFAHSDVEDLAKYGNIPI 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD  HPCQI+AD+ T  EH+G++KG   ++ GDGNNI +SL+ G ++    + I +
Sbjct: 121 INGLTDLMHPCQILADLFTVYEHKGTLKGLKMAYLGDGNNIANSLLHGCSKVGMDVAIGS 180

Query: 185 PIGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREEH 239
           P G +   + ++     A+  G+++ L  D V+A+K A  V+TDTW+SM  +  K     
Sbjct: 181 PKGYQCDEQVISEAKEAAKISGSNIILTEDPVEAIKDADVVYTDTWVSMGQESEKQSRIK 240

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           +F+P++V+ +L + A  DA+F+HCLPA+RG EV  E++DG QSVVFDEAENRLH QKAI+
Sbjct: 241 IFEPYKVDGNLFAKAKEDAIFLHCLPAYRGYEVTEEIIDGSQSVVFDEAENRLHVQKAIM 300

Query: 300 LWCF 303
               
Sbjct: 301 ALLM 304


>gi|308071072|ref|YP_003872677.1| Ornithine carbamoyltransferase (OTCase) [Paenibacillus polymyxa
           E681]
 gi|305860351|gb|ADM72139.1| Ornithine carbamoyltransferase (OTCase) [Paenibacillus polymyxa
           E681]
          Length = 318

 Score =  228 bits (581), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 144/308 (46%), Positives = 196/308 (63%), Gaps = 5/308 (1%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M    + F +L N S   +  +I++A +IK   +N    +PL GK L +IFEK STRTRV
Sbjct: 10  MNLKGRDFLELDNYSPEEIQYLIDLAIEIKRKHKNGETYQPLKGKTLGLIFEKSSTRTRV 69

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFEV M  LGG  +FLS +++QLGR E I D A+V+SRY+D I++RT  H  ++EL  YA
Sbjct: 70  SFEVGMYQLGGHALFLSKNDIQLGRGEPISDMAQVMSRYLDGIMIRTFGHDNVVELARYA 129

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +VPVIN L+D  HPCQ++AD  T  E +G +KG   ++ GDGNN+ HSL+ G A+    +
Sbjct: 130 SVPVINGLSDLAHPCQVLADYQTLYEQKGKLKGLKLAYIGDGNNMAHSLLIGGAKLGVHV 189

Query: 181 NIATPIGSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-A 235
           +IA+P G EP    +      A+  G+ + +     +AV+ A  ++TD W SM  E +  
Sbjct: 190 SIASPAGYEPDPNVVAASREIAKQTGSEIVITQSPQEAVQDADAIYTDVWASMGFEEEQK 249

Query: 236 REEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
             E  F  FQVN  L+ +A PD LF+HCLPAHRGEEV   V+DGP SV+FDEAENRLH Q
Sbjct: 250 ERELAFADFQVNEELVKLAKPDYLFLHCLPAHRGEEVSAGVIDGPNSVIFDEAENRLHAQ 309

Query: 296 KAILLWCF 303
           KA+L+   
Sbjct: 310 KALLVALM 317


>gi|320161211|ref|YP_004174435.1| ornithine carbamoyltransferase [Anaerolinea thermophila UNI-1]
 gi|319995064|dbj|BAJ63835.1| ornithine carbamoyltransferase [Anaerolinea thermophila UNI-1]
          Length = 331

 Score =  228 bits (581), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 132/305 (43%), Positives = 188/305 (61%), Gaps = 5/305 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K F  + + +   L  ++++A ++K    +      L GKVL MIF+KPS RTRVSF+
Sbjct: 24  MKKDFISIQDYTPEELQSMLDLAIQLKKEYFSGGNPPLLKGKVLGMIFQKPSLRTRVSFD 83

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           +AM+HLGGD ++LS +E+ LG+ E+I D A+VLS YV AI+ R   H  +LEL ++++VP
Sbjct: 84  MAMRHLGGDALYLSPNEIGLGQRESIADVARVLSGYVHAIMARVFAHEHVLELAKWSSVP 143

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN L+D  HPCQ +AD +T  E  G++KG   ++ GDGNN+  SL+    +       +
Sbjct: 144 VINGLSDYDHPCQAMADALTIIEKFGTLKGVNVTFVGDGNNVCVSLMHIVTKLGGNFTHS 203

Query: 184 TPIGSEPRNE----YLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REE 238
            P G +   +     L +A   G+ V    D  +AV+ A  ++TDTW SM QE +A   E
Sbjct: 204 GPEGYDMPKQAVELGLQFASKSGSKVRFTRDPHEAVRDAQVIYTDTWTSMGQEAEAKERE 263

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
            VF P+QVN  L+S A  D + MHCLPAHRG+E+ + V DGP S +F +A NRLH QKAI
Sbjct: 264 KVFPPYQVNEQLVSEADKDCIVMHCLPAHRGQEITDAVADGPHSAIFPQAHNRLHAQKAI 323

Query: 299 LLWCF 303
           L+  F
Sbjct: 324 LVRLF 328


>gi|118581573|ref|YP_902823.1| ornithine carbamoyltransferase [Pelobacter propionicus DSM 2379]
 gi|189036336|sp|A1ATU5|OTC_PELPD RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|118504283|gb|ABL00766.1| ornithine carbamoyltransferase [Pelobacter propionicus DSM 2379]
          Length = 305

 Score =  228 bits (581), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 141/303 (46%), Positives = 189/303 (62%), Gaps = 2/303 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             +HF  L + +   L  ++ +A ++K   +   E+  L GK LAMIF+K STRTR+SFE
Sbjct: 1   MARHFLSLHDYTKEELDRLLALAIELKQEQKQGGEHHLLKGKTLAMIFDKSSTRTRISFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V +  LGG  +F+S    Q+GR E + DTA+VLSRY D I++RT     + EL  YATVP
Sbjct: 61  VGIYQLGGHGLFISTGTSQMGRGEPLKDTARVLSRYCDGIMIRTFGQEIVDELAAYATVP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQI+AD+MT  EH+G   G  F+W GDGNN+ ++ IE AA F + L +A
Sbjct: 121 VINGLTDLFHPCQIMADVMTVMEHKGGYAGLKFAWVGDGNNMANTWIEAAAIFGFDLALA 180

Query: 184 TPIGSEPRNEYLNW-ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVF 241
            P G EP  + + W A      V L  D  +AV GAH + TD W SM  E + +  E  F
Sbjct: 181 CPQGYEPDAKVMAWAAERAPGRVTLTADPKEAVSGAHVINTDVWASMGMEAEQKVREQAF 240

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
             F ++ +L  +AHPD + +HCLPAHRGEE+ + V++G  S V+DEAENRLH QKAI+  
Sbjct: 241 GGFCLDDALAGLAHPDHIVLHCLPAHRGEEISDSVIEGSNSRVWDEAENRLHAQKAIMAT 300

Query: 302 CFG 304
             G
Sbjct: 301 LMG 303


>gi|295696783|ref|YP_003590021.1| ornithine carbamoyltransferase [Bacillus tusciae DSM 2912]
 gi|295412385|gb|ADG06877.1| ornithine carbamoyltransferase [Bacillus tusciae DSM 2912]
          Length = 318

 Score =  228 bits (581), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 150/303 (49%), Positives = 194/303 (64%), Gaps = 5/303 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F DL++ +S  L  ++ +A  +K   +     +PL+GK L MIFEK STRTRVSFEV 
Sbjct: 11  RDFLDLADFTSDELRGLLRLAAVLKEKQKAGERVQPLAGKTLGMIFEKSSTRTRVSFEVG 70

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FL+  + QLGR E I DTA+VLSRYVD I++RT +H  + EL EYATVPVI
Sbjct: 71  MVQLGGHALFLASHDTQLGRGEPIPDTARVLSRYVDGIMIRTFSHESVRELAEYATVPVI 130

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ++AD MT  EH+  ++G   ++ GDGNN+ +S + GA  F   L +ATP
Sbjct: 131 NGLTDLHHPCQVLADAMTILEHKSRLEGVTVAYVGDGNNMANSWLVGAPLFGMNLRVATP 190

Query: 186 IGSEPRN----EYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHV 240
            G E            A   G  ++L HD  +AV GA  ++TD W SM QE +       
Sbjct: 191 QGYECDPGVAARAQELAARAGTEMSLVHDPREAVAGADVIYTDVWASMGQEAEREERLRA 250

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F  F+V  +L++ A PD LFMHCLPAHRGEEV  +V+DGP SV+FDEAENRLH QKAIL+
Sbjct: 251 FAGFEVTPALVARAAPDYLFMHCLPAHRGEEVAPDVIDGPHSVIFDEAENRLHAQKAILV 310

Query: 301 WCF 303
              
Sbjct: 311 ATM 313


>gi|326796229|ref|YP_004314049.1| ornithine carbamoyltransferase [Marinomonas mediterranea MMB-1]
 gi|326546993|gb|ADZ92213.1| Ornithine carbamoyltransferase [Marinomonas mediterranea MMB-1]
          Length = 301

 Score =  228 bits (581), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 152/299 (50%), Positives = 196/299 (65%), Gaps = 4/299 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           P+HF  L ++++     +I  A ++K         +PL  +VLAMIFEK STRTRVSFE 
Sbjct: 3   PRHFLTLKDLTTEEFKQLISRAIELKKMQREGVIYEPLKNRVLAMIFEKSSTRTRVSFES 62

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M   GG  +FLS  + QLGR E I D+AKV+S  VDA+++RT  H ++    + ++VPV
Sbjct: 63  GMAQFGGHALFLSPRDTQLGRGEPIEDSAKVISSMVDAVMIRTFEHDKVEVFAQNSSVPV 122

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALTD+ HPCQ++AD+ T+EEHRGS++GK   W GDGNN+ HS I  AA  N+ L +A 
Sbjct: 123 INALTDDFHPCQLLADMQTYEEHRGSIEGKKVVWVGDGNNMCHSYINAAAILNFHLVVAC 182

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQP 243
           P G EP  E +       A V + +DA  AVK +  V TD + SM QE + A+ E  F  
Sbjct: 183 PTGYEPNAELV---TANKAFVTITNDAKAAVKDSDLVVTDVFASMGQEEEQAQREKDFDG 239

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           FQVN  LMS+AH DALFMHCLPAHRGEEV   V+D P SVV+DEAENRLH QKA+L + 
Sbjct: 240 FQVNEELMSLAHDDALFMHCLPAHRGEEVTAGVIDHPDSVVWDEAENRLHAQKALLEFL 298


>gi|126178949|ref|YP_001046914.1| ornithine carbamoyltransferase [Methanoculleus marisnigri JR1]
 gi|189036332|sp|A3CU82|OTC_METMJ RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|125861743|gb|ABN56932.1| ornithine carbamoyltransferase [Methanoculleus marisnigri JR1]
          Length = 309

 Score =  228 bits (580), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 135/300 (45%), Positives = 191/300 (63%), Gaps = 1/300 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K F  + +I    L  I+  A ++K        ++ L GK L MIFEK STRTRVSFE
Sbjct: 1   MKKDFLSILDIGEYELESIVADAVRLKRLKSAGTAHEFLRGKSLGMIFEKASTRTRVSFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M  LGG  +FL+  +MQLGR E I DTA+VL+RYVDA+++R  +H+ + E   YA VP
Sbjct: 61  VGMSDLGGHALFLNPQDMQLGRGEEIRDTARVLARYVDAVMIRAYSHAAIEEFARYANVP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           V+N L+D  HPCQ++ADIMT  E  G + G   +W GDGNN+ +S +  +A     + +A
Sbjct: 121 VVNGLSDRLHPCQVLADIMTLSERFGDLHGLKLAWVGDGNNVCNSWLLSSALTGMEIAVA 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQ 242
           +P    PR+E ++ AR  G  V +  D  +AV+ A  ++TD W+SM  E + A      +
Sbjct: 181 SPPRYRPRDEIVDQARAAGGKVTVVTDPDEAVRDADVLYTDIWVSMGDEQERAERLQALK 240

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            + ++  L++ A PDAL MHCLPAHRGEE+ +EV++GPQS+V+D+AENRLH QKA+L+  
Sbjct: 241 GYTIDSRLLAQASPDALVMHCLPAHRGEEITDEVMEGPQSIVWDQAENRLHAQKALLVRL 300


>gi|329847860|ref|ZP_08262888.1| ornithine carbamoyltransferase [Asticcacaulis biprosthecum C19]
 gi|328842923|gb|EGF92492.1| ornithine carbamoyltransferase [Asticcacaulis biprosthecum C19]
          Length = 312

 Score =  228 bits (580), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 150/308 (48%), Positives = 204/308 (66%), Gaps = 7/308 (2%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSE-----NIFENKPLSGKVLAMIFEKPST 56
           MT  +HF D+ ++ +  L  I++ A + K + +      +  + P   +VLAMIFEK ST
Sbjct: 1   MT--RHFLDICDLDAVTLRAIVDDAHRRKAARKGWTQGRVDADAPAKERVLAMIFEKNST 58

Query: 57  RTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLEL 116
           RTR SF+ A++ LGG  I  + S+MQLGR E I DT+KVLSR VDAI++R   H  +L L
Sbjct: 59  RTRFSFDAAIRQLGGSAIISTASDMQLGRGEPIEDTSKVLSRMVDAIMIRANRHEDVLRL 118

Query: 117 TEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARF 176
              +T+PV+N LT+ +HPCQI+ADI T EEHRG + GK+ +W  DGNN+ +SLI  AARF
Sbjct: 119 AAVSTIPVVNGLTNLSHPCQILADIQTIEEHRGPIAGKVLAWVSDGNNVCNSLIHAAARF 178

Query: 177 NYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR 236
           ++ L IA P   +P  + + +A   GA V +  D   AV+GA  V  DTW+SM       
Sbjct: 179 DFELRIACPDDYKPSMDAMVFAAQHGAKVTVGSDPRAAVEGADVVLADTWVSMGDLDHDE 238

Query: 237 EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
               F  +QV+  LM++A  DA+F+HCLPAHRGEEV +EV+DGPQS+++DEAENR+H QK
Sbjct: 239 RLMAFHEYQVDSKLMALAKKDAVFLHCLPAHRGEEVSDEVIDGPQSLIWDEAENRIHAQK 298

Query: 297 AILLWCFG 304
           AIL WCFG
Sbjct: 299 AILAWCFG 306


>gi|167044951|gb|ABZ09616.1| putative aspartate/ornithine carbamoyltransferase, carbamoyl-P
           binding domain protein [uncultured marine crenarchaeote
           HF4000_APKG8G2]
          Length = 304

 Score =  228 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 147/303 (48%), Positives = 189/303 (62%), Gaps = 1/303 (0%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M    K    +  ISS     +I+ + K+K  ++ + E   L  K LAM+FEKPSTRTRV
Sbjct: 1   MKLKTKDLLTVDEISSKEFLELIDFSIKLKKENKTVKEKPLLKNKTLAMLFEKPSTRTRV 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFE+ M  LGG T+ LS +EMQ  R E++ DTAK LSRYVDAIV R   HS + +L ++A
Sbjct: 61  SFEIGMLQLGGHTVNLSLNEMQHSRGESVEDTAKTLSRYVDAIVARVYEHSFIEKLAKHA 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVIN L+++ HPCQ +AD+MT +EH+   K    +W GDGNN+ +SLI G ++    +
Sbjct: 121 TVPVINGLSNSYHPCQTLADLMTIKEHKKKFKDLKIAWIGDGNNVCNSLIFGCSKTQTQI 180

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            IATP G EP  E +  +           D   AVK A  V TDT+ S++     R E  
Sbjct: 181 VIATPKGFEPNPEVVKKSSKYTVVDL-TTDPKSAVKDADIVMTDTFTSIHMSDPKRTEKF 239

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
              FQVN SLM  A  DA+FMHCLPA R +EV + V+DGPQSVV+DEAENRLHTQKA+LL
Sbjct: 240 LPSFQVNDSLMEKAKNDAIFMHCLPAKREQEVTSSVIDGPQSVVWDEAENRLHTQKALLL 299

Query: 301 WCF 303
              
Sbjct: 300 SLL 302


>gi|114704458|ref|ZP_01437366.1| ornithine carbamoyltransferase [Fulvimarina pelagi HTCC2506]
 gi|114539243|gb|EAU42363.1| ornithine carbamoyltransferase [Fulvimarina pelagi HTCC2506]
          Length = 308

 Score =  228 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 193/302 (63%), Positives = 234/302 (77%), Gaps = 2/302 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KHF D++ + SS+L  II  A   K    +  + KPL GKVLAMIF+KPSTRTRVSF+V
Sbjct: 1   MKHFLDIAAVDSSDLRTIIADAMHRKTL--DGRQAKPLEGKVLAMIFDKPSTRTRVSFDV 58

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M+ LGG+T+FLSG+EMQLGR+ETI DTAKV+SRYVDAI++RTT H+RLLEL E ATVPV
Sbjct: 59  GMRQLGGETLFLSGTEMQLGRSETIADTAKVMSRYVDAIMIRTTEHARLLELAESATVPV 118

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD+THPCQI+ADI+TFEE RG VKGK F+W GDGNN+  S IE AARF + + IAT
Sbjct: 119 INGLTDDTHPCQIMADILTFEEKRGPVKGKTFAWVGDGNNVTASWIEAAARFEFKMTIAT 178

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P GSE    ++ WARN+GA +    D V+AV GA CV TDTW+SM +E +AR  +VF P+
Sbjct: 179 PEGSEADARFVTWARNEGAEILTTTDPVEAVNGADCVITDTWVSMGREAQARGHNVFMPY 238

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QVN +LM  A  +ALFMHCLPAHRGEEV + V+DGPQSVVFDEAENRLH QK+I+ W FG
Sbjct: 239 QVNENLMRHAKSEALFMHCLPAHRGEEVTDGVMDGPQSVVFDEAENRLHAQKSIIAWVFG 298

Query: 305 II 306
            +
Sbjct: 299 SL 300


>gi|224824998|ref|ZP_03698104.1| ornithine carbamoyltransferase [Lutiella nitroferrum 2002]
 gi|224602669|gb|EEG08846.1| ornithine carbamoyltransferase [Lutiella nitroferrum 2002]
          Length = 307

 Score =  228 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 128/302 (42%), Positives = 177/302 (58%), Gaps = 1/302 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT  +H+   S+++  +   + + A+ +K    +    +PL GKV++M+FEK STRTRVS
Sbjct: 1   MTQVRHYLQFSDLNRDDYQYLFQRAQVLKRRHGSGELYRPLVGKVMSMVFEKNSTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  +FL  +  QLGR E I DTA+VLSR  D I++RT   S +  L   + 
Sbjct: 61  FEAGMSQLGGHAMFLDANTSQLGRGEPIEDTARVLSRMSDIIMIRTFEQSNVERLAANSR 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LT+  HPCQI+ADI+TF EHRG +KGK  +W GDGNN+  + ++ A   ++ L 
Sbjct: 121 VPVINGLTNEYHPCQILADILTFIEHRGPIKGKTVAWVGDGNNMCRTWLQAAKLLDFKLK 180

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
            ATP+G E +         +    +   +   A          T     +         F
Sbjct: 181 AATPVGYELKALDGQHYGPEHFEPSHSAEHAVAGADLVTTDVFTS-MGFEAESVARMEAF 239

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           + +Q+   LM  A PDALFMHCLPAHRGEEV  +V+DGPQSVV+DEAENR+H QKA++ +
Sbjct: 240 RNYQITADLMKHAKPDALFMHCLPAHRGEEVAADVIDGPQSVVWDEAENRMHGQKALIEY 299

Query: 302 CF 303
             
Sbjct: 300 LL 301


>gi|144900478|emb|CAM77342.1| Ornithine carbamoyltransferase [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 311

 Score =  228 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 172/298 (57%), Positives = 208/298 (69%), Gaps = 1/298 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF DL    +  L  I+++    K   +     KPLSG+VLAMIFEKPSTRTRVSFE  
Sbjct: 14  RHFLDLDRFDTETLRRILDLGAAYKRGEQPFGRPKPLSGRVLAMIFEKPSTRTRVSFETG 73

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           MK LGGDTI LS  + QLGR ET+ DTA+VLSRYVDAI++RT + ++L EL+EYATVPVI
Sbjct: 74  MKQLGGDTIVLSKGDTQLGRGETVADTARVLSRYVDAIMIRTDDPAKLAELSEYATVPVI 133

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+THPCQ++ADIMTF EHRGS+ GK+ SW GDGNN+  S I+ AA FN+ + +A P
Sbjct: 134 NGLTDDTHPCQVMADIMTFTEHRGSLDGKVVSWVGDGNNVAASWIQAAAHFNFEMRLACP 193

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
               P    + WAR QGA V +  D V AVK +H V TDTW+SM          +  P+Q
Sbjct: 194 SELMPDVAAVEWARAQGARVVIGSDPVAAVKDSHLVITDTWVSMGCTD-TNRHTLLSPYQ 252

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN  LM+ A  DALFMHCLPAHR EEV + V+DG QSVV+DEAENRLH QK IL WC 
Sbjct: 253 VNDGLMAHAAGDALFMHCLPAHRNEEVTDSVMDGAQSVVWDEAENRLHVQKGILSWCL 310


>gi|282164719|ref|YP_003357104.1| ornithine carbamoyltransferase [Methanocella paludicola SANAE]
 gi|282157033|dbj|BAI62121.1| ornithine carbamoyltransferase [Methanocella paludicola SANAE]
          Length = 305

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 124/299 (41%), Positives = 186/299 (62%), Gaps = 1/299 (0%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAM 66
           H   ++++S  +++ I+++A+ +K   ++      L  K L MIFEK STRTRVSFEV M
Sbjct: 2   HIISIADLSVDDINGILDLAEDLKKKRKDGVVTDYLKNKSLVMIFEKSSTRTRVSFEVGM 61

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
             LGG  ++L     Q+GR ETI DTAK+LSRY   I++R  +H  + E+ + AT+PVIN
Sbjct: 62  TDLGGHALYLDPGTTQIGRGETIADTAKILSRYAHCIMIRAKSHYMITEMAKNATIPVIN 121

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI 186
            L D+ HPCQ++AD+MT  E +G +KG   +W GDGNN+ +SLI  +A     +  A P 
Sbjct: 122 GLDDHEHPCQVLADLMTIRERKGPLKGLKLAWIGDGNNVCNSLILASAMTGMKMVAACPK 181

Query: 187 GSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF-QPFQ 245
           G EP    +  AR+ G  + +  +  +A K A  ++TD W+SM  E +    +   + +Q
Sbjct: 182 GYEPDKGVIEKARSMGGDIKVLRNPKEAAKDADVLYTDVWVSMGDESEMERRYKDLRDYQ 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           +N+ L+ +A    + +HCLPAHRG+E+ +EV++   S VFDEAENRLH QKA+L+   G
Sbjct: 242 INIGLVKLASKGCIVLHCLPAHRGQEITDEVINSENSAVFDEAENRLHAQKALLIKLIG 300


>gi|260893668|ref|YP_003239765.1| ornithine carbamoyltransferase [Ammonifex degensii KC4]
 gi|260865809|gb|ACX52915.1| ornithine carbamoyltransferase [Ammonifex degensii KC4]
          Length = 312

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 141/301 (46%), Positives = 193/301 (64%), Gaps = 3/301 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F  +++ +S  +  ++  A ++K + +    +   +GK LAMIF+KPSTRTRVSFEVA
Sbjct: 12  RDFLSIADFTSEEIMGLLSFAAELKEAKKRGETHTFCAGKSLAMIFQKPSTRTRVSFEVA 71

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  ++L+  ++QLGR E+I DT +VLSRYVD  V+RT     + EL E AT+PVI
Sbjct: 72  MFDLGGYALYLNAQDLQLGRGESIADTGRVLSRYVDGCVIRTFRQEEVEELAEAATIPVI 131

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT   HPCQI+AD +T  + +G + G   ++ GDGNNI HSL+ G  R    + +ATP
Sbjct: 132 NGLTSWEHPCQILADFLTILQSKGRLAGLKLAYVGDGNNICHSLLLGCPRVGMSIYVATP 191

Query: 186 IGSEPRNEYLNWARNQGASVA--LFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQ 242
               P    +  A+         +  D VQAVKGA  V TD W+SM QE +A  ++ VF 
Sbjct: 192 PQYAPHPTVVARAQEAARGTEVVVTEDPVQAVKGADVVVTDVWVSMGQEEEAETKKKVFL 251

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           P+QVN  L+S A PD +F+HCLPAHRGEEV  E++DGP S+V++EAENRLH QKA+L   
Sbjct: 252 PYQVNEELVSHAKPDFIFLHCLPAHRGEEVTAEIIDGPHSLVWEEAENRLHVQKALLALL 311

Query: 303 F 303
            
Sbjct: 312 L 312


>gi|239826270|ref|YP_002948894.1| ornithine carbamoyltransferase [Geobacillus sp. WCH70]
 gi|239806563|gb|ACS23628.1| ornithine carbamoyltransferase [Geobacillus sp. WCH70]
          Length = 312

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 153/305 (50%), Positives = 203/305 (66%), Gaps = 5/305 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K F  L +IS+ ++  ++ +AK++K          PL GK LAMIFEKPSTRTRVSFE
Sbjct: 8   KGKDFLTLMDISTEDIHYLLTLAKELKQKQLAGQLYTPLVGKTLAMIFEKPSTRTRVSFE 67

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M  LGG  ++L+ +++QLGR ETI DTA+VLS+YVDAI++RT  H +L EL EYAT+P
Sbjct: 68  VGMTQLGGSALYLNSNDLQLGRGETIADTARVLSQYVDAIMIRTFAHQKLEELAEYATIP 127

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD+ HPCQ +AD++T  E + ++KG   ++ GDGNN+ H+L+  AA+      IA
Sbjct: 128 VINGLTDDDHPCQALADLLTIYEVKNTLKGLKLAYVGDGNNVAHALMIAAAKVGMDCVIA 187

Query: 184 TPIGSEPRNEYLNWARNQGASV----ALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REE 238
            P G EP+ +Y+N A   G       A+ H+ V+AV  A  ++TD W SM QE ++ +  
Sbjct: 188 CPAGYEPKEKYVNAAMQIGKQTGANVAVTHNPVEAVTNADIIYTDVWTSMGQEQESEQRL 247

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
            VFQPFQVN  L   A PD +F+HCLPAHR EEV  +V+DGP S VF +A NRLH QKAI
Sbjct: 248 AVFQPFQVNCELAKHAKPDYMFLHCLPAHRDEEVTADVIDGPNSFVFQQAGNRLHVQKAI 307

Query: 299 LLWCF 303
           LL   
Sbjct: 308 LLSLL 312


>gi|147919641|ref|YP_686616.1| ornithine carbamoyltransferase [uncultured methanogenic archaeon
           RC-I]
 gi|110622012|emb|CAJ37290.1| ornithine carbamoyltransferase [uncultured methanogenic archaeon
           RC-I]
          Length = 307

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 130/300 (43%), Positives = 188/300 (62%), Gaps = 1/300 (0%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAM 66
           HF   +++S + +  +I+ A+ +K           L  + LAMIFEK STRTRVSFEV M
Sbjct: 2   HFISFADMSPAEIEALIDRAEDLKRMRREGVITDYLKNRSLAMIFEKSSTRTRVSFEVGM 61

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
             LGG  ++L  + MQLGR ET+ DT ++LS YV  I++R  +H  L+EL + +TVPVIN
Sbjct: 62  TDLGGHALYLDPASMQLGRGETVADTGRILSSYVHGIMVRANDHDMLIELAKNSTVPVIN 121

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI 186
            L+D  HPCQ +AD+MT  E +G +KG  F W GDGNN+ +SL+   A     + +A P 
Sbjct: 122 GLSDREHPCQAVADLMTIREQKGKIKGLKFVWVGDGNNVCNSLMLACAMMGMEMVVACPK 181

Query: 187 GSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPFQ 245
           G EP  + L  AR+ G ++ +  D   A K A  ++TD W+SM QE + A+     + +Q
Sbjct: 182 GYEPNQQILEQARSMGGNITITRDPKAASKDADVLYTDVWVSMGQEAERAQRFADLRDYQ 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGI 305
           +N+ L+ +A  D L MHCLPAHRGEE+ ++ +  P SV+F++A+NRLH QKA+L+   G 
Sbjct: 242 INMELVGLAKKDCLVMHCLPAHRGEEITDDAIRSPNSVIFEQAQNRLHAQKALLIRLMGK 301


>gi|167645197|ref|YP_001682860.1| ornithine carbamoyltransferase [Caulobacter sp. K31]
 gi|167347627|gb|ABZ70362.1| ornithine carbamoyltransferase [Caulobacter sp. K31]
          Length = 311

 Score =  227 bits (578), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 147/310 (47%), Positives = 201/310 (64%), Gaps = 5/310 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSE-----NIFENKPLSGKVLAMIFEKPST 56
           MT P+HF DL  +  + L  I+E AK  K++ +      +  + P  G+VLAMIF+K ST
Sbjct: 1   MTTPRHFIDLWKLDGAALRVILEDAKARKSARKGWGQGKVDADAPAEGRVLAMIFQKNST 60

Query: 57  RTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLEL 116
           RTR SF+ A++ LGG  I  + ++MQLGR ETI DTAKVLSR VDA+++R  +H+ +   
Sbjct: 61  RTRFSFDAAIRQLGGAGIISTSNDMQLGRGETIEDTAKVLSRMVDAVMIRANSHADVERF 120

Query: 117 TEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARF 176
            + +TVPVIN LTD +HPCQI+AD++T EEHRG + GK  +W GDGNN+  S I  A   
Sbjct: 121 AQVSTVPVINGLTDKSHPCQIMADLLTIEEHRGDIGGKTIAWVGDGNNVCSSFIHAAPLL 180

Query: 177 NYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR 236
            + L IA P    P    L  A++    + L  D  +AV+GA  V  DTW+SM       
Sbjct: 181 GFTLKIACPAIYHPDLVDLARAQDLQGQITLTDDPREAVRGADVVVADTWVSMGDTDHDE 240

Query: 237 EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
                +P+QV+ +LM ++ PD +F+HCLPAHRGEEV + VLDGP+S+ +DEAENR+H QK
Sbjct: 241 RLAALEPYQVDDALMDLSKPDGVFLHCLPAHRGEEVTDSVLDGPRSLAWDEAENRIHAQK 300

Query: 297 AILLWCFGII 306
           ++L WCFG I
Sbjct: 301 SVLAWCFGAI 310


>gi|148261523|ref|YP_001235650.1| ornithine carbamoyltransferase [Acidiphilium cryptum JF-5]
 gi|326405011|ref|YP_004285093.1| ornithine carbamoyltransferase [Acidiphilium multivorum AIU301]
 gi|146403204|gb|ABQ31731.1| ornithine carbamoyltransferase [Acidiphilium cryptum JF-5]
 gi|325051873|dbj|BAJ82211.1| ornithine carbamoyltransferase [Acidiphilium multivorum AIU301]
          Length = 313

 Score =  227 bits (578), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 161/300 (53%), Positives = 210/300 (70%), Gaps = 2/300 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           P+HF DLS + +  L  +++ A + K +   +    PL+G+ LA+IFEKPSTRTRVSFE+
Sbjct: 14  PRHFLDLSLLDTPTLRHMLDTATRFKRAGRALG--HPLAGRALALIFEKPSTRTRVSFEI 71

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M+ LGG+ I LS  EMQ+GR ET+ DTA+VLSRYVD I++RT    +L EL  +ATVPV
Sbjct: 72  GMRRLGGEVIMLSSREMQIGRGETVADTARVLSRYVDGIMLRTDREEKLRELAAHATVPV 131

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LT+ +HPCQ++AD+MTFEE RG + G+  +W GDGNN+  S IE +ARF + L +A 
Sbjct: 132 INGLTERSHPCQVMADVMTFEEQRGPIAGQRIAWIGDGNNMAKSWIEASARFGFQLRLAC 191

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P    P  E L WAR QGA + L     +AV+GA CV TDTW+SM+ E      ++  P+
Sbjct: 192 PEELLPDAEALAWARAQGADIQLTTSPAEAVEGARCVTTDTWVSMSDEDVESRHNILAPY 251

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           +V+ +LM+ A PDA+FMHCLPAHRGEEV   V+DGPQSVVFDEAENRL  Q+ IL W  G
Sbjct: 252 RVDEALMARAAPDAIFMHCLPAHRGEEVSAGVIDGPQSVVFDEAENRLFAQQGILAWALG 311


>gi|87119428|ref|ZP_01075325.1| ornithine carbamoyltransferase [Marinomonas sp. MED121]
 gi|86164904|gb|EAQ66172.1| ornithine carbamoyltransferase [Marinomonas sp. MED121]
          Length = 301

 Score =  227 bits (578), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 135/302 (44%), Positives = 189/302 (62%), Gaps = 3/302 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M+ P+HF  L++++S  L  ++  A ++K    +  + +PL  +V+AMIFEK STRTRVS
Sbjct: 1   MS-PRHFLTLTDLTSDELKQVLTRATELKKLHRDGTQYQPLKNRVMAMIFEKSSTRTRVS 59

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M   GG  +FLS  + QLGR E I D+A+V+S  VDA+++RT  H ++    ++++
Sbjct: 60  FEAGMAQFGGHALFLSPRDTQLGRGEPIEDSARVISSMVDAVMIRTFEHEKIALFAKHSS 119

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVINALTD+ HPCQ++AD+ T++EHRGS++GK   W GDGNN+ HS +  A   ++ L 
Sbjct: 120 VPVINALTDDFHPCQLLADMQTYQEHRGSIQGKKVVWIGDGNNMCHSYMNAAHLLDFQLV 179

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +A P G EP  E    A+            V A      V         ++ +      F
Sbjct: 180 VACPKGYEPNAELT--AKYADRITITQDVQVAATDADLIVTDVFASMGQEDEQDTRLKDF 237

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
             FQVN +LM++A+ DALFMHCLPAHRGEEV  EV+D P SVV+DEAENRLH QKA+L +
Sbjct: 238 DGFQVNEALMALANEDALFMHCLPAHRGEEVTAEVIDAPDSVVWDEAENRLHAQKALLEF 297

Query: 302 CF 303
             
Sbjct: 298 LL 299


>gi|288871332|ref|ZP_06117239.2| ornithine carbamoyltransferase [Clostridium hathewayi DSM 13479]
 gi|288863856|gb|EFC96154.1| ornithine carbamoyltransferase [Clostridium hathewayi DSM 13479]
          Length = 312

 Score =  227 bits (578), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 110/311 (35%), Positives = 163/311 (52%), Gaps = 7/311 (2%)

Query: 1   MMTYP-KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MM    + F  L + +   ++ ++++A  +K   ++      L GK +A+IFEKPSTRTR
Sbjct: 1   MMNLKGRSFITLKDYTPEEINYLLDLAADLKAKKKSGVTGSSLKGKNIALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
            SF VA    G    +L   ++QLG  E++ DTA+VL R  D I  R   H  + +L +Y
Sbjct: 61  CSFVVAAVDEGAHPEYLGKDDIQLGHKESVEDTARVLGRIFDGIEFRGFKHKTVEDLAKY 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGD-GNNILHSLIEGAARFNY 178
           A VPV N LTD+ HP QI+AD++T +EH G +KG  F ++GD  NN+ +SL+ G ++   
Sbjct: 121 AGVPVWNGLTDDYHPTQILADLLTMKEHFGYLKGLNFVYAGDGRNNMANSLMIGMSKMGV 180

Query: 179 LLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE 238
              I  P    P++E +   R             + V       T          +  + 
Sbjct: 181 NFTILAPKCLWPKDELVTLCRGYAGESGSSVTLTENVDDVKGADTIYTDVWCSMGEEDKA 240

Query: 239 HVF----QPFQVNLSLMSMAHPD-ALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLH 293
                  +P+QVN +LM     D  +FMHCLPA +G EV  +V +   SVVFDEAENR+H
Sbjct: 241 AERVALLKPYQVNAALMEKTEKDTTIFMHCLPAVKGNEVTEDVFESKASVVFDEAENRMH 300

Query: 294 TQKAILLWCFG 304
           T KA+++   G
Sbjct: 301 TIKAVMVATLG 311


>gi|220935631|ref|YP_002514530.1| ornithine carbamoyltransferase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219996941|gb|ACL73543.1| ornithine carbamoyltransferase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 300

 Score =  227 bits (578), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 144/299 (48%), Positives = 192/299 (64%), Gaps = 4/299 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++++  L  +I  A ++K       E+ PL GK L MIFEK STRTRVSFEV 
Sbjct: 4   RHFLSLLDLTTEELRGLIARATELKRMHYEGVEHTPLKGKTLGMIFEKSSTRTRVSFEVG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLS  + QLGR E I D+A+VLSR VD +++RT  H ++     ++ VPVI
Sbjct: 64  MIQLGGHALFLSPRDTQLGRGEPIEDSARVLSRMVDGVMIRTFEHEKIERFAAHSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ++AD+ T+ EHRG + G+   + GDGNN+ +S I  A R  + L+IA P
Sbjct: 124 NGLTDLEHPCQLLADMQTWFEHRGDIAGRTVCYVGDGNNMCNSYITAAQRLGFTLHIACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G +P  + +  A   G    +  D  +A +GA  V TD W SM QE + ++    F  +
Sbjct: 184 EGYDPDPDLMQQA---GDCARIIRDPREAARGADLVVTDVWASMGQEDEQSQRRQAFARY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
            VN +LM++A PDALFMHCLPAHR EEV  EVL+GPQSVV+DEAENRLH QKA+L +  
Sbjct: 241 VVNGALMALARPDALFMHCLPAHREEEVSTEVLEGPQSVVWDEAENRLHAQKALLEFLM 299


>gi|163761280|ref|ZP_02168355.1| ornithine carbamoyltransferase [Hoeflea phototrophica DFL-43]
 gi|162281437|gb|EDQ31733.1| ornithine carbamoyltransferase [Hoeflea phototrophica DFL-43]
          Length = 307

 Score =  227 bits (578), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 199/302 (65%), Positives = 245/302 (81%), Gaps = 3/302 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           P+HF DLS +S++ L  +I+ A   + +  +   ++PL+GK+LAMIFEKPSTRTRVSF+V
Sbjct: 9   PRHFLDLSAVSAAELRAMIDAA---RAAKSSSGGDRPLAGKMLAMIFEKPSTRTRVSFDV 65

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M+ LGG+T+FLSG+EMQLGRAETI DTAKVLSRYVD I++RT +H R+LEL E+ATVPV
Sbjct: 66  GMRQLGGETLFLSGTEMQLGRAETIADTAKVLSRYVDIIMIRTMDHERMLELAEHATVPV 125

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALTD+THPCQI+ADI+TFEEHRG +KGK  +W+GDGNN+LHSL+EGA RF Y + IAT
Sbjct: 126 INALTDDTHPCQIMADILTFEEHRGPIKGKTLAWTGDGNNVLHSLVEGAGRFGYRMQIAT 185

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P GSEP   +++WAR QGA + L  D  +A  GA C+ TDTW+SMNQE KAR  +VF P+
Sbjct: 186 PEGSEPDMRFVDWARAQGAEIDLSADPERAASGADCIITDTWVSMNQEHKARGHNVFLPY 245

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QVN  LM+ A+ DALFMHCLPAHRGEEV NEV+DGPQSVVFDEAENRLH QKAI+ WC G
Sbjct: 246 QVNEDLMAKANKDALFMHCLPAHRGEEVTNEVMDGPQSVVFDEAENRLHAQKAIMRWCMG 305

Query: 305 II 306
            +
Sbjct: 306 AL 307


>gi|304312845|ref|YP_003812443.1| Ornithine carbamoyltransferase [gamma proteobacterium HdN1]
 gi|301798578|emb|CBL46808.1| Ornithine carbamoyltransferase [gamma proteobacterium HdN1]
          Length = 305

 Score =  227 bits (578), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 150/300 (50%), Positives = 193/300 (64%), Gaps = 4/300 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L++ S   L  I+  A ++K         +P   KVL MIFEK STRTRVSFE A
Sbjct: 4   RHFLTLNDFSPEELRGILARAIELKKMLREGTPYEPFKNKVLGMIFEKSSTRTRVSFESA 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M   GG  +FLS  + QLGR E + DTA+VLSR VD I++RT  H ++    +Y+ VPVI
Sbjct: 64  MIQCGGGALFLSPRDTQLGRGEPLSDTARVLSRMVDIIMIRTFEHEKVETFAQYSQVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+ HPCQ++AD+ TF EHRG ++GK  +W GDGNN+ +S +  A +F + LNIA P
Sbjct: 124 NALTDSFHPCQLLADMQTFVEHRGDIRGKTVTWVGDGNNMCNSYMNAARQFGFHLNIACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQPF 244
            G EP    L    N  A V L HD   AV+ +H V TD W SM QE + +     F  +
Sbjct: 184 PGFEPDAAVL---ANNQAHVTLMHDPKAAVRASHLVVTDVWASMGQEQEQQARIAAFANY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QV+ +LM +A  DALFMHCLPAHRGEEV  E+LD P++VV+DEAENRLH QKA++    G
Sbjct: 241 QVSPALMDLAADDALFMHCLPAHRGEEVSAEMLDDPRAVVWDEAENRLHAQKALMEVLLG 300


>gi|148656527|ref|YP_001276732.1| ornithine carbamoyltransferase [Roseiflexus sp. RS-1]
 gi|148568637|gb|ABQ90782.1| ornithine carbamoyltransferase [Roseiflexus sp. RS-1]
          Length = 313

 Score =  227 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 138/313 (44%), Positives = 190/313 (60%), Gaps = 11/313 (3%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK------PLSGKVLAMIFEKPSTR 57
             +HF   ++++ +    +++ A+ +K    N    +      PL GK LA++FEKPS R
Sbjct: 1   MVRHFLSAADLTRTEAEALLDRAQALKAEWRNGGHARDANGALPLQGKTLALVFEKPSLR 60

Query: 58  TRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELT 117
           TRV+FE  M  LGG   +LS +++ +G  E++ D A+ LSR+V AI  R   H+ +  L 
Sbjct: 61  TRVAFEAGMTQLGGHGSYLSANDIDMGGRESVPDVARNLSRWVHAIAARVFRHATVETLA 120

Query: 118 EYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFN 177
            YATVPVINAL+D  HPCQ +AD++T  EH G + G   ++ GDGNN+ HSL+   A   
Sbjct: 121 RYATVPVINALSDREHPCQALADMLTLREHYGRLAGLTLAYVGDGNNVAHSLMLLGATLG 180

Query: 178 YLLNIATPIGSEPRNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEF 233
             + I  P    P  E L  A        AS+ +    V+AV+GA  V+TD W SM QE 
Sbjct: 181 MNIRIGCPPDYRPDPEILTLAERLAAEHNASIWITPSPVEAVEGADAVYTDVWASMGQEH 240

Query: 234 KA-REEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRL 292
           +A R   +FQP+QVN  LM+ A   ALFMHCLPAHRGEEV  +V+DG QSVVF++AENRL
Sbjct: 241 EAARRRPIFQPYQVNALLMTHARSGALFMHCLPAHRGEEVTADVIDGSQSVVFEQAENRL 300

Query: 293 HTQKAILLWCFGI 305
           H QKA++L   G+
Sbjct: 301 HVQKALILTLLGL 313


>gi|167045396|gb|ABZ10051.1| putative aspartate/ornithine carbamoyltransferase, carbamoyl-P
           binding domain protein [uncultured marine crenarchaeote
           HF4000_APKG10F15]
          Length = 304

 Score =  227 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 147/303 (48%), Positives = 189/303 (62%), Gaps = 1/303 (0%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M    K    +  ISS     +I+ + K+K  ++ + E   L  K LAM+FEKPSTRTRV
Sbjct: 1   MKLKTKDLLTVDEISSKEFLELIDFSIKLKKENKTVKEKPLLKNKTLAMLFEKPSTRTRV 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFE+ M  LGG T+ LS +EMQ  R E++ DTAK LSRYVDAIV R   HS + +L ++A
Sbjct: 61  SFEIGMLQLGGHTVNLSLNEMQHSRGESVEDTAKTLSRYVDAIVARVYEHSFIEKLAKHA 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVIN L+++ HPCQ +AD+MT +EH+   K    +W GDGNN+ +SLI G ++    +
Sbjct: 121 TVPVINGLSNSYHPCQTLADLMTIKEHKKKFKDLKIAWIGDGNNVCNSLIFGCSKTQTQI 180

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            IATP G EP  E +  +           D   AVK A  V TDT+ S++     R E  
Sbjct: 181 VIATPKGFEPNPEVVKKSSKYTVVDL-TTDPKSAVKDADIVMTDTFTSIHMSDLKRTEKF 239

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
              FQVN SLM  A  DA+FMHCLPA R +EV + V+DGPQSVV+DEAENRLHTQKA+LL
Sbjct: 240 LPSFQVNDSLMEKAKNDAIFMHCLPAKREQEVTSSVIDGPQSVVWDEAENRLHTQKALLL 299

Query: 301 WCF 303
              
Sbjct: 300 SLL 302


>gi|254429913|ref|ZP_05043620.1| ornithine carbamoyltransferase [Alcanivorax sp. DG881]
 gi|196196082|gb|EDX91041.1| ornithine carbamoyltransferase [Alcanivorax sp. DG881]
          Length = 302

 Score =  227 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 153/303 (50%), Positives = 205/303 (67%), Gaps = 6/303 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT  +HF  L++++   L  +I+ A ++K    N   ++PL GK L MIFEK STRTRVS
Sbjct: 1   MT--RHFLTLTDLTPDELGYLIQRAIELKTMLRNGQHHEPLQGKTLGMIFEKSSTRTRVS 58

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FEVAM H GG +IFLS  + QLGR E I D+A+VLSR VDA+++RT +H+ L    +++ 
Sbjct: 59  FEVAMTHFGGSSIFLSPRDTQLGRGEPIEDSARVLSRMVDAVMIRTFDHATLQTFADHSA 118

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVINALTD+ HPCQ++AD+ T+ EHRGS++GK   W GDGNN+  S I  A +F++ L 
Sbjct: 119 VPVINALTDDFHPCQLLADMQTYVEHRGSIQGKKVVWVGDGNNMCASYINAANQFDFELV 178

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHV 240
           I++P G  P ++ L         V+L  D   AV+GAH V TD W SM QE + +   + 
Sbjct: 179 ISSPDGFTPDSDLLGR---YPDRVSLEPDVATAVQGAHLVVTDVWASMGQEDEQQTRLNA 235

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F  +QV   LM  A PDALFMHCLPAHRGEEV +E++D P++VV+DEAENRLH QKA+L 
Sbjct: 236 FDGYQVTPELMDRADPDALFMHCLPAHRGEEVSHEMMDDPRAVVWDEAENRLHAQKALLE 295

Query: 301 WCF 303
           +  
Sbjct: 296 FLL 298


>gi|88602403|ref|YP_502581.1| ornithine carbamoyltransferase [Methanospirillum hungatei JF-1]
 gi|121697661|sp|Q2FPP7|OTC_METHJ RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|88187865|gb|ABD40862.1| ornithine carbamoyltransferase [Methanospirillum hungatei JF-1]
          Length = 302

 Score =  227 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 139/301 (46%), Positives = 183/301 (60%), Gaps = 1/301 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K F  + +IS   L+ +I  A+K+K       +   L+ K L MIFEK STRTR+SFE
Sbjct: 1   MKKDFISILDISREELANLIAHARKLKEERRVGIQTPVLAHKTLGMIFEKSSTRTRISFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
             M  LGG  +FL+  +MQLGR E I DTA+V+SR+V AI++R   H  +LEL  +A +P
Sbjct: 61  AGMFELGGHALFLNPKDMQLGRGEAIRDTARVMSRFVSAIMIRANRHDEVLELAAHADIP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN L+D  HPCQI+ADIMT EE     +G   +W GDGNN+  SLI         + +A
Sbjct: 121 VINGLSDREHPCQILADIMTIEERLFRTEGVKVAWIGDGNNVCTSLILSTILTGMEVIVA 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQ 242
           +P    P  + ++ A   GA V +  D  +A  GA  V TDTWISM QE +  R   +F 
Sbjct: 181 SPSEFAPGEDVVSEALRMGAKVRIVTDPREAATGADVVMTDTWISMGQEEEIDRRRQIFM 240

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           P+QVN  LM+ A P A+ MHCLPAHR  E+ +EVLD   S V+D+AENRLH QKA+L+  
Sbjct: 241 PYQVNAELMACAKPGAIVMHCLPAHRNWEITDEVLDSKASAVWDQAENRLHAQKALLVRL 300

Query: 303 F 303
            
Sbjct: 301 L 301


>gi|108805675|ref|YP_645612.1| ornithine carbamoyltransferase [Rubrobacter xylanophilus DSM 9941]
 gi|108766918|gb|ABG05800.1| ornithine carbamoyltransferase [Rubrobacter xylanophilus DSM 9941]
          Length = 317

 Score =  226 bits (576), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 144/300 (48%), Positives = 188/300 (62%), Gaps = 1/300 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +    L+  S   +  I++ A KIK   +     +PL G+ LAM+F+KPS RTRVSFEV 
Sbjct: 18  RDCLTLAEFSPQEVRLILDEAVKIKGLQKARIPYRPLRGRTLAMVFQKPSNRTRVSFEVG 77

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  + LS  E+Q+G+ E+  DT KVL+RY+DAI++RT +H+ L EL   A VPVI
Sbjct: 78  MYQLGGHALSLSPQEIQMGKRESPSDTGKVLTRYIDAIMVRTFDHAELEELAAAAEVPVI 137

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ +AD++T  E  G V+G   ++ GDGNN+ HSL  G A     L+IA P
Sbjct: 138 NGLTDTHHPCQALADLLTVREQFGRVEGTKIAYVGDGNNVAHSLAIGCALTGARLSIAHP 197

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQPF 244
            G  P  + +  +   G    L  D  +AV GA  V+TD W SM QE +A      F P+
Sbjct: 198 EGHGPDGKVVRLSAELGEPPKLTQDPEEAVAGAQVVYTDVWASMGQEAEAEERRKRFAPY 257

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QV+  LMS+A  DA+F+HCLPAHRGEEV   V+DGP+S VFD+AENRLH QKA+L    G
Sbjct: 258 QVDERLMSLAADDAIFLHCLPAHRGEEVAASVIDGPRSRVFDQAENRLHAQKALLYLLLG 317


>gi|167044180|gb|ABZ08862.1| putative aspartate/ornithine carbamoyltransferase, carbamoyl-P
           binding domain protein [uncultured marine crenarchaeote
           HF4000_APKG5E24]
 gi|167044478|gb|ABZ09153.1| putative aspartate/ornithine carbamoyltransferase, carbamoyl-P
           binding domain protein [uncultured marine crenarchaeote
           HF4000_APKG6J21]
          Length = 304

 Score =  226 bits (576), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 146/303 (48%), Positives = 188/303 (62%), Gaps = 1/303 (0%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M    K    +  ISS     +I+ + K+K  ++ + E   L  K LAM+F KPSTRTRV
Sbjct: 1   MKLKTKDLLTVDEISSKEFLELIDFSIKLKKENKTVKEKPLLKNKTLAMLFGKPSTRTRV 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFE+ M  LGG T+ LS +EMQ  R E++ DTAK LSRYVDAIV R   HS + +L ++A
Sbjct: 61  SFEIGMLQLGGHTVNLSLNEMQHSRGESVEDTAKTLSRYVDAIVARVYEHSFIEKLAKHA 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVIN L+++ HPCQ +AD+MT +EH+   K    +W GDGNN+ +SLI G ++    +
Sbjct: 121 TVPVINGLSNSYHPCQTLADLMTIKEHKKKFKDLKIAWIGDGNNVCNSLIFGCSKTQTQI 180

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            IATP G EP  E +  +           D   AVK A  V TDT+ S++     R E  
Sbjct: 181 VIATPKGFEPNPEVVKKSSKYTVVDL-TTDPKSAVKDADIVMTDTFTSIHTSDPKRTEKF 239

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
              FQVN SLM  A  DA+FMHCLPA R +EV +EV+DG QSVV+DEAENRLHTQKA+LL
Sbjct: 240 LPSFQVNQSLMEKAKNDAIFMHCLPAKRDQEVTSEVIDGSQSVVWDEAENRLHTQKALLL 299

Query: 301 WCF 303
              
Sbjct: 300 SLL 302


>gi|154250859|ref|YP_001411683.1| ornithine carbamoyltransferase [Parvibaculum lavamentivorans DS-1]
 gi|154154809|gb|ABS62026.1| ornithine carbamoyltransferase [Parvibaculum lavamentivorans DS-1]
          Length = 313

 Score =  226 bits (576), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 172/312 (55%), Positives = 226/312 (72%), Gaps = 10/312 (3%)

Query: 2   MTY---PKHFADLSNISSSNLSCIIEVAKKIKNSSEN-----IFENKPLSGKVLAMIFEK 53
           MT    P+HF DL  ++  +L  I+E +KK K +           ++PL G++LAMIFEK
Sbjct: 1   MTRAANPRHFLDLDGVAPVDLRSILESSKKRKQARNGKGQAVPDSDRPLDGRLLAMIFEK 60

Query: 54  PSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRL 113
           PSTRTRVSF+VAM+ LGG+T+ L+G + QLGR ETI DTA+VLSRYVDAI++RTT+H  L
Sbjct: 61  PSTRTRVSFDVAMRQLGGETLLLNGGDTQLGRGETIADTARVLSRYVDAIMIRTTDHEHL 120

Query: 114 LELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGA 173
            EL E+ATVPVIN LT+ +HPCQI+AD+MTFEEH+G +KG+  +W GDGNN++ S I+ A
Sbjct: 121 TELAEHATVPVINGLTNRSHPCQIMADVMTFEEHKGPIKGRRVAWVGDGNNVVTSWIQAA 180

Query: 174 ARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF 233
           A+  + L IA P    P  E L+WA+++GAS+ +  D  +AVK A CV TDTW+SM    
Sbjct: 181 AQLEFELRIACPPELSPVPEALDWAKSKGASIIVTTDPFEAVKDADCVNTDTWVSMGDSV 240

Query: 234 K--AREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENR 291
           +  AR  ++  P+QV+  LM+ A  DA+FMHCLPAHRGEE+  +V+DGP SVVFDEAENR
Sbjct: 241 ETAARRHNLLAPYQVDARLMAAAGKDAIFMHCLPAHRGEEMTVDVIDGPASVVFDEAENR 300

Query: 292 LHTQKAILLWCF 303
           LH QK +L WCF
Sbjct: 301 LHAQKGVLAWCF 312


>gi|78484877|ref|YP_390802.1| ornithine carbamoyltransferase [Thiomicrospira crunogena XCL-2]
 gi|123555875|sp|Q31I95|OTC_THICR RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|78363163|gb|ABB41128.1| ornithine carbamoyltransferase [Thiomicrospira crunogena XCL-2]
          Length = 302

 Score =  226 bits (575), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 134/298 (44%), Positives = 185/298 (62%), Gaps = 2/298 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF  L + S + L  ++  A ++K   ++    +PL  K LAMIFEK STRTR+SFE+ 
Sbjct: 4   KHFLTLQDFSPAELKQLMLRAIELKKIQKSGEIFEPLKNKTLAMIFEKSSTRTRISFEIG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLS  + QLGR E I DTAKV+S   D I++RT  H  + ++ E++ VPVI
Sbjct: 64  MSQLGGHALFLSPRDTQLGRGEPIEDTAKVISSMADGIMIRTFGHEVVEKMAEHSQVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+ HPCQ++AD+ T+ EHRGS++GK   W GDGNN+ HS I  A ++ + L I+ P
Sbjct: 124 NALTDDYHPCQLLADMQTYYEHRGSIEGKTVLWVGDGNNMCHSYINAAKQYGFKLRISAP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
              +P    +   +     +    DA + V         +     +E + + E  F+ +Q
Sbjct: 184 EDYDPNPRIVEANQEYVEMIRNPMDAAENVDLIVTDVWASM--GQEEEQKKREKAFKDYQ 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN ++M  A+PDALFMHCLPAHRGEEV  EV+D   SVV+DEAENRLH QKA+L +  
Sbjct: 242 VNTAMMQQANPDALFMHCLPAHRGEEVSAEVMDAEDSVVWDEAENRLHAQKALLEYLM 299


>gi|255264870|ref|ZP_05344212.1| ornithine carbamoyltransferase [Thalassiobium sp. R2A62]
 gi|255107205|gb|EET49879.1| ornithine carbamoyltransferase [Thalassiobium sp. R2A62]
          Length = 308

 Score =  226 bits (575), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 164/308 (53%), Positives = 218/308 (70%), Gaps = 7/308 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFEN-----KPLSGKVLAMIFEKPSTRTR 59
             HF D+   + S+L  II+ A+ IK++     ++     +PL+G ++A+IFEKPSTRTR
Sbjct: 1   MTHFLDIHKTNPSDLRQIIDTARDIKDARHGRPKSALDDDQPLAGHMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V ++ +GG T+ LSG++MQLG  ETI DTA+VLSRYVD I++RT + S L E+ EY
Sbjct: 61  VSFDVGVRQMGGQTMVLSGADMQLGHGETIADTARVLSRYVDLIMIRTFDESVLTEMAEY 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           A VPVIN LTD THPCQI+AD+MT+EEHRG + GK   W+GDGNN+  S +  AA+F + 
Sbjct: 121 ADVPVINGLTDRTHPCQIMADVMTYEEHRGPIAGKKVVWTGDGNNVCASFLHAAAQFKFD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L  A P   +P  E++  AR+ G  +++  DA +AV+GA  V  DTW+SM+    ARE  
Sbjct: 181 LTFAGPSQLDPEGEFVKLARDAGCKISIERDADKAVQGADLVVADTWVSMHDAQSARERR 240

Query: 240 VFQ--PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
                P+QVN +LM+ A PDALFMHCLPAHR EEV +EV+DGPQSV+FDEAENRLH QKA
Sbjct: 241 HNMLRPYQVNAALMAQAEPDALFMHCLPAHREEEVTSEVMDGPQSVIFDEAENRLHAQKA 300

Query: 298 ILLWCFGI 305
           I+ +C G 
Sbjct: 301 IMKFCLGK 308


>gi|85859273|ref|YP_461475.1| ornithine carbamoyltransferase [Syntrophus aciditrophicus SB]
 gi|123516497|sp|Q2LT98|OTC_SYNAS RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|85722364|gb|ABC77307.1| ornithine carbamoyltransferase [Syntrophus aciditrophicus SB]
          Length = 302

 Score =  226 bits (575), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 136/301 (45%), Positives = 190/301 (63%), Gaps = 2/301 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K    + ++ + +   I E A+ +K+  E      PL GK L MIF+K STRTR+SFE
Sbjct: 1   MKKDLLSIYDLEAGDFKAIFEKARHLKSVHEQGVAYTPLKGKTLGMIFDKSSTRTRISFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M  LGG  +FLS  + QLGR ET+ D+A+++SRY++ I++RT +H  + E   +AT+P
Sbjct: 61  VGMYQLGGLALFLSNRDTQLGRGETVADSARIMSRYLNGIMIRTFSHLIIEEFAAHATIP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQI++D+ T  E +GS +     + GDGNNI +S I  AAR  + L ++
Sbjct: 121 VINGLTDLLHPCQILSDLFTIIEKKGSYERLKIVYVGDGNNIANSWINAAARLPFHLALS 180

Query: 184 TPIGSEPRNEYLNW-ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVF 241
            P G +P +  L+   +     V+L  D  +AV+ A  V+TD W SM QE +      VF
Sbjct: 181 CPEGYDPDSGILDRGVKEAKEGVSLMRDPYEAVRNADVVYTDVWASMGQEAEQEARARVF 240

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           +P+Q+N +L+S A  DA+ MHCLPAHRGEE+   VLDGP+SV+ D+AENRLH QKAIL  
Sbjct: 241 RPYQINEALLSPAKKDAIVMHCLPAHRGEEITAAVLDGPRSVIIDQAENRLHVQKAILEI 300

Query: 302 C 302
            
Sbjct: 301 L 301


>gi|114320260|ref|YP_741943.1| ornithine carbamoyltransferase [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226654|gb|ABI56453.1| ornithine carbamoyltransferase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 303

 Score =  226 bits (575), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 146/301 (48%), Positives = 195/301 (64%), Gaps = 4/301 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
           +P+HF  L + +   L  +I  A ++K+  +    ++PL GKVL M+FEK STRTRV+FE
Sbjct: 2   HPRHFLTLLDFTPDELRRVIHRASELKHIRDQGQLHEPLRGKVLGMVFEKSSTRTRVAFE 61

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
             M  LGG  IFLS  + QLGR E + DTA+VLSR VD I++RT  H  L    EY+ VP
Sbjct: 62  AGMNQLGGSAIFLSPRDTQLGRGEPVEDTARVLSRMVDIIMIRTYGHEVLERFAEYSRVP 121

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN L+D  HPCQ++ADI  +E HRGS++G+  +W GDGNN+ HS I  A + ++ L IA
Sbjct: 122 VINGLSDRFHPCQLLADIQAYEAHRGSIQGRTVAWVGDGNNMCHSWINAARQLDFQLRIA 181

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQ 242
            P G +P  + +      G  V++  D  +AV+G H V TD W SM QE +A+     F 
Sbjct: 182 VPEGYDPDPDLI---HAGGDRVSVHRDPREAVEGVHLVTTDVWASMGQEEEAKARMKAFS 238

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            F V+ +LM +A  DA+FMHCLPAHRGEEV   V+DGPQSVV+DEAENRLH  KA++ + 
Sbjct: 239 GFCVDDALMGLAAKDAVFMHCLPAHRGEEVSASVIDGPQSVVWDEAENRLHAHKALMEFL 298

Query: 303 F 303
            
Sbjct: 299 L 299


>gi|269467874|gb|EEZ79617.1| ornithine carbamoyltransferase [uncultured SUP05 cluster bacterium]
          Length = 299

 Score =  226 bits (575), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 137/303 (45%), Positives = 197/303 (65%), Gaps = 4/303 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT  KHF +L+++S+++L  II+ A  +K   ++   N  L  K LAMIF+K STRTRVS
Sbjct: 1   MT--KHFINLNDLSNNDLQQIIDQAIALKKQHKSGEINNALQNKTLAMIFDKSSTRTRVS 58

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  +FLS  ++QLGR E I D+A V+S  VDAI+MR ++H  +   +++++
Sbjct: 59  FEAGMTQLGGHALFLSDRDIQLGRGEPIIDSAIVISSMVDAIMMRVSSHDDITTFSQHSS 118

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VP+INAL+D +HPCQ++AD+MT++E+ GS+KGK  +W GDGNN+ H+ ++ A  F + LN
Sbjct: 119 VPIINALSDESHPCQLLADMMTYQEYNGSIKGKTVAWIGDGNNMCHTYMQAAKAFGFTLN 178

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           IATP G EP   +++   +     A    A             +     +  + + E  F
Sbjct: 179 IATPKGYEPEQSFVSQYADFINLCADAQTACDNADLVVTDVWASM--GQESEQTKRETAF 236

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           + FQVN +LM  A  +A+FMHCLPAHRGEEV   V+DG QS+V++EAENRLH QKA+LL+
Sbjct: 237 KDFQVNTALMESAKSNAIFMHCLPAHRGEEVSANVIDGKQSLVWNEAENRLHAQKALLLF 296

Query: 302 CFG 304
             G
Sbjct: 297 LLG 299


>gi|169830551|ref|YP_001716533.1| ornithine carbamoyltransferase [Candidatus Desulforudis audaxviator
           MP104C]
 gi|169637395|gb|ACA58901.1| ornithine carbamoyltransferase [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 309

 Score =  225 bits (574), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 145/309 (46%), Positives = 198/309 (64%), Gaps = 7/309 (2%)

Query: 2   MT--YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    + F  + + S S L  +  +A+ +K        +   +GK LAMIF+KPSTRTR
Sbjct: 1   MTSLKGRDFLSILDFSVSELEAVFSLARDLKRKQRAGEAHPLCAGKTLAMIFQKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSFE  M  LGG  ++L+ +++QLGR ET+ DTA+VLSRYVD I++RT   S + EL  +
Sbjct: 61  VSFEAGMFQLGGHALYLNAADLQLGRGETVADTARVLSRYVDGIMIRTFKQSDVEELAAH 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           A VPVIN LTD  HPCQI+AD +T  EH+G + G   ++ GDGNN+ HSL+ G AR    
Sbjct: 121 AEVPVINGLTDWEHPCQILADFLTILEHKGRLAGLKLAYVGDGNNVAHSLLLGGARLGMR 180

Query: 180 LNIATPIGSEPRNEYLN----WARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA 235
           + +++P G EP  + ++     A   G +V L  D   AV+ A  V TDTW SM +E + 
Sbjct: 181 VAVSSPRGYEPAPDLVSRAAAEAVRTGGAVELTTDPAAAVRDADVVVTDTWASMGRESEH 240

Query: 236 R-EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHT 294
                 F P+QVN +L++ A PD +FMHCLPAHRGEEV++ V+DGP+SV++DEAENRLH 
Sbjct: 241 SARVKAFAPYQVNEALVAHARPDYIFMHCLPAHRGEEVVDAVMDGPRSVIWDEAENRLHV 300

Query: 295 QKAILLWCF 303
           QKA+L    
Sbjct: 301 QKALLALVL 309


>gi|312135339|ref|YP_004002677.1| ornithine carbamoyltransferase [Caldicellulosiruptor owensensis OL]
 gi|311775390|gb|ADQ04877.1| ornithine carbamoyltransferase [Caldicellulosiruptor owensensis OL]
          Length = 308

 Score =  225 bits (574), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 136/308 (44%), Positives = 204/308 (66%), Gaps = 6/308 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            +HF  L+++S  ++  ++E+A ++K  ++  F    L  K L +IF K STRTRVSFEV
Sbjct: 1   MRHFLHLNDLSKEDILYLVELASRLKKEAKKGFYFPYLKNKALGLIFTKASTRTRVSFEV 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG +++L  +++QLGR ETI DTAKVLSRY+D IV+RT     + E  +Y+++PV
Sbjct: 61  GIHQLGGYSLYLGKNDLQLGRGETIEDTAKVLSRYLDLIVIRTYEQKEVEEFAKYSSIPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD+ HP QIIAD  T  E +G +     ++ GDGNN+  +L+ GA++    + +AT
Sbjct: 121 INGLTDDYHPTQIIADFQTIFEEKGRLSNLKIAYVGDGNNVAATLLVGASKLGLDIAVAT 180

Query: 185 PIGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEH 239
           P G E + E +++    A+   ++V   +   +AVK A  V+TDTW+SM QE +  +   
Sbjct: 181 PAGYEIKKEVVDFALDEAKKSKSNVIFTNSPKEAVKDADVVYTDTWVSMGQEEEKEKRIR 240

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ +QV+ SL+ +A  DA+F+HCLPA+RG EV +EV+DGPQS VF+EAENRLH+ KAI+
Sbjct: 241 DFEGYQVDSSLLRLAKDDAIFLHCLPAYRGFEVTSEVIDGPQSRVFEEAENRLHSHKAIM 300

Query: 300 LWC-FGII 306
           ++   G I
Sbjct: 301 IFVYLGKI 308


>gi|258511211|ref|YP_003184645.1| ornithine carbamoyltransferase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257477937|gb|ACV58256.1| ornithine carbamoyltransferase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 355

 Score =  225 bits (574), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 133/303 (43%), Positives = 194/303 (64%), Gaps = 5/303 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K     S++S  +L  ++ +A+ +K + ++ F +  L+GK L MIF+K STRTR+SFEV 
Sbjct: 43  KDLLHFSDLSGDDLRNLVHLAELLKEAQKSRFTHTLLAGKTLGMIFDKSSTRTRISFEVG 102

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FL G+ +Q GR E I DTA+V+SRY+D +++RT     + E  +YA +PVI
Sbjct: 103 MLQLGGHALFLPGNMLQTGRGEPISDTARVMSRYLDGVMIRTFRQQDVEEFAKYADIPVI 162

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ++AD +T  EH+G ++G   ++ GDGNN+ HS ++ A +    + +ATP
Sbjct: 163 NGLTDEFHPCQLLADALTILEHKGRLEGITVAFIGDGNNLAHSWLQLAPKLGMNIRVATP 222

Query: 186 IGSEPRNEYLNWARNQGASVAL----FHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HV 240
            G +P    +  A+              D  +A++GA  V+TDTW+SM  E +A E    
Sbjct: 223 PGYQPMQWVVEEAKLHAVQQGTEVLVTTDPERAIEGADVVYTDTWVSMGDEEEAEERLKH 282

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+ +QVN  L ++A PD +FMHCLPAHRGEEV  +V+DGP S++FD+AENRLH QKA+L 
Sbjct: 283 FEGYQVNEKLCALAKPDYVFMHCLPAHRGEEVSPDVIDGPHSIIFDQAENRLHAQKAVLA 342

Query: 301 WCF 303
              
Sbjct: 343 ATM 345


>gi|159043348|ref|YP_001532142.1| ornithine carbamoyltransferase [Dinoroseobacter shibae DFL 12]
 gi|157911108|gb|ABV92541.1| ornithine carbamoyltransferase [Dinoroseobacter shibae DFL 12]
          Length = 308

 Score =  225 bits (574), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 152/308 (49%), Positives = 213/308 (69%), Gaps = 7/308 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFE-----NKPLSGKVLAMIFEKPSTRTR 59
             HF D+     ++L  +++  + +K +     +     ++PL+G ++A+IFEKPSTRTR
Sbjct: 1   MTHFLDIHTTDPADLRAMLDRGRAMKTARAGRPKGASDDDQPLAGHMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF++ ++ +GG T+ LSG++MQLG  ETI DTA+VLSRYVD I++RT   + LLE+ E+
Sbjct: 61  VSFDLGVRQMGGQTMVLSGADMQLGHGETIADTARVLSRYVDLIMIRTFEETTLLEMAEH 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           A+VPVIN LT+ THPCQI+AD+MT+EEHRG + GK   W GDGNN+  S +  A +F + 
Sbjct: 121 ASVPVINGLTNRTHPCQIMADVMTYEEHRGPIAGKKVVWCGDGNNVCASFLHAAGQFGFD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKARE 237
           +    P   +P  E++  AR +G +V +  D   AV+GA  V  DTW+SM+  Q  K R 
Sbjct: 181 MTFTGPPTLDPEAEFVAGARAKGVTVEIERDPAVAVQGADLVVADTWVSMHDSQTTKERR 240

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
            +  +P+QV+ +LM  A PDALFMHCLPAHRGEEV +EV+DGP SV+FDEAENRLH QKA
Sbjct: 241 HNQLRPYQVDRALMEKAKPDALFMHCLPAHRGEEVTSEVMDGPHSVIFDEAENRLHAQKA 300

Query: 298 ILLWCFGI 305
           ++ WC G+
Sbjct: 301 VMRWCLGV 308


>gi|320352649|ref|YP_004193988.1| ornithine carbamoyltransferase [Desulfobulbus propionicus DSM 2032]
 gi|320121151|gb|ADW16697.1| ornithine carbamoyltransferase [Desulfobulbus propionicus DSM 2032]
          Length = 306

 Score =  225 bits (574), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 139/296 (46%), Positives = 192/296 (64%), Gaps = 2/296 (0%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAM 66
           H   L + +   L  +I+ A ++K  S+    ++ L+G+ + ++FEKPSTRTRVSFE AM
Sbjct: 4   HLLALGDFTQEELRALIDRALELKAESKQGVRHQQLAGRKICLLFEKPSTRTRVSFEAAM 63

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
             LGG  IF+S  E QLGR E + DTA+VLSRYVDAIV+RT     + EL  YATVPVIN
Sbjct: 64  YGLGGQVIFMSTKESQLGRGEPLKDTARVLSRYVDAIVVRTFGQGVVEELARYATVPVIN 123

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI 186
           ALTD  HPCQ+++D+MT  E +G++      W GDGNN+ +S IE A+ F + L +A P 
Sbjct: 124 ALTDLHHPCQVLSDLMTVIEKKGTLDKTKTVWIGDGNNMANSWIEAASVFGFPLTLACPA 183

Query: 187 GSEPRNEYLNWARNQGA-SVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
           G  P    L  AR +    + +  D  +A++GA  +  D W SM QE +  +   VF+ +
Sbjct: 184 GFSPNETILEKARVRSPLPIVVLRDPAEAIRGAAVINVDVWASMGQEAEQEQRLGVFRDY 243

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           Q++ +L++ A  DA+ +HCLPAHRGEEV  EVL+GPQSVVFD+AEN++H   AIL 
Sbjct: 244 QLDSALLAKADKDAIVLHCLPAHRGEEVTEEVLEGPQSVVFDQAENKMHIHAAILE 299


>gi|218289855|ref|ZP_03494045.1| ornithine carbamoyltransferase [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218239995|gb|EED07181.1| ornithine carbamoyltransferase [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 355

 Score =  225 bits (574), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 133/303 (43%), Positives = 194/303 (64%), Gaps = 5/303 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K     S++S  +L  ++ +A+ +K + ++ F +  L+GK L MIF+K STRTR+SFEV 
Sbjct: 43  KDLLHFSDLSGDDLRNLVHLAELLKEAQKSRFTHTLLAGKTLGMIFDKSSTRTRISFEVG 102

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FL G+ +Q GR E I DTA+V+SRY+D +++RT     + E  +YA +PVI
Sbjct: 103 MLQLGGHALFLPGNMLQTGRGEPISDTARVMSRYLDGVMIRTFRQQDVEEFAKYADIPVI 162

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ++AD +T  EH+G ++G   ++ GDGNN+ HS ++ A +    + +ATP
Sbjct: 163 NGLTDEFHPCQLLADALTILEHKGRLEGITVAFIGDGNNLAHSWLQLAPKLGMDIRVATP 222

Query: 186 IGSEPRNEYLNWARNQGASVAL----FHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HV 240
            G +P    +  A+              D  +A++GA  V+TDTW+SM  E +A E    
Sbjct: 223 PGYQPMQWVVEEAKLHAVQQGTEVLVTTDPERAIEGADVVYTDTWVSMGDEEEAEERLKH 282

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+ +QVN  L ++A PD +FMHCLPAHRGEEV  +V+DGP S++FD+AENRLH QKA+L 
Sbjct: 283 FEGYQVNEKLCALAKPDYVFMHCLPAHRGEEVSPDVIDGPHSIIFDQAENRLHAQKAVLA 342

Query: 301 WCF 303
              
Sbjct: 343 ATM 345


>gi|34558060|ref|NP_907875.1| ornithine carbamoyltransferase [Wolinella succinogenes DSM 1740]
 gi|56749127|sp|Q7M8B5|OTC_WOLSU RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|34483778|emb|CAE10775.1| ORNITHINE CARBAMOYLTRANSFERASE [Wolinella succinogenes]
          Length = 307

 Score =  225 bits (574), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 134/303 (44%), Positives = 197/303 (65%), Gaps = 6/303 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            +HF  L + S+  +  I+ ++K+IK+  +       + GKVL MIFEK STRTRVSFE 
Sbjct: 1   MRHFLTLKDFSAQEILEILALSKEIKDDLKKGIRPPLMQGKVLGMIFEKSSTRTRVSFES 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG  +FLS  ++QLGR E + DTA+V+SR VD +++RT+ H R+ E  +Y+ VPV
Sbjct: 61  GIYQLGGMGMFLSNRDIQLGRGEPMKDTARVISRMVDMVMIRTSGHERIEEFAKYSQVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           +N LTD+ HP Q++AD +T    +G  +  + ++ GDGNN+ HS +  A++  + L +AT
Sbjct: 121 VNGLTDSYHPVQLMADYLTM-MEQGKDQNPIVAYVGDGNNMTHSWLMLASKLGFELRVAT 179

Query: 185 PIGSEPRNEYLNWARNQGA----SVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEH 239
           P G EP  +    A+   +     + L +D  +AV+GA  V TDTW SM QE +  +   
Sbjct: 180 PRGYEPNLKIFEEAQKIASLSGAKITLTNDPKRAVEGADVVTTDTWASMGQEEEKEKRAR 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            FQ + V+ +LM +A  DA+F+HCLPA+RG+EV  EVL+GPQS++FDEAENRLH QK I+
Sbjct: 240 DFQGYCVDSALMGLAKSDAIFLHCLPAYRGQEVSEEVLEGPQSLIFDEAENRLHVQKGIM 299

Query: 300 LWC 302
           +W 
Sbjct: 300 VWL 302


>gi|319403590|emb|CBI77175.1| Ornithine carbamoyltransferase [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 313

 Score =  225 bits (574), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 186/297 (62%), Positives = 238/297 (80%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAM 66
           HF D+S ++      +I+ AK +K + ++    KP SGK LAMIFEKPSTRTRVSF++ M
Sbjct: 7   HFTDISILTPQRARALIDYAKILKAAFKSGENLKPFSGKTLAMIFEKPSTRTRVSFDLGM 66

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
           + LGG+TI L+GSEMQLG +ETI DTA+VLSR+V+AI++RTT H R+LEL +YA +PVIN
Sbjct: 67  RQLGGETIMLTGSEMQLGHSETIADTARVLSRFVEAIIIRTTAHHRMLELAQYAQIPVIN 126

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI 186
           ALTD+THPCQI+ADI+T+EEHRG++ GK F+W GDGNN+LHSLIE  A FN+ L+IATP 
Sbjct: 127 ALTDDTHPCQILADILTYEEHRGTIAGKTFAWMGDGNNVLHSLIEATALFNFHLHIATPQ 186

Query: 187 GSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQV 246
           GSEP+ +Y+NWAR +GA + L H+  +A +   C+ TDTW+SM QEF+A+   +FQP+QV
Sbjct: 187 GSEPQEKYINWARERGAHIMLTHNPQKAAENVDCIITDTWVSMGQEFRAQNYSIFQPYQV 246

Query: 247 NLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           N +LM+ A PDALFMHCLPAHRGEEV++ V+DGP SVVFDEAENRLH QKAIL WC 
Sbjct: 247 NEALMACAKPDALFMHCLPAHRGEEVVDAVIDGPHSVVFDEAENRLHAQKAILSWCL 303


>gi|254468826|ref|ZP_05082232.1| ornithine carbamoyltransferase [beta proteobacterium KB13]
 gi|207087636|gb|EDZ64919.1| ornithine carbamoyltransferase [beta proteobacterium KB13]
          Length = 304

 Score =  225 bits (574), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 119/302 (39%), Positives = 176/302 (58%), Gaps = 2/302 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT  KHF   ++++   +  + + AK +K   +   ++ PL  + L MIFEK STRTR+S
Sbjct: 1   MTI-KHFLQFNDLTKDEIYYLFDRAKWLKKQFKEYQKHWPLEDRTLVMIFEKASTRTRLS 59

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  I+L+  + QLGR E + D A+V+SR  D +++RT     +    + + 
Sbjct: 60  FESGMHQLGGAAIYLNTKDSQLGRGEPVEDAAQVISRMSDVVMIRTFEQEIIERFAQNSR 119

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LT+  HPCQI+ADI TF EHRGSV+GK  +W GD NN+ ++ ++ A   ++ ++
Sbjct: 120 VPVINGLTNEYHPCQILADIFTFIEHRGSVEGKTVAWIGDSNNVCNTWLQAAELLDFNMH 179

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           ++TP G E   E      +                        T     +  ++  + VF
Sbjct: 180 VSTPKGYEVEVERAGLYDDSHFEQFENPMDAAKDAHLVTTDVWTS-MGYESEQSERKSVF 238

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
             +QV+  +M  +  D+LFMHCLPAHRGEEV ++V+DGP+SVV+DEAENRLH QKA+L +
Sbjct: 239 ADWQVDQEMMDASAKDSLFMHCLPAHRGEEVTSDVIDGPKSVVWDEAENRLHVQKALLEY 298

Query: 302 CF 303
             
Sbjct: 299 LL 300


>gi|99080507|ref|YP_612661.1| ornithine carbamoyltransferase [Ruegeria sp. TM1040]
 gi|123379040|sp|Q1GIW7|OTC_SILST RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|99036787|gb|ABF63399.1| ornithine carbamoyltransferase [Ruegeria sp. TM1040]
          Length = 308

 Score =  225 bits (574), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 160/308 (51%), Positives = 219/308 (71%), Gaps = 7/308 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFE-----NKPLSGKVLAMIFEKPSTRTR 59
             HF D+   +  +L  II+ A ++K +     +      +PL+G ++A+IFEKPSTRTR
Sbjct: 1   MNHFLDIHKTAPEDLRQIIDQAGQMKTARLGRPKGTPDDEQPLAGHMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V ++ +GG+T+ LSG +MQLG  ETI DTA+VLSRYVD I++RT + + L E+ EY
Sbjct: 61  VSFDVGVRQMGGETMVLSGKDMQLGHGETIADTARVLSRYVDMIMIRTFDETVLTEMAEY 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           A VPVIN LTD THPCQI+ADI+T+EEHRG +KGK   W+GDGNN+  S +  A +F + 
Sbjct: 121 ADVPVINGLTDRTHPCQIMADILTYEEHRGPIKGKKVVWTGDGNNVCASFLHAAGQFGFD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKARE 237
           L    P   +P +E++ +ARN G+ + +  DA +AV+GA  V  DTW+SM+  Q  K R 
Sbjct: 181 LTFTGPAQLDPEDEFIGFARNAGSKITIERDAAKAVEGADLVVADTWVSMHDSQSSKERR 240

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
            ++ +P+QVN +LM+ A PDALFMHCLPAHR EEV + V+DGPQSV+FDEAENRLH QKA
Sbjct: 241 HNMLRPYQVNDALMAHAKPDALFMHCLPAHREEEVTSAVMDGPQSVIFDEAENRLHAQKA 300

Query: 298 ILLWCFGI 305
           ++ WC G+
Sbjct: 301 VMRWCLGV 308


>gi|312115101|ref|YP_004012697.1| ornithine carbamoyltransferase [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220230|gb|ADP71598.1| ornithine carbamoyltransferase [Rhodomicrobium vannielii ATCC
           17100]
          Length = 320

 Score =  225 bits (573), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 162/304 (53%), Positives = 211/304 (69%), Gaps = 3/304 (0%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSE---NIFENKPLSGKVLAMIFEKPSTRTR 59
           + P+HF D+ +     L  I++ A+ +K   +        K   GKVLAM+FEK STRTR
Sbjct: 14  SAPRHFLDIDDYDFDTLRLILDNARALKKLIKTSPASDWPKVAEGKVLAMLFEKSSTRTR 73

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+VAM+ LGG+TI L+ ++MQLGR ETI DTA+VLSRYVDAI+MR T+H  L+EL E+
Sbjct: 74  VSFDVAMRQLGGETIVLNRNDMQLGRGETIADTARVLSRYVDAIMMRCTSHEALIELAEH 133

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN L+D +HPCQI+ADIMT EEH+G V     +W GD NN+  S +  A RF + 
Sbjct: 134 SAVPVINGLSDRSHPCQILADIMTLEEHKGDVAPLKVAWIGDFNNVTASWVHAAVRFGFA 193

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           + +ATP   +P   +L+WA ++G  + +  D   AV GA CV TD W+SM QE  A  E 
Sbjct: 194 MTLATPKLLQPPRSFLDWANDEGGRITVVEDPAVAVAGADCVVTDVWVSMGQENVAERET 253

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           +  P+QVN +LM  A  +A+FMHCLPAHRG EV ++V+DGPQSVVFDEAENRLH Q+AIL
Sbjct: 254 LLAPYQVNAALMEKADKNAIFMHCLPAHRGREVTDDVIDGPQSVVFDEAENRLHAQRAIL 313

Query: 300 LWCF 303
            WCF
Sbjct: 314 AWCF 317


>gi|88800227|ref|ZP_01115795.1| ornithine carbamoyltransferase [Reinekea sp. MED297]
 gi|88777073|gb|EAR08280.1| ornithine carbamoyltransferase [Reinekea sp. MED297]
          Length = 300

 Score =  225 bits (573), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 146/302 (48%), Positives = 200/302 (66%), Gaps = 5/302 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT  +HF  L++++S     II  A ++K   +    ++PL  +VL MIFEK STRTRVS
Sbjct: 1   MTV-RHFLTLNDLTSDEALKIINRAAELKALHKARTVHEPLKNRVLGMIFEKSSTRTRVS 59

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  IFLS  + QLGR E I D+A+VLS+ VDA+++RT  H ++    +Y+T
Sbjct: 60  FEAGMTQLGGSAIFLSPRDTQLGRGEPIEDSARVLSQMVDAVMIRTFEHHKIQTFADYST 119

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVINALTD+ HPCQ++AD+  + E RGS++GK  +W GDGNN+ +S I  A  F++ LN
Sbjct: 120 VPVINALTDDYHPCQLLADVQAYTEARGSIQGKTVTWVGDGNNMCNSYINAAKLFDFQLN 179

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHV 240
           IA P G EP +E L  A ++   +       +A  GAH V TD W SM QE +A+     
Sbjct: 180 IACPEGYEPMSELLESAGDRVHIIR---SVEEATAGAHLVTTDVWASMGQEEEAKARMAA 236

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+ +QV+  LM +A  DA+F+HCLPAHRGEEV  ++LD P+SVVF++A NRLH QKA+L 
Sbjct: 237 FRDYQVSPKLMDIADKDAVFLHCLPAHRGEEVSEDMLDDPRSVVFEQAGNRLHAQKALLE 296

Query: 301 WC 302
           + 
Sbjct: 297 FL 298


>gi|114773339|ref|ZP_01450543.1| ornithine carbamoyltransferase [alpha proteobacterium HTCC2255]
 gi|114546273|gb|EAU49184.1| ornithine carbamoyltransferase [alpha proteobacterium HTCC2255]
          Length = 307

 Score =  225 bits (573), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 161/307 (52%), Positives = 217/307 (70%), Gaps = 7/307 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSE-----NIFENKPLSGKVLAMIFEKPSTRTR 59
            KHF D++  + ++L+ I++ AKK K +           ++ LSGK++A+IFEKPSTRTR
Sbjct: 1   MKHFLDINKTNVNDLNQILDQAKKTKATRAGFANGANDIDQTLSGKMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF++ ++ +GG T+ LSG+EMQ+G  E+I DTA+VLSRYVD I++RT   + LLEL EY
Sbjct: 61  VSFDMGVRQMGGQTMVLSGAEMQIGHGESIADTARVLSRYVDMIMIRTFAEATLLELAEY 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           +TVPVIN LTD +HPCQI+ADIMTF+E  GS+ GK   W GDGNN+  S +  A +F + 
Sbjct: 121 STVPVINGLTDRSHPCQIMADIMTFQEKHGSISGKKVVWLGDGNNVCTSFLHAAGKFGFN 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKARE 237
           L  A P   +P  E + +AR+ G++V +  DA +AVK A  + TDTW+SM+  Q  +AR 
Sbjct: 181 LTFAGPEVLDPETEAMGYARSNGSTVEIERDASKAVKDADLIVTDTWLSMHDDQAARARR 240

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
            ++ +P+QVN  LM  A  DA+FMHCLPAHR EEV +EV+DG  SVVFDEAENRLH QKA
Sbjct: 241 HNLLRPYQVNAELMKQASKDAIFMHCLPAHREEEVTSEVMDGANSVVFDEAENRLHVQKA 300

Query: 298 ILLWCFG 304
           I+ WC G
Sbjct: 301 IMQWCLG 307


>gi|332982559|ref|YP_004464000.1| ornithine carbamoyltransferase [Mahella australiensis 50-1 BON]
 gi|332700237|gb|AEE97178.1| ornithine carbamoyltransferase [Mahella australiensis 50-1 BON]
          Length = 320

 Score =  225 bits (573), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 133/303 (43%), Positives = 192/303 (63%), Gaps = 5/303 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    + +++   +  I+ +  K+K  S+    +  L GK L MIF+K STRTRVSFEV 
Sbjct: 17  KDLLSIHDLTQDEVYQILSLGLKLKAQSKAGIPHPLLKGKTLGMIFQKSSTRTRVSFEVG 76

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  +FLS +++QLGR ETI DTA+VLSRY+D I++RT     + +L  Y+++PVI
Sbjct: 77  IYQLGGYGLFLSSNDLQLGRGETIADTARVLSRYLDGIMIRTFKQKDVEDLAHYSSIPVI 136

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ+++D++T  E +    G   ++ GDGNN+ HSL+ G A+ +  + +A P
Sbjct: 137 NGLTDLLHPCQVLSDLLTVYEKKQRFSGLKLAFIGDGNNMAHSLMFGCAKVDMDIALACP 196

Query: 186 IGSEPRNEYLNWARNQGA----SVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV- 240
            G  P ++ +  A+         + +  D  +A++GA  V+TD W SM QE + +E    
Sbjct: 197 EGYMPDDDIVKAAKTDAQLSGSHITITTDPAEAIEGADVVYTDVWASMGQEAETQERKKA 256

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
            Q +QVN SL  +A PDA+FMHCLPAHRGEEV + ++DGP S +FDEAENRLH QKAI+ 
Sbjct: 257 MQNYQVNESLWQLAKPDAIFMHCLPAHRGEEVTDAIIDGPMSAIFDEAENRLHAQKAIMA 316

Query: 301 WCF 303
              
Sbjct: 317 LLM 319


>gi|254784926|ref|YP_003072354.1| ornithine carbamoyltransferase [Teredinibacter turnerae T7901]
 gi|237684230|gb|ACR11494.1| ornithine carbamoyltransferase [Teredinibacter turnerae T7901]
          Length = 304

 Score =  225 bits (573), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 144/300 (48%), Positives = 181/300 (60%), Gaps = 3/300 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           P+H   LS+++S  L  II  A  +K S        PL+ K L MIFEK STRTRVSFE 
Sbjct: 3   PRHLLSLSDLTSEELEAIIANAIALKKSHYEGNAPLPLANKTLGMIFEKSSTRTRVSFEA 62

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG  IFLS  + QLGR E I D+A+VLSR VD I++RT   + L     Y+ VPV
Sbjct: 63  GMTQLGGSAIFLSPRDTQLGRGEPIEDSARVLSRMVDIIMIRTFEQADLERFAAYSRVPV 122

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALTD  HPCQ++AD+ TF EHRGS KGK  +W GDGNN+ HS I  A   ++ L IA 
Sbjct: 123 INALTDTFHPCQLLADVQTFVEHRGSPKGKTVAWVGDGNNMCHSYINAARLCDFQLRIAC 182

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P G EP  E L    ++   V    DAV+           +     +  +   E  F  F
Sbjct: 183 PRGFEPDPELLAANADRVTVVNSPADAVKGAHWVATDVWASM--GQESEQKEREKQFAGF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQS-VVFDEAENRLHTQKAILLWCF 303
           QVN  LM++A PDA+FMHCLPAHRGEEV  E+++  +  VV+DEAENRLH QKA++L+  
Sbjct: 241 QVNHELMALAQPDAVFMHCLPAHRGEEVSAELMEDEKFTVVWDEAENRLHAQKALMLFLL 300


>gi|307353462|ref|YP_003894513.1| ornithine carbamoyltransferase [Methanoplanus petrolearius DSM
           11571]
 gi|307156695|gb|ADN36075.1| ornithine carbamoyltransferase [Methanoplanus petrolearius DSM
           11571]
          Length = 311

 Score =  225 bits (573), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 135/303 (44%), Positives = 197/303 (65%), Gaps = 2/303 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K    + +++S  L+ ++ +A K+K   +N    + L  K + +IFEK STRTR+SFE
Sbjct: 1   MKKDILSILDLNSEELTGVLALADKLKGERKNGIFPEYLYKKSVGLIFEKASTRTRISFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
             +  LGG  +FL+ ++MQLGR ETI DTAKVLSRY+ AI+MR+ +H  + EL  ++T+P
Sbjct: 61  TGIFELGGHPLFLNPNDMQLGRGETISDTAKVLSRYLSAIMMRSYSHRTVEELALHSTIP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSV-KGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           VIN L+D  HPCQI+ADIMT  E+ G+  +    +W GDGNN+  SL+  +A   Y +N+
Sbjct: 121 VINGLSDEEHPCQILADIMTMRENFGNNLEDLTIAWIGDGNNVCDSLMLSSALTGYRVNV 180

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVF 241
           A+P    P+ +Y+  A   GA V  F +   AV GA  ++TDTWISM +E +     + F
Sbjct: 181 ASPPAYRPKEKYIELAEKAGAYVKFFDNPRDAVSGADVIYTDTWISMGRENEKEARVNAF 240

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           + ++V+ SL++    D++  HCLPAHRGEE+ +EV+DGP S V+D+AENRLH QKA+L  
Sbjct: 241 KGYRVDESLLAGCDSDSIVFHCLPAHRGEEISDEVIDGPMSRVWDQAENRLHAQKALLAK 300

Query: 302 CFG 304
             G
Sbjct: 301 LLG 303


>gi|83644597|ref|YP_433032.1| ornithine carbamoyltransferase [Hahella chejuensis KCTC 2396]
 gi|83632640|gb|ABC28607.1| ornithine carbamoyltransferase [Hahella chejuensis KCTC 2396]
          Length = 304

 Score =  225 bits (573), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 138/302 (45%), Positives = 188/302 (62%), Gaps = 3/302 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M+  +HF  L + S + L  +IE A ++K    +   + P+ G+VL MIFEK STRTRVS
Sbjct: 1   MSI-RHFLTLCDFSPTELEYLIERAIQLKAKHRSKQAHTPMQGQVLGMIFEKSSTRTRVS 59

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE     LGG  IFLS  + QLGR E I D+A+VLSR VD I++RT  HS+L    +Y++
Sbjct: 60  FEAGAAQLGGSAIFLSPRDTQLGRGEPIEDSARVLSRMVDIIMIRTFEHSKLELFAKYSS 119

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
            PVINALTD+ HPCQ++ADI T+ EHRG+++GK  +W GDGNN+ +S I  A +F + L 
Sbjct: 120 APVINALTDDYHPCQLLADIQTYVEHRGTIRGKKVAWIGDGNNMCNSYINAARQFGFELA 179

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +A P G EP    +    ++        DAV            +     ++ +A  E  F
Sbjct: 180 VACPEGYEPMQSLVEQNADRVKIFRTPSDAVAGAHLVVTDVWASM--GQEQEQAEREKAF 237

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
             FQV+  LM+ A PDALFMHCLPAHRGEE+  ++LD  +SVV+DEAENRLH QKA++ +
Sbjct: 238 AAFQVSPELMNKAAPDALFMHCLPAHRGEEISTDMLDDQRSVVWDEAENRLHAQKALMEF 297

Query: 302 CF 303
             
Sbjct: 298 LL 299


>gi|91789427|ref|YP_550379.1| ornithine carbamoyltransferase [Polaromonas sp. JS666]
 gi|91698652|gb|ABE45481.1| ornithine carbamoyltransferase [Polaromonas sp. JS666]
          Length = 329

 Score =  225 bits (572), Expect = 8e-57,   Method: Composition-based stats.
 Identities = 125/298 (41%), Positives = 182/298 (61%), Gaps = 1/298 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +H+   S++++S  + + E A  IK   +   +++PL+ + LAMIFEK STRTRVSFE  
Sbjct: 28  RHYLQFSDLNASEYAYLFERAAVIKKKFKAYEKHQPLADRTLAMIFEKASTRTRVSFEAG 87

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  + L+  + QLGRAE I D+AKV+SR VD +++RT   +++    E++ VPVI
Sbjct: 88  MYQLGGSVVHLTTGDSQLGRAEPIEDSAKVISRMVDLVMIRTFEQTKIDRFAEHSRVPVI 147

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI T+ EHRGS+ GK  +W GDGNN+ ++ ++ +    + ++++TP
Sbjct: 148 NGLTNEFHPCQILADIFTYIEHRGSILGKTVAWVGDGNNMANTWLQASEILGFKVHVSTP 207

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G E           +   V        A          T +    E +A  +  F  + 
Sbjct: 208 GGYEVDQSIAGIRSAESYQVFKDPMQACAGADLVTTDVWTSMGYEAENEA-RKKAFADWC 266

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           V+  +M  A PDALFMHCLPAHRGEEV  +V+DGPQSVV+DEAENR+H QKA++ +  
Sbjct: 267 VDADMMRAAKPDALFMHCLPAHRGEEVEADVIDGPQSVVWDEAENRMHVQKALMEFLL 324


>gi|241766170|ref|ZP_04764075.1| ornithine carbamoyltransferase [Acidovorax delafieldii 2AN]
 gi|241363775|gb|EER59124.1| ornithine carbamoyltransferase [Acidovorax delafieldii 2AN]
          Length = 306

 Score =  225 bits (572), Expect = 8e-57,   Method: Composition-based stats.
 Identities = 132/301 (43%), Positives = 191/301 (63%), Gaps = 2/301 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH+   +++++   + + E A  IK   +   ++ PL+ + LAMIFEK STRTRVSFE 
Sbjct: 1   MKHYLQFNDLTADEYAYLFERAALIKKKFKAYEKHHPLADRTLAMIFEKASTRTRVSFEA 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG  + L+  + QLGRAE I D+AKV+SR VD +++RT   +++      + VPV
Sbjct: 61  GMYQLGGSVVHLTTGDSQLGRAEPIEDSAKVISRMVDLVMIRTFEQTKIERFAADSRVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LT+  HPCQI+ADI T+ EHRGS++GK  +W GDGNN+ ++ ++ A+   + ++++T
Sbjct: 121 INGLTNEFHPCQILADIFTYIEHRGSIQGKTVAWVGDGNNMANTWLQAASLLGFKVHVST 180

Query: 185 PIGSEPRNEYLNWAR-NQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQ 242
           P G E   +    A      S   F + ++A KGA  V TD W SM  E +    +  F 
Sbjct: 181 PRGYEVDEKLAAGASGISAGSYQFFSNPLEACKGADLVTTDVWTSMGYEAENEARKAAFA 240

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            + V+  +M+ A  DALFMHCLPAHRGEEV  +V+DGPQSVV+DEAENR+H QKA++ + 
Sbjct: 241 DWCVDAEMMAAAKADALFMHCLPAHRGEEVEADVIDGPQSVVWDEAENRMHVQKALMEYL 300

Query: 303 F 303
            
Sbjct: 301 L 301


>gi|71065517|ref|YP_264244.1| ornithine carbamoyltransferase [Psychrobacter arcticus 273-4]
 gi|123648901|sp|Q4FT48|OTC_PSYA2 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|71038502|gb|AAZ18810.1| ornithine carbamoyltransferase [Psychrobacter arcticus 273-4]
          Length = 307

 Score =  225 bits (572), Expect = 8e-57,   Method: Composition-based stats.
 Identities = 122/298 (40%), Positives = 183/298 (61%), Gaps = 2/298 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  LS+ +   L  +I+ A +++         +P  G+ L MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLSDFTKQELENLIKRASELRKMQHAGEIYQPFVGRTLGMIFEKSSTRTRISFETG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M   GG+ IFLS ++ QLGR E + D+A+V+S  VD I++RT  H ++    +Y++VP+I
Sbjct: 64  MGQFGGNAIFLSPNDTQLGRGEPLEDSARVISSMVDIIMIRTFGHEKVETFAKYSSVPII 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD  HPCQ++AD+ T+ EHRGS++ K+ +W GDGNN+  S ++ A +F + L +A P
Sbjct: 124 NALTDEFHPCQLLADMQTYYEHRGSIENKIVTWVGDGNNMCASFMQAAHQFGFELRVAAP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G EP +  +    +  + V    DA +           +     +  +      F P+Q
Sbjct: 184 YGFEPDSALMERFSHCVSLVENVQDAAKDSNLIVTDVWASM--GQESEQNTRARRFAPYQ 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           V  SL+  A P+ +FMHCLPAHRGEE+ +++LD P+SVV+DEAENRLH QKA++ +  
Sbjct: 242 VTPSLLDKADPEVVFMHCLPAHRGEEISHDMLDDPRSVVWDEAENRLHAQKALMEFLL 299


>gi|226227907|ref|YP_002762013.1| ornithine carbamoyltransferase [Gemmatimonas aurantiaca T-27]
 gi|226091098|dbj|BAH39543.1| ornithine carbamoyltransferase [Gemmatimonas aurantiaca T-27]
          Length = 303

 Score =  225 bits (572), Expect = 8e-57,   Method: Composition-based stats.
 Identities = 147/302 (48%), Positives = 204/302 (67%), Gaps = 4/302 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             + F ++++ SS     ++++A++++  +    + KPL+GK LAMIF K STRTR+SFE
Sbjct: 1   MHRDFLNIADFSSDETFALLDLAERMRTGAY---QAKPLTGKALAMIFMKSSTRTRMSFE 57

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V    LGG   FLS  ++Q+GR E I DTA+VLSRYV  I++RT  H  ++EL EYA+VP
Sbjct: 58  VGANQLGGTAHFLSPRDVQIGRGEPIADTARVLSRYVQGIMIRTFAHQDVVELAEYASVP 117

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           +IN LTD +HPCQI+AD++T ++H G V+GK  +W GDGNN+ +S +E AA   + L +A
Sbjct: 118 IINGLTDLSHPCQILADVLTMQQHLGGVRGKTVAWIGDGNNMANSWMEAAAHLGFTLRLA 177

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQ 242
            P G +P  ++L  A+ +G  V L  D  +AV GA  V TD W SM QE + ++    F 
Sbjct: 178 CPEGYDPDAQFLADAKARGGDVQLLRDPREAVAGADVVTTDVWASMGQEEEQSKRAVAFA 237

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            +QV+  LM+ A   A+F+HCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKAI+   
Sbjct: 238 LYQVDAELMARAAAHAVFLHCLPAHRGEEVTAEVIDGPQSVVWDEAENRLHVQKAIMAVL 297

Query: 303 FG 304
            G
Sbjct: 298 MG 299


>gi|299532015|ref|ZP_07045411.1| ornithine carbamoyltransferase [Comamonas testosteroni S44]
 gi|298720002|gb|EFI60963.1| ornithine carbamoyltransferase [Comamonas testosteroni S44]
          Length = 307

 Score =  225 bits (572), Expect = 8e-57,   Method: Composition-based stats.
 Identities = 131/301 (43%), Positives = 189/301 (62%), Gaps = 2/301 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH+   S+ ++     ++E A  IK   +   ++  L+ + +AMIFEK STRTRVSFE 
Sbjct: 1   MKHYLQFSDFTADEYDYLLERAALIKKKFKGYEKHHTLTDRTMAMIFEKASTRTRVSFEA 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG  + L+  + QLGR+E I D+A+V+SR  D +++RT    ++    +Y+ VPV
Sbjct: 61  GMYQLGGSVVHLTTGDSQLGRSEPIEDSARVISRMTDLVMIRTFGQDKIERFAQYSRVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LT+  HPCQI+ADI TF EHRGS+KGK+ +W GDGNN+ ++ ++ A    + ++++T
Sbjct: 121 INGLTNEFHPCQILADIFTFIEHRGSIKGKVVAWVGDGNNMANTWLQAADLLGFTVHVST 180

Query: 185 PIGSEPRNEYLNWARNQGA-SVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQ 242
           P G E   +     +        +F D ++A KGA  V TD W SM  E +    +  F 
Sbjct: 181 PGGYEVDEQLAFNGKPVNPGCYKVFKDPLEACKGADLVTTDVWTSMGYEAENEARKKAFA 240

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            + V+  +M+ A  DALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENR+H QKA++ + 
Sbjct: 241 DWCVDAEMMASAKADALFMHCLPAHRGEEVEAEVIDGPQSVVWDEAENRMHVQKALMEYL 300

Query: 303 F 303
            
Sbjct: 301 L 301


>gi|302879197|ref|YP_003847761.1| ornithine carbamoyltransferase [Gallionella capsiferriformans ES-2]
 gi|302581986|gb|ADL55997.1| ornithine carbamoyltransferase [Gallionella capsiferriformans ES-2]
          Length = 311

 Score =  225 bits (572), Expect = 8e-57,   Method: Composition-based stats.
 Identities = 119/302 (39%), Positives = 172/302 (56%), Gaps = 2/302 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF    +++   L  + E  + IK   ++  +  PLS + L MIFEK STRTR+SFE  
Sbjct: 10  KHFLQFKDLNREELEYLFERTRIIKQKYKSYQQYWPLSDRTLVMIFEKASTRTRLSFEAG 69

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG  I+L+  + QLGR E + D  +V+SR  D +++RT   S +     ++ VPVI
Sbjct: 70  MQQLGGSAIYLNTRDSQLGRGEPVEDAGQVISRMSDIVMIRTFEQSIIERFAAHSRVPVI 129

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI T+ E RGS++GK  +W GD NN+ ++ ++ A   ++ ++++TP
Sbjct: 130 NGLTNEYHPCQILADIYTYIEQRGSIQGKTVAWIGDSNNMCNTWLQAAEILDFNVHVSTP 189

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
              E   E      ++                       T +    E +      F  +Q
Sbjct: 190 PEYEVEPERAGLYGHEHYEEFTDPMEAARGADLVTTDVWTSMGFEAENEE-RMKDFADWQ 248

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL-LWCFG 304
           V+  +M++A  DALFMHCLPAHRGEEV   V+DGPQSVV+DEAENRLH QKA++     G
Sbjct: 249 VDEDMMAVAAKDALFMHCLPAHRGEEVSAGVMDGPQSVVWDEAENRLHVQKALMEYLLLG 308

Query: 305 II 306
            I
Sbjct: 309 KI 310


>gi|260575313|ref|ZP_05843313.1| ornithine carbamoyltransferase [Rhodobacter sp. SW2]
 gi|259022573|gb|EEW25869.1| ornithine carbamoyltransferase [Rhodobacter sp. SW2]
          Length = 308

 Score =  225 bits (572), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 157/308 (50%), Positives = 213/308 (69%), Gaps = 7/308 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFE-----NKPLSGKVLAMIFEKPSTRTR 59
            KHF D+   ++++L  +I  A+ +K +     +     ++PL+G+++A+IFEKPSTRTR
Sbjct: 1   MKHFLDIHTTAAADLRLMINSAQAMKTARNGRPKGTPDDDQPLAGRMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V ++ +GG T+ LSG EMQLG  ETI DTA+VLSRYVD I++RT   + LLE+ E+
Sbjct: 61  VSFDVGVRQMGGQTMVLSGKEMQLGHGETIADTARVLSRYVDLIMIRTFEEATLLEMAEH 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ATVPVIN LT+ THPCQI+AD+MT+EEHRG + GK   W+GDGNN+  S +  A +F + 
Sbjct: 121 ATVPVINGLTNRTHPCQIMADVMTYEEHRGPIAGKKVVWAGDGNNVCASFLHAAGQFGFD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF--KARE 237
                P   +P    L +AR  G+ VA+  D   AV+GA  V TDTW+SM+     K R 
Sbjct: 181 FTFTGPEPLDPEAPALGFARQMGSRVAIERDPALAVQGADLVVTDTWVSMHDPESAKERR 240

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
            +  + +QVN +LM+ A PDALFMHCLPAHR +EV + V+DGP SVVFDEAENRLH QKA
Sbjct: 241 HNQLRGYQVNDALMAKAKPDALFMHCLPAHRNDEVTSAVMDGPHSVVFDEAENRLHAQKA 300

Query: 298 ILLWCFGI 305
           ++ WC G+
Sbjct: 301 VMRWCLGV 308


>gi|284047968|ref|YP_003398307.1| ornithine carbamoyltransferase [Acidaminococcus fermentans DSM
           20731]
 gi|283952189|gb|ADB46992.1| ornithine carbamoyltransferase [Acidaminococcus fermentans DSM
           20731]
          Length = 313

 Score =  225 bits (572), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 125/308 (40%), Positives = 183/308 (59%), Gaps = 5/308 (1%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M    K    + ++S   ++ I++V++K+K   +    ++ L GK LAMIF K STRTRV
Sbjct: 1   MALRNKDLISIHDLSVGEVATILDVSRKLKKKQKLGEPHEYLKGKTLAMIFSKASTRTRV 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFE     LGG  I++S +  Q+GR E + DTA+VLSR+VD I++RT +H  + EL +YA
Sbjct: 61  SFETGFHQLGGHPIYMSEATSQIGRGEPVKDTARVLSRFVDGIMIRTFSHDAVKELADYA 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVIN LTD  HPCQ + D+ T  E++  +KG+   + GDGNN+ HSL+   A+    +
Sbjct: 121 TVPVINGLTDLLHPCQALTDMFTVLEYKDVLKGRKLVYVGDGNNMAHSLMFACAKVGMNM 180

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFT--DTWISMNQEFKAREE 238
             A+P G +P    +  AR   A         + ++ A        T +  +   +A+ E
Sbjct: 181 VCASPKGYQPDPHIVAQARMDAAITGCTITVQEDMEDAAKGADVLYTDVWASMGEEAQRE 240

Query: 239 HVF---QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
                   +Q+N  L+ +A PDA+ +HCLPAHRGEE+ ++V++GPQS VFDEAENRLH Q
Sbjct: 241 ERKKALHDYQINQHLLDLARPDAMVLHCLPAHRGEEITDDVIEGPQSAVFDEAENRLHVQ 300

Query: 296 KAILLWCF 303
           KAI+    
Sbjct: 301 KAIMALLM 308


>gi|167629524|ref|YP_001680023.1| ornithine carbamoyltransferase [Heliobacterium modesticaldum Ice1]
 gi|167592264|gb|ABZ84012.1| ornithine carbamoyltransferase [Heliobacterium modesticaldum Ice1]
          Length = 318

 Score =  225 bits (572), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 142/305 (46%), Positives = 194/305 (63%), Gaps = 5/305 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             + F  L + S   +   I++A+++K   ++   +  L+GK L MIF K STRTRVSFE
Sbjct: 14  KGRDFLSLHDFSRDEIFYFIDLARQLKALQKDRIPHPYLAGKTLGMIFTKSSTRTRVSFE 73

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M  LGG+ +FLS +++QLGR E I DTA+VLSRYVD I++RT  HS ++EL +YA +P
Sbjct: 74  VGMYQLGGNALFLSSADIQLGRGEPIKDTARVLSRYVDGIMIRTFAHSDVVELAQYADIP 133

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQ++AD+MT  E++G   G   ++ GDGNN+ H L+ G A+    + I 
Sbjct: 134 VINGLTDLLHPCQVLADLMTIVEYKGKTDGLKMTFIGDGNNMAHELMFGGAKAGMDVVIC 193

Query: 184 TPIGSEPRNEYLNWARNQGASV----ALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           TP    P  E +  A     +      L  D V A K A  ++TD W SM QE +A+E  
Sbjct: 194 TPEAYRPEPEIVRIATEDAKAHGGSITLMSDPVAASKDADVLYTDVWASMGQEGEAQERA 253

Query: 240 V-FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             FQ F ++ ++M  AHP A+ +HCLPAHRGEE+ +EV++GPQS VFDEAENRLH QKAI
Sbjct: 254 QAFQGFMIDGTIMKAAHPKAIVLHCLPAHRGEEITDEVIEGPQSAVFDEAENRLHAQKAI 313

Query: 299 LLWCF 303
           +    
Sbjct: 314 MASVM 318


>gi|221065674|ref|ZP_03541779.1| ornithine carbamoyltransferase [Comamonas testosteroni KF-1]
 gi|220710697|gb|EED66065.1| ornithine carbamoyltransferase [Comamonas testosteroni KF-1]
          Length = 307

 Score =  224 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 132/301 (43%), Positives = 189/301 (62%), Gaps = 2/301 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH+   S+ ++     ++E A  IK   +   ++  L+ + +AMIFEK STRTRVSFE 
Sbjct: 1   MKHYLQFSDFTADEYDYLLERAALIKKKFKGYEKHHTLTDRTMAMIFEKASTRTRVSFEA 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG  + L+  + QLGR+E I D+A+V+SR  D +++RT    ++    EY+ VPV
Sbjct: 61  GMYQLGGSVVHLTTGDSQLGRSEPIEDSARVISRMTDLVMIRTFGQDKIARFAEYSRVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LT+  HPCQI+ADI TF EHRGS+KGK+ +W GDGNN+ ++ ++ A    + ++++T
Sbjct: 121 INGLTNEFHPCQILADIFTFIEHRGSIKGKVVAWVGDGNNMANTWLQAADLLGFTVHVST 180

Query: 185 PIGSEPRNEYLNWARNQGA-SVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQ 242
           P G E   +     +        +F D ++A KGA  V TD W SM  E +    +  F 
Sbjct: 181 PGGYEVDEQLAFNGKPVNPGCYKVFKDPLEACKGADLVTTDVWTSMGYEAENEARKKAFA 240

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            + V+  +M+ A  DALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENR+H QKA++ + 
Sbjct: 241 DWCVDAEMMASAKSDALFMHCLPAHRGEEVEAEVIDGPQSVVWDEAENRMHVQKALMEYL 300

Query: 303 F 303
            
Sbjct: 301 L 301


>gi|253999269|ref|YP_003051332.1| ornithine carbamoyltransferase [Methylovorus sp. SIP3-4]
 gi|253985948|gb|ACT50805.1| ornithine carbamoyltransferase [Methylovorus sp. SIP3-4]
          Length = 305

 Score =  224 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 121/302 (40%), Positives = 170/302 (56%), Gaps = 2/302 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF    ++S   L  I E  + IK   +   +  PL+ + L MIFEK STRTR+SFE  
Sbjct: 4   KHFLQFKDLSREELDHIFERTRWIKQQFKAYQQYWPLTDRTLVMIFEKASTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG  I+L+  + QLGR E + D A+V+SR  D +++RT     +      + VPVI
Sbjct: 64  MQQLGGSAIYLNTRDSQLGRGEPVEDAAQVISRMSDIVMIRTFEQEIIERFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI TF EHRG ++GK  +W GD NN+ ++ ++ A   ++ ++++TP
Sbjct: 124 NGLTNEYHPCQILADIFTFIEHRGPIQGKTVAWIGDSNNVCNTWLQAAEVLDFNVHVSTP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G E   E      ++                       T +    E +      F  +Q
Sbjct: 184 PGYEVEPERAGLYGHEHYEEFTDPMEAARGADLVTTDVWTSMGFEAENEE-RMRDFADWQ 242

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL-LWCFG 304
           V+  +M +A  DALFMHCLPAHRGEEV  EV+DGP SVV+DEAENRLH QKA++     G
Sbjct: 243 VDADMMRVAKSDALFMHCLPAHRGEEVAAEVIDGPHSVVWDEAENRLHVQKALMEYLLLG 302

Query: 305 II 306
            +
Sbjct: 303 KV 304


>gi|319790661|ref|YP_004152294.1| ornithine carbamoyltransferase [Thermovibrio ammonificans HB-1]
 gi|317115163|gb|ADU97653.1| ornithine carbamoyltransferase [Thermovibrio ammonificans HB-1]
          Length = 309

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 145/303 (47%), Positives = 196/303 (64%), Gaps = 5/303 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            K F  + +     +  II ++  +K   +     +PL G   A+IFEKPSTRTRVSFEV
Sbjct: 1   MKDFISMLDADRLFIENIISLSAFLKEKQKKGELYRPLEGFTAALIFEKPSTRTRVSFEV 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG  +++     QLGR E I DTA+VLSRYVD IV+RT    R+ EL  YA+VPV
Sbjct: 61  GVYQLGGHGVYMDTQGSQLGRGEPIKDTARVLSRYVDLIVIRTFGQERVEELARYASVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALTD  HPCQ++AD+ T  E++G +KG   ++ GDGNN+ +S + GAA        AT
Sbjct: 121 INALTDQEHPCQVLADLFTIWEYKGELKGLKVAYLGDGNNMCNSWLVGAAYMGMRFYAAT 180

Query: 185 PIGSEPRNEYLN----WARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEH 239
           P G EP  +Y+      A++ GA + + +D  +AVK A  ++TD W SM QE +A     
Sbjct: 181 PKGYEPLEKYVKAAKEIAKSTGAEIVVTNDPEEAVKDADVIYTDVWASMGQEAEAEERRR 240

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           +F P+QVN  L+ +A PD LFMHCLPAHRGEEV +EV++G +SVV+D+AENRLHTQKA++
Sbjct: 241 IFTPYQVNGELVKLAKPDFLFMHCLPAHRGEEVTDEVIEGERSVVWDQAENRLHTQKALI 300

Query: 300 LWC 302
           L  
Sbjct: 301 LKL 303


>gi|154150382|ref|YP_001404000.1| ornithine carbamoyltransferase [Candidatus Methanoregula boonei
           6A8]
 gi|153998934|gb|ABS55357.1| ornithine carbamoyltransferase [Methanoregula boonei 6A8]
          Length = 303

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 140/301 (46%), Positives = 192/301 (63%), Gaps = 1/301 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K F  + +I+ + L  I+  A+++K   +    ++ L G  LAMIFEK STRT +SFE
Sbjct: 1   MKKDFLSILDITKTELDEILIDAERLKRQKKAGVPHELLRGMSLAMIFEKSSTRTHISFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M  LGG  +FL+  ++Q+GR E I DTA+V SRYV AI++R   HS +++L E ATVP
Sbjct: 61  VGMHELGGHALFLNAKDLQIGRGEEIRDTARVASRYVSAIMIRAYRHSTVVDLAENATVP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN L+D  HPCQ++ADI+T +EH G V+G   +W GDGNN+ +SL+  +A     + +A
Sbjct: 121 VINGLSDIEHPCQLLADILTIKEHFGKVRGLKVAWVGDGNNVCNSLVLSSALTGMEIAVA 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQ 242
            P G E   E +  A+  G  V        AVK AH + TDTWISM  E +  +    F+
Sbjct: 181 GPKGYEIAPELVEKAQALGGRVTRVKTPQDAVKDAHVIVTDTWISMGDEAEQEKRRAAFK 240

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            F VN +L+  A PDA  +HCLPAHRGEE+  +VLDGP+S+V+DEAENRLH QKA+L+  
Sbjct: 241 GFTVNDALLRHASPDARVLHCLPAHRGEEITGDVLDGPKSLVWDEAENRLHAQKALLVKL 300

Query: 303 F 303
            
Sbjct: 301 L 301


>gi|91785023|ref|YP_560229.1| ornithine carbamoyltransferase [Burkholderia xenovorans LB400]
 gi|91688977|gb|ABE32177.1| ornithine carbamoyltransferase [Burkholderia xenovorans LB400]
          Length = 309

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 136/305 (44%), Positives = 185/305 (60%), Gaps = 5/305 (1%)

Query: 2   MTYP--KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    +H+    + S  +   ++E A+ +K   +N     PL  + LAMIFEK STRTR
Sbjct: 1   MTAKKIRHYLQFKDFSLEDYEYVLERARILKRKFKNYETYHPLHDRTLAMIFEKNSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +F+S  + QLGR E I D A+V+SR VD I++RT     L   +E 
Sbjct: 61  LSFEAGIFQLGGHAVFMSTRDTQLGRGEPIEDAAQVISRMVDIIMIRTFGQDILQRFSEN 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT+  HPCQ++ADI T+ EHRG ++GK  +W GD NN+L++ IE A    + 
Sbjct: 121 SRVPVINGLTNEYHPCQVLADIFTYFEHRGPIRGKTVAWVGDANNMLYTWIEAAQILGFK 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EE 238
           L ++TP G +     +  A         F D  +A  GA  V TD W SM  E +    +
Sbjct: 181 LRLSTPPGYKLDRAVV--AAESAPFYEEFDDPNEACAGADLVTTDVWTSMGFEAENEARK 238

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F  + V+  +M+ A+PDALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA+
Sbjct: 239 KAFADWCVDADMMARANPDALFMHCLPAHRGEEVSAEVIDGPQSVVWDEAENRLHVQKAL 298

Query: 299 LLWCF 303
           + +  
Sbjct: 299 MEYLL 303


>gi|329890975|ref|ZP_08269318.1| ornithine carbamoyltransferase [Brevundimonas diminuta ATCC 11568]
 gi|328846276|gb|EGF95840.1| ornithine carbamoyltransferase [Brevundimonas diminuta ATCC 11568]
          Length = 305

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 141/306 (46%), Positives = 198/306 (64%), Gaps = 8/306 (2%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSE-----NIFENKPLSGKVLAMIFEKPSTRT 58
             +HF D+  + +++L  I++ A   K + +         + P   +VLAMIFEK STRT
Sbjct: 1   MVRHFLDIHRLDAADLRAILDDAHARKRARKGWPQGRADADAPGKDRVLAMIFEKNSTRT 60

Query: 59  RVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTE 118
           R SF+ A++ LGGD+I  + ++MQLGR E + DTA+VLSR VDA+++R  +H  +     
Sbjct: 61  RFSFDAAIRQLGGDSIIATAADMQLGRGEPVEDTARVLSRMVDAVMIRANDHEDVERFAR 120

Query: 119 YATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNY 178
            +TVPV+N LTD +HPCQI+AD+MT EEHRG ++GK  +W GDGNN+ HS +  A +F +
Sbjct: 121 VSTVPVVNGLTDRSHPCQILADLMTIEEHRGPIEGKTIAWIGDGNNVCHSFMHAAPKFGF 180

Query: 179 LLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE 238
            L++A P    P    L          +   D  +AVKGA  V TDTW+SM  +      
Sbjct: 181 HLHVACPAEYHPDLRDLEKGGAHVHLTS---DPREAVKGADVVVTDTWVSMGDQDYEARL 237

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F+P+ V+ +LM+ A  DA+F+HCLPAHRGEEV + V+DGPQS+++DEAENRLH QKA+
Sbjct: 238 AAFEPYGVDEALMAEAADDAVFLHCLPAHRGEEVTDAVIDGPQSLIWDEAENRLHAQKAV 297

Query: 299 LLWCFG 304
           L WCFG
Sbjct: 298 LAWCFG 303


>gi|323527175|ref|YP_004229328.1| ornithine carbamoyltransferase [Burkholderia sp. CCGE1001]
 gi|323384177|gb|ADX56268.1| ornithine carbamoyltransferase [Burkholderia sp. CCGE1001]
          Length = 309

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 128/304 (42%), Positives = 176/304 (57%), Gaps = 3/304 (0%)

Query: 2   MTYP--KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    +H+    + S  +   ++E A+ +K   +N     PL  + LAMIFEK STRTR
Sbjct: 1   MTAKKIRHYLQFKDFSLDDYEYVLERARILKRKFKNYETYHPLHDRTLAMIFEKNSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +F+S  + QLGR E I D A+V+SR VD I++RT     +    E 
Sbjct: 61  LSFEAGIFQLGGHAVFMSTRDTQLGRGEPIEDAAQVISRMVDIIMIRTFGQDIIQRFAEN 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT+  HPCQ++ADI T+ EHRG ++GK  +W GD NN+L++ IE A    + 
Sbjct: 121 SRVPVINGLTNEYHPCQVLADIFTYFEHRGPIRGKTVAWVGDANNMLYTWIEAAQILGFR 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L ++TP G +     +              +   A          T +    E +A  + 
Sbjct: 181 LRLSTPPGYKLDRALVAAESAPFFEEFDDPNEACAGADLVTTDVWTSMGFEAENEA-RKK 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  + V+  +MS AHPDALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA++
Sbjct: 240 AFADWCVDAEMMSRAHPDALFMHCLPAHRGEEVSAEVIDGPQSVVWDEAENRLHVQKALM 299

Query: 300 LWCF 303
            +  
Sbjct: 300 EYLL 303


>gi|51894155|ref|YP_076846.1| ornithine carbamoyltransferase [Symbiobacterium thermophilum IAM
           14863]
 gi|56749115|sp|Q67JZ8|OTC_SYMTH RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|51857844|dbj|BAD42002.1| ornithine carbamoyltransferase [Symbiobacterium thermophilum IAM
           14863]
          Length = 310

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 146/309 (47%), Positives = 199/309 (64%), Gaps = 7/309 (2%)

Query: 2   MT--YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    + F  L + S   L  ++E+A   K   +    ++PL GK L M F KPSTRTR
Sbjct: 1   MTTLKGRDFISLHDWSRDELEEVLELAMWQKARLKAGIRDEPLKGKQLGMYFAKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFEV ++ LGGD +FLS  ++QL R E+I DTA+V+SR++D I++RT +H  ++EL E+
Sbjct: 61  LSFEVGIRQLGGDALFLSAHDLQLQRGESIADTARVMSRFLDGIMIRTFSHREVVELAEW 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           AT+PVIN LTD  HPCQ++AD++T  E  G++ G   ++ GDGNN+ HSL++G A+F   
Sbjct: 121 ATIPVINGLTDEEHPCQVVADLLTALERFGTLPGLKLAYVGDGNNVAHSLMDGGAKFGMH 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASV----ALFHDAVQAVKGAHCVFTDTWISMNQEFKA 235
           + +A+P G +P    +  A+   A       +  D V AV GA  V+TD W SM QE +A
Sbjct: 181 VVVASPEGYQPDPARVARAQVTAARYGGLVEVVTDPVLAVTGAQIVYTDVWASMGQEAEA 240

Query: 236 -REEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHT 294
            +    F  +QV   LM  A P+A+FMHCLPAHRGEEV  EV+DGPQS VFDEAENRLH 
Sbjct: 241 EQRRKAFAGYQVTAELMRCAAPEAIFMHCLPAHRGEEVAAEVIDGPQSAVFDEAENRLHA 300

Query: 295 QKAILLWCF 303
           QKAI+    
Sbjct: 301 QKAIMTLIM 309


>gi|295401641|ref|ZP_06811608.1| ornithine carbamoyltransferase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|294976261|gb|EFG51872.1| ornithine carbamoyltransferase [Geobacillus thermoglucosidasius
           C56-YS93]
          Length = 313

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 153/305 (50%), Positives = 206/305 (67%), Gaps = 5/305 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K F  L +IS+ ++  ++ +A+++K        + PL+GK LAMIFEKPSTRTRVSFE
Sbjct: 8   KGKDFLTLIDISTEDIYDLLALAEELKQKQLAGQSHAPLAGKTLAMIFEKPSTRTRVSFE 67

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M  LGG  ++L+ S++QLGR ETI DTA+VLS+YVDAI++RT  HS+L EL  YAT+P
Sbjct: 68  VGMTQLGGSALYLNSSDLQLGRGETIADTARVLSQYVDAIMIRTFAHSKLEELAAYATIP 127

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD+ HPCQ +AD++T  E + ++KG   ++ GDGNN+ ++L+  AA+      IA
Sbjct: 128 VINGLTDDDHPCQALADLLTIYEVKKTLKGLKLAYVGDGNNVANALMIAAAKVGMDCVIA 187

Query: 184 TPIGSEPRNEYLNWARNQGASV----ALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REE 238
            P G EP+ +Y++ A   G       A+ HD V+AV  A  ++TD W SM QE ++ +  
Sbjct: 188 CPAGYEPKEKYIDAAEQIGRQTGAAVAVTHDPVEAVANADVIYTDVWTSMGQEQESEQRL 247

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
            VFQPFQVN  L+  A  D LF+HCLPAHRGEEV  EV+DGP S VF +A NRLH QKA+
Sbjct: 248 TVFQPFQVNGELVKHAKQDYLFLHCLPAHRGEEVTAEVIDGPNSFVFQQAGNRLHAQKAV 307

Query: 299 LLWCF 303
           LL   
Sbjct: 308 LLSLL 312


>gi|330507741|ref|YP_004384169.1| ornithine carbamoyltransferase [Methanosaeta concilii GP-6]
 gi|328928549|gb|AEB68351.1| ornithine carbamoyltransferase [Methanosaeta concilii GP-6]
          Length = 304

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 137/299 (45%), Positives = 194/299 (64%), Gaps = 3/299 (1%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAM 66
           +   ++++S  ++  +I+ A+  +         +PL GK LAMIFEKPSTRTRVS EVA 
Sbjct: 2   NLISIADLSGEDILRLIQSAEAFRA--RRGRHGQPLEGKSLAMIFEKPSTRTRVSLEVAA 59

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
             LGG  ++LS +E+QLGR ETI DTA+VLSRYV  I  R  +H  +L+L E+A+VPVIN
Sbjct: 60  WELGGHPLYLSANELQLGRGETIADTARVLSRYVHGITARVHSHGTVLQLAEHASVPVIN 119

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI 186
           AL+D  HP QI+AD+ T  ++  ++ G    W GDGNN+ +SLI  +A     + +A+P 
Sbjct: 120 ALSDWEHPLQILADLQTMSQNFQALDGLQIGWIGDGNNVCNSLILASAILRMEITVASPP 179

Query: 187 GSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREEHVFQPFQ 245
           G  P+ E L  AR  G S  +  +  +A  GA  + TDTW+SM ++  +A    VF  +Q
Sbjct: 180 GYGPKAEILEEARALGGSPRVVEEPEEAAGGADVLVTDTWVSMGDEAEEAERLRVFGRYQ 239

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           +N  LM +A   A+ +HCLPAHRG+E+ +EV+DGP+S VFDEAENR+HT KA++ W  G
Sbjct: 240 INSQLMDLAGDGAIALHCLPAHRGQEITDEVMDGPRSRVFDEAENRMHTSKAVMAWLMG 298


>gi|240849780|ref|YP_002971168.1| ornithine carbamoyltransferase [Bartonella grahamii as4aup]
 gi|240266903|gb|ACS50491.1| ornithine carbamoyltransferase [Bartonella grahamii as4aup]
          Length = 311

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 183/303 (60%), Positives = 237/303 (78%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M    +HF DLS ++ +    +I+ AK +K S +    +KP  GK LAMIFEKPSTRTR+
Sbjct: 1   MTNALRHFTDLSILTPAIARALIDYAKILKASFKAGKGSKPFIGKTLAMIFEKPSTRTRI 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF+++M+ LGGDTI L+GSEMQLG +ETI DTA+VLSR+VD +++RTT H R+LEL +YA
Sbjct: 61  SFDISMRQLGGDTIMLTGSEMQLGHSETIADTARVLSRFVDIVILRTTKHQRMLELAQYA 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
            +PVINALTD+THPCQI+ADI+T+EEHRG + GK+F+W GDGNN+LHSLIE AA F++ L
Sbjct: 121 QIPVINALTDDTHPCQILADILTYEEHRGPIAGKIFAWMGDGNNVLHSLIEAAALFDFHL 180

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            IATP GSEP+ ++++WAR +GA + L H   +A + A C+ TDTW+SM QEF+AR   +
Sbjct: 181 RIATPKGSEPQEKFIHWARERGAHLTLTHSPQKAAQDADCIMTDTWVSMGQEFRARSHSI 240

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F P+QVN +LM +A  DALFMHCLPAHRGEEV++ ++DG  SVVFDEAENRLH QKAIL 
Sbjct: 241 FLPYQVNEALMKLAKSDALFMHCLPAHRGEEVVDSIIDGLHSVVFDEAENRLHVQKAILS 300

Query: 301 WCF 303
           WC 
Sbjct: 301 WCL 303


>gi|312112026|ref|YP_003990342.1| ornithine carbamoyltransferase [Geobacillus sp. Y4.1MC1]
 gi|311217127|gb|ADP75731.1| ornithine carbamoyltransferase [Geobacillus sp. Y4.1MC1]
          Length = 313

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 153/305 (50%), Positives = 206/305 (67%), Gaps = 5/305 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K F  L +IS+ ++  ++ +A+++K        + PL+GK LAMIFEKPSTRTRVSFE
Sbjct: 8   KGKDFLTLIDISTEDIYDLLALAEELKQKQLAGQSHAPLAGKTLAMIFEKPSTRTRVSFE 67

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M  LGG  ++L+ S++QLGR ETI DTA+VLS+YVDAI++RT  HS+L EL  YAT+P
Sbjct: 68  VGMTQLGGSALYLNSSDLQLGRGETIADTARVLSQYVDAIMIRTFAHSKLEELAAYATIP 127

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD+ HPCQ +AD++T  E + ++KG   ++ GDGNN+ ++L+  AA+      IA
Sbjct: 128 VINGLTDDDHPCQALADLLTIYEVKKTLKGLKLAYVGDGNNVANALMIAAAKVGMDCVIA 187

Query: 184 TPIGSEPRNEYLNWARNQGASV----ALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REE 238
            P G EP+ +Y++ A   G       A+ HD V+AV  A  ++TD W SM QE ++ +  
Sbjct: 188 CPAGYEPKEKYIDAAEQIGKQTGAAVAVTHDPVEAVANADVIYTDVWTSMGQEQESEQRL 247

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
            VFQPFQVN  L+  A  D LF+HCLPAHRGEEV  EV+DGP S VF +A NRLH QKA+
Sbjct: 248 TVFQPFQVNGELVKHAKQDYLFLHCLPAHRGEEVTAEVIDGPNSFVFQQAGNRLHAQKAV 307

Query: 299 LLWCF 303
           LL   
Sbjct: 308 LLSLL 312


>gi|227825140|ref|ZP_03989972.1| ornithine carbamoyltransferase [Acidaminococcus sp. D21]
 gi|226905639|gb|EEH91557.1| ornithine carbamoyltransferase [Acidaminococcus sp. D21]
          Length = 313

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 123/308 (39%), Positives = 179/308 (58%), Gaps = 5/308 (1%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M    K    + ++S   ++ I++V++K+K   +    ++ L GK LAMIF K STRTRV
Sbjct: 1   MALKNKDLISIHDLSVGEVATILDVSRKLKKKQKMGEPHEYLKGKTLAMIFSKASTRTRV 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFE     LGG  I++S +  Q+GR E + DTA+VLSR+VD I++RT +H  + EL  YA
Sbjct: 61  SFETGFHQLGGHPIYMSEATSQIGRGEPVKDTARVLSRFVDGIMIRTYSHEAVKELAAYA 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +VPVIN LTD  HPCQ + D+ T  E++  +KG+   + GDGNN+ HSL+   A+    +
Sbjct: 121 SVPVINGLTDLLHPCQALTDLFTIMEYKEVLKGRKLVFVGDGNNMAHSLMYACAKVGMNM 180

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN-----QEFKA 235
             A+P G  P  + L  A+   A         + V  A       +  +      +    
Sbjct: 181 VCASPKGYYPDPQVLKQAQEDAALTGASITVEEDVMKAAEGADVLYTDVWASMGEEAEHE 240

Query: 236 REEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
                FQ +Q+N +L+ +A PDA+ +HCLPAHRGEE+ ++V++GP S VFDEAENRLH Q
Sbjct: 241 ERVKKFQGYQINQALLDVARPDAMVLHCLPAHRGEEITDDVIEGPHSAVFDEAENRLHVQ 300

Query: 296 KAILLWCF 303
           KAI+    
Sbjct: 301 KAIMALLM 308


>gi|152979907|ref|YP_001352538.1| ornithine carbamoyltransferase [Janthinobacterium sp. Marseille]
 gi|151279984|gb|ABR88394.1| ornithine carbamoyltransferase [Janthinobacterium sp. Marseille]
          Length = 304

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 128/300 (42%), Positives = 173/300 (57%), Gaps = 3/300 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF   S+++      +IE  + IK   +N     PLS + L M+FEK STRTR+SFE  
Sbjct: 4   KHFLQFSDLTLDEFEHVIERTRVIKRKFKNYEPYHPLSDRTLVMVFEKNSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  I+L+  + QLGR E + D A+V+SR  D I++RT     +      + VPVI
Sbjct: 64  MHQLGGAAIYLNTRDSQLGRGEPVEDAAQVMSRMCDIIMIRTFGQEIIERFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQ++AD+ T+ E RGS+KGK  +W GD NN+L+S ++ A  F++ +N++TP
Sbjct: 124 NGLTNEHHPCQVLADVFTYIEQRGSIKGKTVAWIGDANNMLYSWLQAAQVFDFHVNVSTP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G E     +          A   DA             +     +E  A     F  + 
Sbjct: 184 KGYEIDPTLVAQDNTHYTLYASPSDACAGAHLVTTDVWTSM--GFEEENAARLKAFDGWI 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC-FG 304
           V+ + M  A PDALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA+L +   G
Sbjct: 242 VDAAKMKRAQPDALFMHCLPAHRGEEVAAEVIDGPQSVVWDEAENRLHVQKALLEYLVLG 301


>gi|293401569|ref|ZP_06645712.1| ornithine carbamoyltransferase [Erysipelotrichaceae bacterium
           5_2_54FAA]
 gi|291305207|gb|EFE46453.1| ornithine carbamoyltransferase [Erysipelotrichaceae bacterium
           5_2_54FAA]
          Length = 302

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 116/301 (38%), Positives = 168/301 (55%), Gaps = 1/301 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH   L+++S   L  ++++A  +K   +     K L  K L MIF K STRTRVSFEV
Sbjct: 1   MKHLLTLADLSKDELYELLDLADALKKEVKKGIYTKYLRNKALGMIFTKSSTRTRVSFEV 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M+ LGG  ++L+ ++MQLGR E I DTA+VLSRYVD I++RT   S L EL EY ++P+
Sbjct: 61  GMQQLGGKALYLNANDMQLGRGEPIKDTARVLSRYVDGIMIRTYKQSDLEELAEYGSIPI 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD  HPCQ++AD+ T  E++GS++G    + G GNN+ +S I G       + +A 
Sbjct: 121 INGLTDYVHPCQVLADLQTIREYKGSLEGLKLCYIGAGNNMANSYINGCILAGMQVALAC 180

Query: 185 PIGS-EPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQP 243
           P             A     ++     A               +    E + R +     
Sbjct: 181 PKEYLPDTQICAKAATTGRFTLTQDPLAAAKDADVVVTDVWASMGEEGEAEKRRQIFEGV 240

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +Q+N ++M+ A  DA+ +HCLPAHR EE+  +V +   + +FDEAENRLH QKA+L+   
Sbjct: 241 YQINDAVMAQAKKDAMVLHCLPAHREEEITAKVFEEHANEIFDEAENRLHAQKAVLVKLL 300

Query: 304 G 304
           G
Sbjct: 301 G 301


>gi|319649994|ref|ZP_08004143.1| ornithine carbamoyltransferase [Bacillus sp. 2_A_57_CT2]
 gi|317398175|gb|EFV78864.1| ornithine carbamoyltransferase [Bacillus sp. 2_A_57_CT2]
          Length = 318

 Score =  223 bits (568), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 143/305 (46%), Positives = 193/305 (63%), Gaps = 5/305 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K F  L++ SS  +  ++E AK++K +     E   L GK+L MIFEK STRTRVSFE
Sbjct: 14  KGKDFLTLADFSSEEIKGLLEKAKQLKEAHLQGAETPSLKGKILGMIFEKSSTRTRVSFE 73

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
             M  LGG  ++L+  ++QLGR E+I DTAKVLS+YVDAI++RT +H+++ EL  +A +P
Sbjct: 74  AGMLQLGGHALYLNSQDLQLGRGESIADTAKVLSQYVDAIMIRTFSHAKIQELAHHADIP 133

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQ +AD++T EE  G +KG+   + GDGNN+ HSL+  +A+    + IA
Sbjct: 134 VINGLTDLYHPCQALADLLTIEEKNGELKGQNLVYVGDGNNVAHSLMIASAKMGVNITIA 193

Query: 184 TPIGSEPRNEYLN----WARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREE 238
            PIG EP N  L     +A   G+ V +  +  +AV  A  ++TD W SM QE +  +  
Sbjct: 194 CPIGYEPDNFVLQQSQEFAEQSGSKVKITSNPEEAVANADAIYTDVWTSMGQEDENEQRL 253

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F  +QVN  L+  A  D +F+HCLPAHRGEEV  EV+DG  S VF +A NRLH QKAI
Sbjct: 254 KDFADYQVNEYLVQKAKKDYVFLHCLPAHRGEEVTAEVIDGNNSAVFQQAGNRLHVQKAI 313

Query: 299 LLWCF 303
           L    
Sbjct: 314 LSEIL 318


>gi|170077297|ref|YP_001733935.1| ornithine carbamoyltransferase [Synechococcus sp. PCC 7002]
 gi|169884966|gb|ACA98679.1| ornithine carbamoyltransferase [Synechococcus sp. PCC 7002]
          Length = 306

 Score =  223 bits (568), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 122/307 (39%), Positives = 186/307 (60%), Gaps = 9/307 (2%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             +    ++++SS+ +  ++ +A  +K              K L ++F K STRTRVSF 
Sbjct: 5   KGRDLLSIADLSSTEIITLLNLAADLKQGKIAPTCP-----KTLGLLFYKASTRTRVSFS 59

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VAM  LGG+ I L+ +  Q+GR E I DTA+VL RY+D + +RT +   L    +Y  +P
Sbjct: 60  VAMYQLGGNVIDLNPNRTQVGRGEPIEDTARVLDRYLDILAIRTFDQQDLETFADYCEMP 119

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           +INALTD  HPCQ++AD+ T +E  G ++G   ++ GDGNN+ HS++ G A     + IA
Sbjct: 120 IINALTDLEHPCQMLADLQTMQETFGQLEGLTMTYVGDGNNVAHSILLGGALVGMNIRIA 179

Query: 184 TPIGSEPRNEYLNWARNQGASVALF---HDAVQAVKGAHCVFTDTWISMNQEFKAR-EEH 239
           TP   EP  + +  A+      +     HD  +A +G H ++TD W SM QE  A     
Sbjct: 180 TPKDYEPSPKIVAQAQAIAGDRSQILITHDPKEAAEGCHAIYTDVWASMGQEDLANSRVP 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           +FQP+QVN  LM++A  +A+ +HCLPAHRGEE+  +V++GPQ+ ++D+AENR+H QKA++
Sbjct: 240 IFQPYQVNAELMALADKEAIALHCLPAHRGEEITADVMEGPQAKIWDQAENRMHAQKALM 299

Query: 300 LWCFGII 306
               GI+
Sbjct: 300 ASLLGIV 306


>gi|296273196|ref|YP_003655827.1| ornithine carbamoyltransferase [Arcobacter nitrofigilis DSM 7299]
 gi|296097370|gb|ADG93320.1| ornithine carbamoyltransferase [Arcobacter nitrofigilis DSM 7299]
          Length = 308

 Score =  223 bits (568), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 135/306 (44%), Positives = 197/306 (64%), Gaps = 6/306 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            +HF  +++ S   L  I+++A +IK  ++     + L  +VL MIFEK STRTRVSFE 
Sbjct: 1   MRHFLTIADFSKEELLEILDLAIQIKAETKQRNFKEYLPKQVLGMIFEKSSTRTRVSFET 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG  +FLS +++QLGR E + DT++V+SR VD +++RT  HS+L E  +Y+ VPV
Sbjct: 61  GIYQLGGIGLFLSSNDIQLGRGEPMSDTSRVISRMVDMVMIRTFEHSKLEEFAQYSKVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD+ HP Q++AD +T     G  K  + ++ GDGNN+ HS +  AA+  + L IAT
Sbjct: 121 INGLTDDFHPVQLLADYLTII-EEGKDKDLVAAYVGDGNNLAHSWLMLAAKLGFELRIAT 179

Query: 185 PIGSEPRNEYLN----WARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEH 239
           P G E   + L+    +A+  GA + + +D ++A+K A  V TDTW+SM QE +  +   
Sbjct: 180 PKGYEVNQKILDRALEFAKISGAKIVIGNDPIEAIKNATVVTTDTWVSMGQEDEKEKRVK 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  + V+  LMS A+ +A+F+HCLPA+R  EV  EV +GPQS VF+EAENRLH QK I+
Sbjct: 240 DFTGYIVDTKLMSYANSNAIFLHCLPAYREYEVSEEVFEGPQSKVFEEAENRLHAQKGIM 299

Query: 300 LWCFGI 305
           +W  G 
Sbjct: 300 VWLDGK 305


>gi|89094676|ref|ZP_01167612.1| ornithine carbamoyltransferase [Oceanospirillum sp. MED92]
 gi|89081022|gb|EAR60258.1| ornithine carbamoyltransferase [Oceanospirillum sp. MED92]
          Length = 301

 Score =  223 bits (568), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 145/303 (47%), Positives = 194/303 (64%), Gaps = 5/303 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M+  +HF  L ++SS  L  +++ A ++K         +PL  KV+AMIFEK STRTRVS
Sbjct: 1   MST-RHFLTLRDLSSEELRTLVKRASELKAIRNRGEVYEPLKNKVMAMIFEKSSTRTRVS 59

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M   GG  +FLS  + QLGR E I D+AKV+S  VD +++RT +H  + E    +T
Sbjct: 60  FEAGMAQFGGHAMFLSPRDTQLGRGEPISDSAKVISSMVDVVMIRTFSHQLVEEFAANST 119

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVINALTD  HPCQ++AD+ T+ EHRG ++GK  +W GDGNN+ HS I  A + ++ LN
Sbjct: 120 VPVINALTDEYHPCQLLADMQTYFEHRGDIQGKTVTWIGDGNNMCHSYINAARQLDFKLN 179

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHV 240
           IA P G +P  + +   + +          V+AV G+  V TD W SM QE +    E  
Sbjct: 180 IACPEGFDPDEKLVAENQERIFITR---SPVEAVTGSDLVVTDVWASMGQEEEQKEREAK 236

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F  FQV+ +LM  A+ DALFMHCLPAHRGEEV  ++L+ P+SVVFDEAENRLH QKA+L 
Sbjct: 237 FDGFQVSPALMDNANKDALFMHCLPAHRGEEVSMDMLEDPRSVVFDEAENRLHAQKALLE 296

Query: 301 WCF 303
           +  
Sbjct: 297 FLM 299


>gi|83309416|ref|YP_419680.1| ornithine carbamoyltransferase [Magnetospirillum magneticum AMB-1]
 gi|82944257|dbj|BAE49121.1| Ornithine carbamoyltransferase [Magnetospirillum magneticum AMB-1]
          Length = 305

 Score =  223 bits (568), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 165/299 (55%), Positives = 208/299 (69%), Gaps = 4/299 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           P+HF DL    ++ L  I+++    K          PL+GK+LAMIFEKPSTRTRVSFEV
Sbjct: 10  PRHFLDLDGFDTATLRHILDLGLAYKQGK---GPKAPLAGKMLAMIFEKPSTRTRVSFEV 66

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            MK LGGD I L+  + QLGR ETI DTA+VLSR+VDA+++RT    +L EL +YA VPV
Sbjct: 67  GMKQLGGDVIMLAAGDTQLGRGETIADTARVLSRFVDAVMIRTNLPEKLTELAKYADVPV 126

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD +HPCQ++AD+MTFEEHRGS+KGK+ +W GDGNN+  S I  A  F   + +A 
Sbjct: 127 INGLTDQSHPCQVMADVMTFEEHRGSLKGKVVAWVGDGNNVAASWIHAAGHFGCEIRLAC 186

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P    P    ++WAR +GASV L     +AV GAH V TDTW+SM  +  +    + +P+
Sbjct: 187 PDSLMPSRAAVDWARAKGASVVLTTHPAEAVAGAHLVLTDTWVSMGCQD-SNRHELLEPY 245

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           QVN +LM+ A PDALFMHCLPAHRGEEV + V+DG QSVV+DEAENR+H QK IL WC 
Sbjct: 246 QVNEALMAKAAPDALFMHCLPAHRGEEVTDPVMDGIQSVVWDEAENRMHVQKGILTWCL 304


>gi|119898478|ref|YP_933691.1| ornithine carbamoyltransferase [Azoarcus sp. BH72]
 gi|189036316|sp|A1K7J9|OTC_AZOSB RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|119670891|emb|CAL94804.1| ArgF protein [Azoarcus sp. BH72]
          Length = 311

 Score =  223 bits (568), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 134/307 (43%), Positives = 188/307 (61%), Gaps = 4/307 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M+ P+H+   S+ +++    + +  + IK   +      PL  + L MIFEK STRTR+S
Sbjct: 1   MSSPRHYLQFSDFTAAEYDHVFQRTRWIKEKFKQYEPYHPLFDRTLVMIFEKASTRTRLS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M+ LGG  I+L+  + QLGR E + D A+V+SR  D +++RT     +     Y+ 
Sbjct: 61  FEAGMQQLGGSAIYLNTRDSQLGRGEPVEDAAQVISRMSDLVMIRTFEQDIIERFAAYSR 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LT+  HPCQI+ADI TF EHRGS+KGK  +W GD NN+ ++ ++ A   ++ + 
Sbjct: 121 VPVINGLTNEYHPCQILADIYTFIEHRGSIKGKTVAWVGDSNNMCNTWLQAAEVLDFKVR 180

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHV 240
           ++TP G     E  +      A  A F D ++A +GA  V TD W SM  E +       
Sbjct: 181 VSTPPGY--EVEPTDAGLRGTAHFAQFSDPLEACRGADLVTTDVWTSMGFEAENEARMKA 238

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F  + V+  +MS+A PDALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA++ 
Sbjct: 239 FADWCVDAEMMSVAAPDALFMHCLPAHRGEEVTAEVIDGPQSVVWDEAENRLHVQKALME 298

Query: 301 WC-FGII 306
           +   G +
Sbjct: 299 YLVLGRV 305


>gi|163847143|ref|YP_001635187.1| ornithine carbamoyltransferase [Chloroflexus aurantiacus J-10-fl]
 gi|222524980|ref|YP_002569451.1| ornithine carbamoyltransferase [Chloroflexus sp. Y-400-fl]
 gi|163668432|gb|ABY34798.1| ornithine carbamoyltransferase [Chloroflexus aurantiacus J-10-fl]
 gi|222448859|gb|ACM53125.1| ornithine carbamoyltransferase [Chloroflexus sp. Y-400-fl]
          Length = 309

 Score =  223 bits (568), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 138/310 (44%), Positives = 193/310 (62%), Gaps = 7/310 (2%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFEN-KPLSGKVLAMIFEKPSTRTRV 60
           MT  +HF   ++++ +    +++ A  +K +      N +PL G+ LA++FEKPS RTRV
Sbjct: 1   MTL-RHFLSAADLNRAEAEALLDRAAMLKAAWRAGQVNDRPLLGQTLALVFEKPSLRTRV 59

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           +FE  M  LGG   +LS +++ +G  E++ D A+ LSR+V  I  R   H+ +  L  YA
Sbjct: 60  AFEAGMTQLGGHPSYLSANDIDMGGRESVPDVARNLSRWVAIIAARVFKHATVETLARYA 119

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVINAL+D  HPCQ +AD++T  E  G ++G   ++ GDGNN+ HSL+   A     L
Sbjct: 120 TVPVINALSDREHPCQALADMLTLRERFGRLQGLTLAYVGDGNNVCHSLMLLGATLGLNL 179

Query: 181 NIATPIGSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA- 235
            I  P    P  + +      A+   A++A+    V+AV GA  V+TD W SM QE +A 
Sbjct: 180 RIGCPPDYRPAPDIIELTERLAQEHDATLAITASPVEAVSGADAVYTDVWASMGQEHEAA 239

Query: 236 REEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
           R   VF P+QVN +LM+ A P AL MHCLPAHRGEEV  EV+DGPQSVVF++AENRLH Q
Sbjct: 240 RRRPVFTPYQVNTALMAHAAPHALAMHCLPAHRGEEVTAEVIDGPQSVVFEQAENRLHVQ 299

Query: 296 KAILLWCFGI 305
           KA++L+  G 
Sbjct: 300 KALILFLLGK 309


>gi|326315993|ref|YP_004233665.1| ornithine carbamoyltransferase [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323372829|gb|ADX45098.1| ornithine carbamoyltransferase [Acidovorax avenae subsp. avenae
           ATCC 19860]
          Length = 309

 Score =  223 bits (568), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 125/299 (41%), Positives = 181/299 (60%), Gaps = 1/299 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH+    ++S  + + + E A  IK   ++  ++ PL+ + LAMIFEK STRTRVSFE 
Sbjct: 7   MKHYLQFKDLSPEDYAYLFERAAVIKGKFKSYEKHHPLTDRTLAMIFEKASTRTRVSFEA 66

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG  + L+  + QLGRAE I D+AKV+SR VD +++RT   +++     ++ VPV
Sbjct: 67  GMYQLGGSVVHLTTGDSQLGRAEPIEDSAKVISRMVDLVMIRTYEQTKIERFAAHSRVPV 126

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LT+  HPCQI+ADI TF EHRGS++G+  +W GDGNN+ ++ ++ A    + ++++T
Sbjct: 127 INGLTNEFHPCQILADIFTFIEHRGSIQGRTVAWVGDGNNMANTWLQAAELLGFTVHVST 186

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P G E  +     A      V                   T +    E +A  +  F  +
Sbjct: 187 PSGYEVDSRIAGVAAGSHYKVFSDPLEACRGADLITTDVWTSMGYEAENEA-RKKAFADW 245

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
            V+  +M+ A PDALFMHCLPAHRGEEV  +V+DGPQSVV+DEAENR+H QKA++ +  
Sbjct: 246 CVDAEMMAAARPDALFMHCLPAHRGEEVEADVIDGPQSVVWDEAENRMHVQKALMEYLL 304


>gi|291533644|emb|CBL06757.1| ornithine carbamoyltransferase [Megamonas hypermegale ART12/1]
          Length = 309

 Score =  223 bits (568), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 134/309 (43%), Positives = 193/309 (62%), Gaps = 6/309 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M   K    + +++S  +  I+ +A ++K   +   E+  L GK L MIFEK STRTRVS
Sbjct: 1   MLKGKDLLSIHDLTSDEVMEILNLAHELKAKQKAGIEHHILKGKTLGMIFEKSSTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FEV M  LGG  +FLS  ++Q+GR E I DTA+VLSRY+D +++RT  H  + E  +YA+
Sbjct: 61  FEVGMYQLGGQALFLSNRDLQIGRGEPIKDTARVLSRYLDGVMIRTFGHEIVEEFAQYAS 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSV-KGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +PVINALTD  HPCQ + D++T +EH+G   KG   ++ GDGNN+ HSL+   A+     
Sbjct: 121 IPVINALTDLLHPCQALTDLLTAQEHKGKDLKGLKMAYIGDGNNMTHSLMYACAKVGMNF 180

Query: 181 NIATPIGSEPRNEYLN----WARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR 236
             A+P G EP  + +      A   G+++ + +D  +A K A  ++TD W SM QE +  
Sbjct: 181 ASASPKGYEPNAQVVANAKLDAAQSGSTIEILNDPFEAAKDADILYTDVWASMGQEAEHD 240

Query: 237 -EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
               +F+ +Q+N  L+ +A   A+ MHCLPAHRGEE+  +VL+   +V+FDEAENRLHTQ
Sbjct: 241 ERVKIFKDYQINNELLRVADKRAIVMHCLPAHRGEEIAEDVLEKNANVIFDEAENRLHTQ 300

Query: 296 KAILLWCFG 304
           KAI+    G
Sbjct: 301 KAIMALLMG 309


>gi|171057595|ref|YP_001789944.1| ornithine carbamoyltransferase [Leptothrix cholodnii SP-6]
 gi|170775040|gb|ACB33179.1| ornithine carbamoyltransferase [Leptothrix cholodnii SP-6]
          Length = 320

 Score =  223 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 119/312 (38%), Positives = 182/312 (58%), Gaps = 11/312 (3%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M+  KH+    ++ +   + + E A+ IK   +N  +  PL  + LAMIFEK STRTRVS
Sbjct: 5   MSLMKHYLQFKDLRAEEYAYLFERARNIKTRFKNYEKYTPLVDRTLAMIFEKASTRTRVS 64

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  +GG  + L+  + QLGR+E + D+A+V+SR VD +++RT   +++ +   ++ 
Sbjct: 65  FEAGMYQMGGSVVHLTTGDSQLGRSEPVEDSARVISRMVDIVMIRTYEQTKIEQFAAHSR 124

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHR----------GSVKGKLFSWSGDGNNILHSLIE 171
           VPVIN LT+  HPCQI+AD+ T+ EHR            +KG++ +W GDGNN+ ++ ++
Sbjct: 125 VPVINGLTNEFHPCQILADLYTWLEHRGTLSAAGVDLSCLKGRVVAWVGDGNNMANTWLQ 184

Query: 172 GAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQ 231
            A    + ++++TP G E        A +    V                   T +    
Sbjct: 185 AAEILGFTVHVSTPGGYEVDPVVAGIASSDCYKVFDDPREACRGADLVTTDVWTSMGYEA 244

Query: 232 EFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENR 291
           E +A  +  F  + V+ ++M+ A PDALFMHCLPAHRGEEV  +V+DGPQSVV+DEAENR
Sbjct: 245 ENEA-RKKAFALWCVDAAMMAAAKPDALFMHCLPAHRGEEVTADVIDGPQSVVWDEAENR 303

Query: 292 LHTQKAILLWCF 303
           +H QKA++ +  
Sbjct: 304 MHVQKALMEYLL 315


>gi|297172479|gb|ADI23451.1| ornithine carbamoyltransferase [uncultured nuHF1 cluster bacterium
           HF0770_35I22]
          Length = 305

 Score =  223 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 155/298 (52%), Positives = 202/298 (67%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF DL  ++S+ L  II+ AKKIK+        K LSGK L  IFEKPSTRTRVSF++ 
Sbjct: 7   RHFLDLDLMTSNVLRQIIDDAKKIKSEHFLGRSKKTLSGKNLVCIFEKPSTRTRVSFQIG 66

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG    L      +G+ E+I DTA+VLSRY DAI+ RT +  +L EL +++++PVI
Sbjct: 67  MQQLGGSVTVLDDVNSHMGQGESIADTARVLSRYADAIMFRTDDPKKLQELAQHSSIPVI 126

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD +HPCQI+ADI+TFEEHRGS+ GK  +WSGDGNN+L S +  A  F + + +  P
Sbjct: 127 NGLTDFSHPCQIMADILTFEEHRGSIFGKTIAWSGDGNNVLTSWLHAAVHFGFEVKVGCP 186

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
              +P    + W  + GA + +F  AV AV+ A  V TDTW+SM  E  +        F+
Sbjct: 187 GDCQPDPRVVKWGLDNGAVIKIFDTAVDAVRNADLVITDTWVSMGDEDVSNRRDRLSLFK 246

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           V+  LMS+A  DALFMHCLPAHRGEEV +EV+DGPQSV++DEAENRLH QK+IL WC 
Sbjct: 247 VDSRLMSLAAKDALFMHCLPAHRGEEVTDEVMDGPQSVIWDEAENRLHAQKSILAWCL 304


>gi|323698300|ref|ZP_08110212.1| ornithine carbamoyltransferase [Desulfovibrio sp. ND132]
 gi|323458232|gb|EGB14097.1| ornithine carbamoyltransferase [Desulfovibrio desulfuricans ND132]
          Length = 299

 Score =  223 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 147/301 (48%), Positives = 189/301 (62%), Gaps = 4/301 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
            PKHF  + +I    +  +I  AK++K+          L GK L +IFEK STRTRVSFE
Sbjct: 1   MPKHFLTILDIPKDEVRQVILRAKEMKDGK---VRTDLLDGKTLLLIFEKASTRTRVSFE 57

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V ++ LGG+ +F+S  + QLGR+E I DTA+VLSRY D I+MRT    +L  L +Y  +P
Sbjct: 58  VGVRQLGGEPVFISARDSQLGRSEPIKDTARVLSRYADGIIMRTFGQEKLETLVDYGDIP 117

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           V+NALTD  HPCQ++ADI+T  E    +     +W GDGNN+ HS I GAA F Y L++A
Sbjct: 118 VVNALTDEYHPCQVMADILTMYERTPDLDKVKVAWVGDGNNMAHSFINGAAAFGYELSLA 177

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQ 242
            P G  P    L+ A N GA + L  D  +AV GA  V TD W SM QE +  + E  F 
Sbjct: 178 CPEGYAPDAAILDKAVNLGARITLTDDPKRAVDGADYVNTDVWASMGQEEEQKKREVAFA 237

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            + V+ +LM +A P A FMHCLPAHRGEEV   V + P S+V+D+AENRLH QKAIL W 
Sbjct: 238 GYMVDEALMGLAAPGASFMHCLPAHRGEEVSEAVFESPASIVWDQAENRLHAQKAILEWI 297

Query: 303 F 303
           F
Sbjct: 298 F 298


>gi|114799893|ref|YP_759321.1| ornithine carbamoyltransferase [Hyphomonas neptunium ATCC 15444]
 gi|123129109|sp|Q0C4M2|OTC_HYPNA RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|114740067|gb|ABI78192.1| ornithine carbamoyltransferase [Hyphomonas neptunium ATCC 15444]
          Length = 308

 Score =  223 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 146/309 (47%), Positives = 195/309 (63%), Gaps = 6/309 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-----PLSGKVLAMIFEKPST 56
           MT  +HF D+  + S+ L  I++ A  +K +     + K     PL G  LAMIFEK ST
Sbjct: 1   MTI-RHFLDIWPLESAELRAILDQAHAMKKARAGWPKGKIDAGAPLDGHTLAMIFEKSST 59

Query: 57  RTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLEL 116
           RTR SF++AM+ LGG +I  + ++MQLGR ET+ DTAKVLSR+VDA+++R  +H+ +   
Sbjct: 60  RTRFSFDMAMRQLGGSSITATSNDMQLGRGETVEDTAKVLSRFVDAVMIRANDHADVEAF 119

Query: 117 TEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARF 176
            + A+VPVIN LTD +HPCQI+AD+MT EEH  +++G   +W GDGNN+  S I  A +F
Sbjct: 120 ADAASVPVINGLTDRSHPCQIMADLMTLEEHGLTLRGARLAWVGDGNNVCASFIHAAPKF 179

Query: 177 NYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR 236
            + L + TP    P  + L  A      + L+  A +AV GA  V  DT++SM      R
Sbjct: 180 GFSLAVGTPKRFAPDEDDLEIAAELQGRIDLYETAEEAVAGADVVIADTFVSMGDVDAER 239

Query: 237 EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
              +  P+ V   LM +A   A F+HCLPAHRGEEV  EV+DGP S+VFDEAENRLH QK
Sbjct: 240 RLEILDPYAVTEELMELAAGGAKFLHCLPAHRGEEVDAEVIDGPASLVFDEAENRLHAQK 299

Query: 297 AILLWCFGI 305
           AIL WC G 
Sbjct: 300 AILRWCLGK 308


>gi|313201358|ref|YP_004040016.1| ornithine carbamoyltransferase [Methylovorus sp. MP688]
 gi|312440674|gb|ADQ84780.1| ornithine carbamoyltransferase [Methylovorus sp. MP688]
          Length = 305

 Score =  223 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 120/302 (39%), Positives = 170/302 (56%), Gaps = 2/302 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF    +++   L  I E  + IK   +   +  PL+ + L MIFEK STRTR+SFE  
Sbjct: 4   KHFLQFKDLNREELDHIFERTRWIKQQFKAYQQYWPLTDRTLVMIFEKASTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG  I+L+  + QLGR E + D A+V+SR  D +++RT     +      + VPVI
Sbjct: 64  MQQLGGSAIYLNTRDSQLGRGEPVEDAAQVISRMSDIVMIRTFEQEIIERFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI TF EHRG ++GK  +W GD NN+ ++ ++ A   ++ ++++TP
Sbjct: 124 NGLTNEYHPCQILADIFTFIEHRGPIQGKTVAWIGDSNNVCNTWLQAAEVLDFNVHVSTP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G E   E      ++                       T +    E +      F  +Q
Sbjct: 184 PGYEVEPERAGLYGHEHYEEFTDPMEAARGADLVTTDVWTSMGFEAENEE-RMRDFADWQ 242

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL-LWCFG 304
           V+  +M +A  DALFMHCLPAHRGEEV  EV+DGP SVV+DEAENRLH QKA++     G
Sbjct: 243 VDADMMRVAKSDALFMHCLPAHRGEEVAAEVIDGPHSVVWDEAENRLHVQKALMEYLLLG 302

Query: 305 II 306
            +
Sbjct: 303 KV 304


>gi|192359088|ref|YP_001983334.1| ornithine carbamoyltransferase [Cellvibrio japonicus Ueda107]
 gi|190685253|gb|ACE82931.1| ornithine carbamoyltransferase [Cellvibrio japonicus Ueda107]
          Length = 305

 Score =  223 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 141/300 (47%), Positives = 192/300 (64%), Gaps = 4/300 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           P+HF  L++++S+ L  II  A ++K              KVLAMIFEK STRTRVSFE 
Sbjct: 7   PRHFLTLNDVNSAELQHIIARAIELKALLRQGKAPALFDNKVLAMIFEKNSTRTRVSFES 66

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG  IFLS  + QLGR E I D A+ ++  VD +++RT  H+ +    EY+ VPV
Sbjct: 67  GVAKLGGHAIFLSTKDSQLGRGEPIEDAARCIASMVDMVMIRTYGHATVERFAEYSRVPV 126

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD  HPCQ++ADI T+ E RGS+ GK  +W GDGNN+ +S I+ A   ++ L IAT
Sbjct: 127 INGLTDEYHPCQLLADIQTYVEQRGSLAGKTVAWVGDGNNMCNSYIQAAELCDFELRIAT 186

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQP 243
           P G EP +E++          ++ +D  +AV GA  V TDTW SM QE +  + E +F  
Sbjct: 187 PKGFEPEDEFVTP---YQHRASVSNDPREAVAGADLVVTDTWASMGQEDEKKQREKIFIG 243

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +QVN  LMS A  DALFMHCLPA+RG+EV  ++LD P +VV++EAENR+H Q A++ + F
Sbjct: 244 YQVNKELMSYAKSDALFMHCLPAYRGKEVSADILDAPDAVVWEEAENRMHAQNALMEFLF 303


>gi|304407669|ref|ZP_07389320.1| ornithine carbamoyltransferase [Paenibacillus curdlanolyticus YK9]
 gi|304343152|gb|EFM08995.1| ornithine carbamoyltransferase [Paenibacillus curdlanolyticus YK9]
          Length = 318

 Score =  223 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 133/305 (43%), Positives = 191/305 (62%), Gaps = 5/305 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             + F  L++ S   +  +I++A  IK   +     +PL GK L M+FEK STRTRVSFE
Sbjct: 14  KGRDFLALADYSPEEVRYLIDLAIDIKKKQKAGEVYQPLKGKTLGMVFEKSSTRTRVSFE 73

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V +  LGG  +FLS +++Q+GR E I DT +VLSRY+D I++RT  H  +++L   +TVP
Sbjct: 74  VGIYQLGGQGLFLSRNDLQIGRGEPIWDTGQVLSRYLDGIMIRTFAHKIVIDLARSSTVP 133

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQ + D  T  EH+G ++G   ++ GDGNN+ HSL+ GAA+    +++A
Sbjct: 134 VINGLTDAAHPCQALCDYQTVLEHKGRLEGLKIAYIGDGNNMTHSLLMGAAKLGMNMSVA 193

Query: 184 TPIGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           +P G E   + +      A   G+ + +  D  +A++GA  V++D W SM  E + +E  
Sbjct: 194 SPEGYEADPDIVAQTKAVAAGTGSQIHVCRDPREAIEGADIVYSDVWASMGFEAEQKERE 253

Query: 240 V-FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
           + F  +QVN  L+  A  D LFMHCLPAHRGEEV   V+DG  S+++D+AENRLH QKAI
Sbjct: 254 IAFANYQVNEELVKYAKSDYLFMHCLPAHRGEEVSEGVIDGKHSIIYDQAENRLHAQKAI 313

Query: 299 LLWCF 303
           +    
Sbjct: 314 MAAIM 318


>gi|325981797|ref|YP_004294199.1| ornithine carbamoyltransferase [Nitrosomonas sp. AL212]
 gi|325531316|gb|ADZ26037.1| ornithine carbamoyltransferase [Nitrosomonas sp. AL212]
          Length = 308

 Score =  223 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 131/302 (43%), Positives = 178/302 (58%), Gaps = 2/302 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF   ++        + E A+ IK   +   +  PLS + LAMIF+K STRTR+SFE  
Sbjct: 4   KHFLQFNDFCRDEYEYLFERARWIKKEFKQYRQYWPLSDRTLAMIFDKNSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  I+LS  + QLGR E + D A+V+SR VD I++RT  H  +    E + VPVI
Sbjct: 64  MHQLGGAAIYLSTRDTQLGRGEPVEDAARVISRMVDLIMVRTYQHDTIKRFAENSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQI++DI T+ E RGS++ K  +W GD NN+ ++ ++ A  FN+ ++++TP
Sbjct: 124 NGLTDEYHPCQIMSDIFTYIEFRGSIEEKTVAWIGDSNNMCNTWLQAAEIFNFQVHVSTP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G +   E +         +                   T +   +E + R ++ F  F 
Sbjct: 184 PGYDIDPERIGLNGTAHYEIYTNPREAVMNADLVTTDVWTSMGFEEEVE-RRKNDFAAFC 242

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL-LWCFG 304
           VN  +MS+A  DALFMHCLPAHRGEEV  EVLDGPQSVV+DEAENRLHTQKA++     G
Sbjct: 243 VNKEMMSLAKSDALFMHCLPAHRGEEVSAEVLDGPQSVVWDEAENRLHTQKALMEYLLLG 302

Query: 305 II 306
            I
Sbjct: 303 KI 304


>gi|186475297|ref|YP_001856767.1| ornithine carbamoyltransferase [Burkholderia phymatum STM815]
 gi|184191756|gb|ACC69721.1| ornithine carbamoyltransferase [Burkholderia phymatum STM815]
          Length = 309

 Score =  223 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 126/308 (40%), Positives = 175/308 (56%), Gaps = 4/308 (1%)

Query: 2   MTYP--KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    +H+   ++ S  +   ++E A+ +K   +N     PL  + LAMIFEK STRTR
Sbjct: 1   MTAKTIRHYLQFNDFSLEDYEYVLERARILKRKFKNYETYHPLHDRTLAMIFEKNSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +F+S  + QLGR E I D A+V+SR VD I++RT     +    E 
Sbjct: 61  LSFEAGIFQLGGHAVFMSTRDTQLGRGEPIEDAAQVISRMVDIIMIRTFGQDIIQRFAEN 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT+  HPCQ++ADI T+ EHRG ++GK  +W GD NN+L++ IE A    + 
Sbjct: 121 SRVPVINGLTNEYHPCQVLADIFTYYEHRGPIRGKTVAWVGDANNMLYTWIEAAQILGFT 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L ++TP G +     +              +              T +    E +A  + 
Sbjct: 181 LRLSTPPGYKLDRALVAPESAPFYEEFDDPNEACKGADLVTTDVWTSMGFEAENEA-RKK 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  + V+  +MS A  DALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA++
Sbjct: 240 AFADWCVDADMMSRASKDALFMHCLPAHRGEEVSAEVIDGPQSVVWDEAENRLHVQKALM 299

Query: 300 L-WCFGII 306
                G +
Sbjct: 300 EFLLLGKL 307


>gi|295677501|ref|YP_003606025.1| ornithine carbamoyltransferase [Burkholderia sp. CCGE1002]
 gi|295437344|gb|ADG16514.1| ornithine carbamoyltransferase [Burkholderia sp. CCGE1002]
          Length = 309

 Score =  223 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 125/304 (41%), Positives = 175/304 (57%), Gaps = 3/304 (0%)

Query: 2   MTYP--KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    +H+    + S  +   ++E A+ +K   +N     PL  + LAMIFEK STRTR
Sbjct: 1   MTAKKIRHYLQFKDFSLEDYEYVLERARILKRKFKNYETYHPLHDRTLAMIFEKNSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +F+S  + QLGR E I D A+V+SR VD I++RT     +    E 
Sbjct: 61  LSFEAGIFQLGGHAVFMSTRDTQLGRGEPIEDAAQVISRMVDIIMIRTFGQDIIQRFAEN 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT+  HPCQ++ADI T+ EHRG ++ K  +W GD NN+L++ IE A    + 
Sbjct: 121 SRVPVINGLTNEYHPCQVLADIFTYFEHRGPIRDKTVAWVGDANNMLYTWIEAAQILGFK 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L ++TP G +     +              +   A          T +    E +A  + 
Sbjct: 181 LRLSTPPGYKLDRALVAAESAPFYEEFDDPNEACAGADLVTTDVWTSMGFEAENEA-RKK 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  + V+  +M+ A+PDALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA++
Sbjct: 240 AFADWCVDADMMARANPDALFMHCLPAHRGEEVSAEVIDGPQSVVWDEAENRLHVQKALM 299

Query: 300 LWCF 303
            +  
Sbjct: 300 EYLL 303


>gi|264679773|ref|YP_003279682.1| ornithine carbamoyltransferase [Comamonas testosteroni CNB-2]
 gi|262210288|gb|ACY34386.1| ornithine carbamoyltransferase [Comamonas testosteroni CNB-2]
          Length = 306

 Score =  222 bits (566), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 131/301 (43%), Positives = 188/301 (62%), Gaps = 2/301 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH+   S+ ++     ++E A  IK   +   ++  L  + +AMIFEK STRTRVSFE 
Sbjct: 1   MKHYLQFSDFTADEYDYLLERAALIKKKFKGYEKHHTLIDRTMAMIFEKASTRTRVSFEA 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG  + L+  + QLGR+E I D+A+V+SR  D +++RT    ++    +Y+ VPV
Sbjct: 61  GMYQLGGSVVHLTTGDSQLGRSEPIEDSARVISRMTDLVMIRTFGQDKIERFAQYSRVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LT+  HPCQI+ADI TF EHRGS+KGK+ +W GDGNN+ ++ ++ A    + ++++T
Sbjct: 121 INGLTNEFHPCQILADIFTFIEHRGSIKGKVVAWVGDGNNMANTWLQAADLLGFTVHVST 180

Query: 185 PIGSEPRNEYLNWARNQGA-SVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQ 242
           P G E   +     +        +F D ++A KGA  V TD W SM  E +    +  F 
Sbjct: 181 PGGYEVDEQLAFNGKPVNPGCYKVFKDPLEACKGADLVTTDVWTSMGYEAENEARKKAFA 240

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            + V+  +M+ A  DALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENR+H QKA++ + 
Sbjct: 241 DWCVDAEMMASAKADALFMHCLPAHRGEEVEAEVIDGPQSVVWDEAENRMHVQKALMEYL 300

Query: 303 F 303
            
Sbjct: 301 L 301


>gi|82702171|ref|YP_411737.1| ornithine carbamoyltransferase [Nitrosospira multiformis ATCC
           25196]
 gi|82410236|gb|ABB74345.1| ornithine carbamoyltransferase [Nitrosospira multiformis ATCC
           25196]
          Length = 329

 Score =  222 bits (566), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 137/299 (45%), Positives = 181/299 (60%), Gaps = 3/299 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF   ++ S      + E  + IK   +      PL  + LAMIF+K STRTR+SFE  
Sbjct: 26  KHFLQFNDFSREEFEYLFERTRWIKQEFKQYRRYWPLEDRTLAMIFDKHSTRTRLSFEAG 85

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  I+LS  + QLGR E + D A+V+SR VD +++RT  H  +     ++ VPVI
Sbjct: 86  MHQLGGAAIYLSTRDTQLGRGEPVEDAARVISRMVDIVMIRTHEHDIVRRFAAHSRVPVI 145

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQII DI TF EH GS+ GK  +W GD NN+ ++ ++ A  F++ ++++TP
Sbjct: 146 NGLTDEYHPCQIIGDIFTFIEHHGSITGKTVAWIGDSNNVCNTWLQAAEVFDFNVHVSTP 205

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G E   E         +    F D  +AVKGA  V TD W SM  E +    +  F  F
Sbjct: 206 RGYEVEPERAGL--YGTSHYEEFADPHEAVKGADLVTTDVWTSMGFEAETEERKRDFADF 263

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +V+  +MS    DALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLHTQKA++ +  
Sbjct: 264 RVDAEMMSHTRKDALFMHCLPAHRGEEVAAEVIDGPQSVVWDEAENRLHTQKALIEYLL 322


>gi|94265424|ref|ZP_01289176.1| Ornithine carbamoyltransferase [delta proteobacterium MLMS-1]
 gi|93454081|gb|EAT04416.1| Ornithine carbamoyltransferase [delta proteobacterium MLMS-1]
          Length = 332

 Score =  222 bits (566), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 135/302 (44%), Positives = 189/302 (62%), Gaps = 2/302 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             KH   L++ S   L  +I+ A ++K  S+    ++ L G+ +A+IFEKPSTRTRVSFE
Sbjct: 29  MAKHLLALADFSGEELRALIDRALQMKRESKAGGRHRALEGRSVALIFEKPSTRTRVSFE 88

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
            AM  LGG  I+LS  + QL R E + D A+V++RYVD +V+RT     + EL  Y+ VP
Sbjct: 89  AAMYGLGGQVIYLSSRDTQLARNEPLKDMARVMARYVDGLVVRTFGQEIVEELARYSAVP 148

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINALTD  HPCQ+++D+MT  EH+G ++    +W GDGNN+ +S ++ AAR  + L +A
Sbjct: 149 VINALTDLHHPCQVLSDLMTVIEHQGELERLKIAWVGDGNNMANSWLQAAARLGFALTLA 208

Query: 184 TPIGSEPRNEYLNWARNQGASVAL-FHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHVF 241
            P G EP  + L  AR   A       D  +AV  A  V TD W SM QE +      +F
Sbjct: 209 CPEGYEPDADILAAARAAAARPINLVADPREAVADADVVNTDVWASMGQEDEQLHRLQIF 268

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           +PFQ+N  L++ A P A+ +HCLPAHR EE+   VL+GP+SVV+++AEN++H  KAIL  
Sbjct: 269 RPFQINDELLAEAAPGAIVLHCLPAHRDEEISEAVLEGPRSVVWEQAENKMHIHKAILAT 328

Query: 302 CF 303
             
Sbjct: 329 FL 330


>gi|74317868|ref|YP_315608.1| ornithine carbamoyltransferase [Thiobacillus denitrificans ATCC
           25259]
 gi|74057363|gb|AAZ97803.1| ornithine carbamoyltransferase [Thiobacillus denitrificans ATCC
           25259]
          Length = 305

 Score =  222 bits (566), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 119/300 (39%), Positives = 170/300 (56%), Gaps = 1/300 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             KHF    ++S      + E A+ IK+  +      PL+ + LAMIFEK STRTR+SFE
Sbjct: 1   MLKHFLQFRDLSRDEHLYLFERARVIKSRFKRYEPYHPLADRTLAMIFEKSSTRTRLSFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
             M  LGG  I+L+  + QLGR E + D  +V+SR VD +++RT     +     ++ VP
Sbjct: 61  AGMHQLGGSAIYLNTRDTQLGRGEPVEDAGEVISRMVDIVMIRTFEQEIIERFASHSRVP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LT+  HPCQ++ADI TF EHRG + GK  +W GD NN+ ++ ++ A   ++ ++++
Sbjct: 121 VINGLTNEYHPCQVLADIFTFIEHRGPIHGKTVAWIGDSNNMCNTWLQAAELLDFNVHVS 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQP 243
           TP G E   E             +                 T +    E  A     F  
Sbjct: 181 TPPGYEVEPERAGLYGTDHFESFVDPMDACRGADLVTTDVWTSMGWEAENDA-RMKAFAD 239

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +QV+  +M++A P+A+FMHCLPAHRGEEV  EV+DG QSVV+DEAENRLH QKA++ +  
Sbjct: 240 WQVDAEMMAVAKPEAVFMHCLPAHRGEEVTAEVIDGRQSVVWDEAENRLHVQKALMEYLL 299


>gi|95928617|ref|ZP_01311364.1| ornithine carbamoyltransferase [Desulfuromonas acetoxidans DSM 684]
 gi|95135407|gb|EAT17059.1| ornithine carbamoyltransferase [Desulfuromonas acetoxidans DSM 684]
          Length = 304

 Score =  222 bits (565), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 147/303 (48%), Positives = 195/303 (64%), Gaps = 3/303 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT   HF  L++ +++ L  I  + K++K+  +    +  L+GK L MIFEK STRTR+S
Sbjct: 1   MTN--HFLCLTDWTAAELDAIFALTKELKDKQKQGIAHPLLAGKTLGMIFEKSSTRTRIS 58

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FEV M  LGG  +FLS S  QLGR E I DTA+V+SRYVD I++RT +   + EL  YA 
Sbjct: 59  FEVGMYQLGGHALFLSSSNTQLGRGEPIKDTARVMSRYVDGIMIRTFSQEGIEELARYAD 118

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVINALTD+ HPCQ++AD+ T  EH+GS K +++ W GDGNN+ HS I  AA   + L 
Sbjct: 119 VPVINALTDSYHPCQVMADLFTVLEHKGSYKDQVYCWIGDGNNMAHSWINAAAVLGFELR 178

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHV 240
           +ATP G EP    +  A   GA +   +D +QA  GA  + TD W SM QE +  + E  
Sbjct: 179 VATPKGYEPDTSVIERAEQLGAKITYTNDPLQAAWGADVLNTDVWASMGQEQEQLQREKD 238

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F  FQ+N  ++  A  D L +HCLPAHRGEE+ ++V++G  SVVFDEAENRLH QKAI+ 
Sbjct: 239 FVGFQINAEVIDAADGDCLVLHCLPAHRGEEITDDVIEGRHSVVFDEAENRLHVQKAIMA 298

Query: 301 WCF 303
              
Sbjct: 299 TLM 301


>gi|160897621|ref|YP_001563203.1| ornithine carbamoyltransferase [Delftia acidovorans SPH-1]
 gi|160363205|gb|ABX34818.1| ornithine carbamoyltransferase [Delftia acidovorans SPH-1]
          Length = 310

 Score =  222 bits (565), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 136/304 (44%), Positives = 191/304 (62%), Gaps = 2/304 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT  KH+   S+ ++   + ++E A  IK   +   ++  LS + LAMIFEK STRTRVS
Sbjct: 1   MTAIKHYLQFSDFTADEYAYVLERAALIKKKFKGYEKHHTLSDRTLAMIFEKASTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  + L+  + QLGRAE I D+A+V+SR  D +++RT    +++   EY+ 
Sbjct: 61  FEAGMYQLGGSVVHLTTGDSQLGRAEPIEDSARVISRMTDLVMIRTYGQDKIVRFAEYSR 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LT+  HPCQI+ADI TF EHRGS++GK  +W GDGNN+ ++ ++ A    + ++
Sbjct: 121 VPVINGLTNEFHPCQILADIFTFIEHRGSIQGKTVAWVGDGNNMANTWLQAADLLGFTVH 180

Query: 182 IATPIGSEPRNEYLNWARNQGA-SVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEH 239
           ++TP G E   +     +        +F D + A KGA  V TD W SM  E +    + 
Sbjct: 181 VSTPGGYEVDEKLAFGGKTPREGCYKVFKDPLDACKGADLVTTDVWTSMGYEAENEARKK 240

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  + V+  +M+ A  DALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENR+H QKA++
Sbjct: 241 AFADWCVDAEMMAAARGDALFMHCLPAHRGEEVEAEVIDGPQSVVWDEAENRMHVQKALM 300

Query: 300 LWCF 303
            +  
Sbjct: 301 EYLL 304


>gi|187925179|ref|YP_001896821.1| ornithine carbamoyltransferase [Burkholderia phytofirmans PsJN]
 gi|187716373|gb|ACD17597.1| ornithine carbamoyltransferase [Burkholderia phytofirmans PsJN]
          Length = 309

 Score =  222 bits (565), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 125/304 (41%), Positives = 175/304 (57%), Gaps = 3/304 (0%)

Query: 2   MTYP--KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    +H+    + S  +   ++E A+ +K   +N     PL  + LAMIFEK STRTR
Sbjct: 1   MTAKKIRHYLQFKDFSLEDYEYVLERARILKRKFKNYETYHPLHDRTLAMIFEKNSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +F+S  + QLGR E I D A+V+SR VD I++RT     L   +E 
Sbjct: 61  LSFEAGIFQLGGHAVFMSTRDTQLGRGEPIEDAAQVISRMVDIIMIRTFGQDILQRFSEN 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT+  HPCQ++ADI T+ EHRG ++ K  +W GD NN+L++ IE A    + 
Sbjct: 121 SRVPVINGLTNEYHPCQVLADIFTYFEHRGPIRDKTVAWVGDANNMLYTWIEAAQILGFK 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L ++TP G +     +              +              T +    E +A  + 
Sbjct: 181 LRLSTPPGYKLDRAMVAAESAPFYEEFDDPNEACTGADLVTTDVWTSMGFEAENEA-RKK 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  + V+  +M+ A+PDALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA++
Sbjct: 240 AFADWCVDADMMARANPDALFMHCLPAHRGEEVSAEVIDGPQSVVWDEAENRLHVQKALM 299

Query: 300 LWCF 303
            +  
Sbjct: 300 EYLL 303


>gi|302035863|ref|YP_003796185.1| ornithine carbamoyltransferase [Candidatus Nitrospira defluvii]
 gi|300603927|emb|CBK40259.1| Ornithine carbamoyltransferase [Candidatus Nitrospira defluvii]
          Length = 326

 Score =  222 bits (565), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 137/305 (44%), Positives = 194/305 (63%), Gaps = 5/305 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K F +L +I  + L+ ++ +A ++K        +  L G++L ++F+KPSTRTRVSFE  
Sbjct: 16  KDFLELLSIPVAELTGLLRLAAQLKVKQRRGVSHPLLQGRMLGLLFQKPSTRTRVSFEAG 75

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  + L   ++QL R E++ DTA VLSRY+DAIV+RT +H+   E    A++PVI
Sbjct: 76  MNQLGGQAMVLPMGDIQLSRGESVADTAHVLSRYLDAIVLRTFDHAIAEEWAREASIPVI 135

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ ++D++T +E +  +KG   ++ GDGNN+ +SLIE AA+    + +  P
Sbjct: 136 NGLTDLNHPCQALSDLLTIQEKKRRLKGIKIAYVGDGNNVTNSLIEAAAKMGMTIAVGCP 195

Query: 186 IGSEPRNEYLNWARNQGAS----VALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREEHV 240
            G +P    ++ AR +       + +  D   AVK A  V+TD WISM  +  +A+   +
Sbjct: 196 PGYQPDRGIVDRAREEARQTGAVIEIGADPFVAVKDADVVYTDVWISMGQEREQAKRLKI 255

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
             P+Q+N  L+  A PDAL MHCLPAHRGEE+  EVLDGPQSVVFD+AENRLH QKAIL+
Sbjct: 256 LAPYQLNARLLKCAKPDALVMHCLPAHRGEEISAEVLDGPQSVVFDQAENRLHMQKAILV 315

Query: 301 WCFGI 305
              G 
Sbjct: 316 RLLGK 320


>gi|293604406|ref|ZP_06686813.1| ornithine carbamoyltransferase [Achromobacter piechaudii ATCC
           43553]
 gi|292817283|gb|EFF76357.1| ornithine carbamoyltransferase [Achromobacter piechaudii ATCC
           43553]
          Length = 319

 Score =  222 bits (565), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 121/298 (40%), Positives = 177/298 (59%), Gaps = 1/298 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF    + SS+ ++ +++ A+ IK   +    + PL  + LAM+FEK STRTRVSFE  
Sbjct: 18  RHFLQFKDFSSAEIAYVLDRARLIKEKFKRYEPHMPLHDRTLAMVFEKASTRTRVSFEAG 77

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  +GG  I L+ ++ QLGR+E I DTA+V+SR VD +++RT   +R+     ++ VPVI
Sbjct: 78  MYQMGGSVINLTSNDSQLGRSEPIEDTARVISRMVDIVMIRTFEQTRIERFASHSRVPVI 137

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI T+ EHRG + GK  +W GD NN+ ++ +  A    + L+++TP
Sbjct: 138 NGLTNEFHPCQILADIFTYIEHRGPIAGKTVAWVGDANNMAYTWLHAAEMLGFTLHVSTP 197

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G E     +    ++                       T +    E + R    F  + 
Sbjct: 198 AGYELEAARIGTPSDKVLRQFKDPMQACQGAHLVTTDVWTSMGYEAENEERRAA-FADWC 256

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           V+  +M+ A P+A+FMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA++ +  
Sbjct: 257 VDAEMMAAADPEAVFMHCLPAHRGEEVTGEVIDGPQSVVWDEAENRLHVQKALMEFLL 314


>gi|332978218|gb|EGK14949.1| ornithine carbamoyltransferase [Psychrobacter sp. 1501(2011)]
          Length = 306

 Score =  222 bits (565), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 126/298 (42%), Positives = 184/298 (61%), Gaps = 2/298 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++S + L  +I+ A +++         +P  G+ L MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLLDLSPTELDALIKRASELRKMQHAGEVYQPFVGRTLGMIFEKSSTRTRISFETG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M   GG  IFLS  + QLGR E I D+A+V+S  VD I++RT  H ++ +  EY++VP+I
Sbjct: 64  MGQFGGHAIFLSPKDTQLGRGEPIEDSARVISSMVDIIMIRTFEHEKVEKFAEYSSVPII 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+ HPCQ++AD+ TF EHRGS+K K+ +W GDGNN+  S +  A +F + L +A P
Sbjct: 124 NALTDDFHPCQLLADMQTFYEHRGSIKDKIVTWVGDGNNMCSSFMMAAHQFGFELRVAAP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G EP  + +   ++  + V    DA +           +     +  +      F P+Q
Sbjct: 184 YGFEPNPDLMEKFKHCVSLVEDVQDAAKDAHLIVTDVWASM--GQESEQNTRARRFAPYQ 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           V  S++  A P+ LFMHCLPAHRGEE+ +++LD P+SVV+DEAENRLH QKA++ +  
Sbjct: 242 VTPSMLDKADPEVLFMHCLPAHRGEEISHDLLDDPRSVVWDEAENRLHAQKALMEFLL 299


>gi|71908645|ref|YP_286232.1| ornithine carbamoyltransferase [Dechloromonas aromatica RCB]
 gi|123626821|sp|Q47BL9|OTC_DECAR RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|71848266|gb|AAZ47762.1| ornithine carbamoyltransferase [Dechloromonas aromatica RCB]
          Length = 306

 Score =  222 bits (565), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 118/298 (39%), Positives = 170/298 (57%), Gaps = 1/298 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF    + +   L  + E    IKN  ++  +  PLS + L MIFEK STRTR+SFE  
Sbjct: 4   KHFLQFKDFTREELEYVFERTSWIKNQFKSYQKYWPLSDRTLVMIFEKASTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG  I+L+  + QLGR E + D A+V+SR  D +++RT     +      + VPVI
Sbjct: 64  MQQLGGSAIYLNTRDSQLGRGEPVEDAAQVISRMSDIVMIRTFEQEIIERFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI T+ EHRG ++GK  +W GD NN+ ++ ++ A   ++ ++++TP
Sbjct: 124 NGLTNEYHPCQILADIYTYIEHRGCIQGKTVAWVGDANNMCNTWLQAAEVLDFKVHVSTP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
              E + E +         V                   T +    E +      F  + 
Sbjct: 184 PAYEIQPELVGKINPARFKVFADPMDACRGADLVTTDVWTSMGFEAENEE-RIKAFADWC 242

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           V+  +M +A+P A+FMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA++ +  
Sbjct: 243 VDGDMMRVANPQAVFMHCLPAHRGEEVTAEVIDGPQSVVWDEAENRLHVQKALMEYLM 300


>gi|260223001|emb|CBA33129.1| Ornithine carbamoyltransferase [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 323

 Score =  222 bits (565), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 128/300 (42%), Positives = 185/300 (61%), Gaps = 2/300 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +H+    + S+   + ++E A  IK   +    +  L  + LAMIFEK STRTRVSFE  
Sbjct: 20  RHYLQFDDFSADEYAYLLERAAFIKRKFKTFERHHTLVDRTLAMIFEKASTRTRVSFEAG 79

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  + L+  + QLGR+E I D+AKV+SR  D +++RT   ++L      + VPVI
Sbjct: 80  MYQLGGSVVHLTTGDSQLGRSEPIEDSAKVISRMTDIVMIRTYEQTKLQAFAANSRVPVI 139

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI T+ EHRG ++GK  +W GDGNN+ ++ ++ AA+  + L ++TP
Sbjct: 140 NGLTNEFHPCQILADIFTYIEHRGPIQGKTVTWVGDGNNMANTWLQAAAKLGFHLRVSTP 199

Query: 186 IGSE-PRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQP 243
            G E       +       S   + D ++A +GA  + TD W SM  E +       F  
Sbjct: 200 SGYEVNETLAASAGGMGAGSYKTYSDPMEACQGADLITTDVWTSMGFEAENEVRRKAFAA 259

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           + V+  +M++A P+A+FMHCLPAHRGEEV  EV+DGPQSVV+DEAENR+H QKA++ +  
Sbjct: 260 WCVDRKMMAVAAPNAIFMHCLPAHRGEEVEAEVIDGPQSVVWDEAENRMHVQKALMEYLL 319


>gi|56478328|ref|YP_159917.1| ornithine carbamoyltransferase [Aromatoleum aromaticum EbN1]
 gi|81356892|sp|Q5P0Z8|OTC_AZOSE RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|56314371|emb|CAI09016.1| Ornithine carbamoyltransferase [Aromatoleum aromaticum EbN1]
          Length = 307

 Score =  222 bits (565), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 126/307 (41%), Positives = 183/307 (59%), Gaps = 4/307 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT P+H+    + +  +   + +  + IK+  +      PL  + L MIFEK STRTR+S
Sbjct: 1   MTKPRHYLQFKDFTRDDYRHVFDRTRWIKDKFKRYEPYHPLFDRTLVMIFEKASTRTRLS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M+ LGG  I+L+  + QLGR E + D A+V+SR  D +++RT     +     ++ 
Sbjct: 61  FEAGMQQLGGSAIYLNTRDSQLGRGEPVEDAAQVISRMSDVVMIRTFEQDIIERFAAHSR 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LT+  HPCQI+ADI TF EHRGS++G+  +W GD NN+ ++ ++ A   ++ ++
Sbjct: 121 VPVINGLTNEYHPCQILADIYTFIEHRGSIQGRTVAWVGDSNNMCNTWLQAAELLDFNVH 180

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHV 240
           ++TP G E   E              F D ++A KGA  V TD W SM  E +       
Sbjct: 181 VSTPPGYEVEPERAGL--YGTGHFEQFADPMEACKGADLVTTDVWTSMGFEAENDERMKD 238

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F  + V+  +M+ A  DA+FMHCLPAHRGEEV  +V+DG QSVV+DEAENRLH QKA++ 
Sbjct: 239 FADWCVDAEMMAAARADAVFMHCLPAHRGEEVTADVIDGAQSVVWDEAENRLHVQKALME 298

Query: 301 WC-FGII 306
           +   G +
Sbjct: 299 YLVLGKV 305


>gi|209521016|ref|ZP_03269750.1| ornithine carbamoyltransferase [Burkholderia sp. H160]
 gi|209498550|gb|EDZ98671.1| ornithine carbamoyltransferase [Burkholderia sp. H160]
          Length = 309

 Score =  222 bits (565), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 136/309 (44%), Positives = 184/309 (59%), Gaps = 6/309 (1%)

Query: 2   MTYP--KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    +H+    + S  +   ++E A+ +K   +N     PL  + LAMIFEK STRTR
Sbjct: 1   MTAKKIRHYLQFKDFSLEDYEYVLERARILKRKFKNYETYHPLHDRTLAMIFEKNSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +F+S  + QLGR E I D A+V+SR VD I++RT     +    E 
Sbjct: 61  LSFEAGIFQLGGHAVFMSTRDTQLGRGEPIEDAAQVISRMVDIIMIRTFGQDIIQRFAEN 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT+  HPCQ++ADI T+ EHRG ++ K  +W GD NN+L++ IE A    + 
Sbjct: 121 SRVPVINGLTNEYHPCQVLADIFTYFEHRGPIRDKTVAWVGDANNMLYTWIEAAQILGFK 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EE 238
           L ++TP G +     +  A    A    F D  +A  GA  V TD W SM  E +    +
Sbjct: 181 LRLSTPPGYKLDRALV--AAESAAFYEEFDDPHEACAGADLVTTDVWTSMGFEAENEARK 238

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F  + V+  +M+ A PDALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA+
Sbjct: 239 KAFADWCVDADMMARAKPDALFMHCLPAHRGEEVSAEVIDGPQSVVWDEAENRLHVQKAL 298

Query: 299 LL-WCFGII 306
           +     G +
Sbjct: 299 MEFLLLGKL 307


>gi|170693517|ref|ZP_02884676.1| ornithine carbamoyltransferase [Burkholderia graminis C4D1M]
 gi|170141672|gb|EDT09841.1| ornithine carbamoyltransferase [Burkholderia graminis C4D1M]
          Length = 309

 Score =  222 bits (565), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 127/304 (41%), Positives = 176/304 (57%), Gaps = 3/304 (0%)

Query: 2   MTYP--KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    +H+    + S  +   ++E A+ +K   +N     PL  + LAMIFEK STRTR
Sbjct: 1   MTAKKIRHYLQFKDFSLDDYEYVLERARILKRKFKNYETYHPLHDRTLAMIFEKNSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +F+S  + QLGR E I D A+V+SR VD I++RT     +    E 
Sbjct: 61  LSFEAGIFQLGGHAVFMSTRDTQLGRGEPIEDAAQVISRMVDIIMIRTFGQDIIQRFAEN 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT+  HPCQ++ADI T+ EHRG ++GK  +W GD NN+L++ IE A    + 
Sbjct: 121 SRVPVINGLTNEYHPCQVLADIFTYFEHRGPIRGKTVAWVGDANNMLYTWIEAAQILGFK 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L ++TP G +    ++              +   A          T +    E +A  + 
Sbjct: 181 LRLSTPPGYKLDRGFVAAESAPFYEEFDDPNEACAGADLVTTDVWTSMGFEAENEA-RKK 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  + V+  +MS AH DALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA++
Sbjct: 240 AFADWCVDAEMMSRAHADALFMHCLPAHRGEEVSAEVIDGPQSVVWDEAENRLHVQKALM 299

Query: 300 LWCF 303
            +  
Sbjct: 300 EYLL 303


>gi|332283936|ref|YP_004415847.1| ornithine carbamoyltransferase [Pusillimonas sp. T7-7]
 gi|330427889|gb|AEC19223.1| ornithine carbamoyltransferase [Pusillimonas sp. T7-7]
          Length = 314

 Score =  222 bits (565), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 128/299 (42%), Positives = 186/299 (62%), Gaps = 3/299 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF    ++S + +  +++ A+ IKN  +    +  L  + LAM+FEK STRTRVSFE  
Sbjct: 12  RHFLQFRDLSKTEIQYVLDRAQLIKNKFKRYEPHHTLHDRNLAMVFEKASTRTRVSFEAG 71

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  I L+  + QLGR+E I DTA+V+SR VD +++RT   +R+     ++ VPVI
Sbjct: 72  MYQLGGSVIHLTTGDSQLGRSEPIEDTARVISRMVDLVMIRTFEQTRIERFASHSRVPVI 131

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI TF EH+G + GK  +W GD NN+ ++ ++ A    + L+++ P
Sbjct: 132 NGLTNEFHPCQILADIFTFIEHQGPIAGKTVAWIGDANNMAYTWLQAAEILGFHLHVSAP 191

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G +   + +    +       F D ++A + AH V TD W SM  E +       F  +
Sbjct: 192 AGYQLDPQRVGQPADGVLQ--EFTDPIEACRNAHLVTTDVWTSMGFEAENEERRKAFADW 249

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
            V+  +M++A P ALFMHCLPAHRGEEV  +V+DGPQSVV+DEAENRLH QKA++ +  
Sbjct: 250 CVDADMMAVADPKALFMHCLPAHRGEEVTGDVIDGPQSVVWDEAENRLHVQKALMEFLL 308


>gi|307822449|ref|ZP_07652681.1| ornithine carbamoyltransferase [Methylobacter tundripaludum SV96]
 gi|307737015|gb|EFO07860.1| ornithine carbamoyltransferase [Methylobacter tundripaludum SV96]
          Length = 302

 Score =  222 bits (565), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 137/302 (45%), Positives = 185/302 (61%), Gaps = 5/302 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M  P+HF  L ++S   L  +I     +KN+     + +PL G+VLAMIFEK STRTR+S
Sbjct: 1   MN-PRHFISLLDLSGDELRSLINRGIVLKNN--RDPDYQPLKGQVLAMIFEKSSTRTRIS 57

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M H GG  +FLS  + QLGR E + D+A+V+S  VD I++RT  H  +    +Y++
Sbjct: 58  FESGMSHFGGSALFLSPRDTQLGRGEPLQDSARVISSMVDCIMLRTDKHETVTTFAQYSS 117

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD  HPCQ++AD+ T+ EHRG +KGK  +W GDGNN+ HS I  A   ++ LN
Sbjct: 118 VPVINGLTDLQHPCQLLADMQTYFEHRGDIKGKTVTWIGDGNNMCHSYIHAATVLDFTLN 177

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           IA P   +P  + +  A  +         A Q           +     +E + + E  F
Sbjct: 178 IACPKDYQPLQDIVEAAGERVRFFDTPLAAAQNSDLVVTDVWASM--GQEEEQKQREMAF 235

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           + +QVN  +M +AH DALFMHCLPAHRGEEV  +V+DG QSV+FDEAENRLH QKA+L +
Sbjct: 236 KNYQVNAEVMKVAHNDALFMHCLPAHRGEEVSADVIDGAQSVIFDEAENRLHAQKALLEF 295

Query: 302 CF 303
             
Sbjct: 296 LL 297


>gi|325288629|ref|YP_004264810.1| ornithine carbamoyltransferase [Syntrophobotulus glycolicus DSM
           8271]
 gi|324964030|gb|ADY54809.1| ornithine carbamoyltransferase [Syntrophobotulus glycolicus DSM
           8271]
          Length = 314

 Score =  222 bits (565), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 138/305 (45%), Positives = 193/305 (63%), Gaps = 5/305 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             + F  L++ +S  +  +I+VA ++K+ S+    +  L GK L MIF K STRTRVSFE
Sbjct: 10  KGRDFIALNDFTSEEILHMIDVAARLKSESKAGIPHHILQGKTLGMIFTKSSTRTRVSFE 69

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V +  LGG  +FLS  ++Q+GR E I DTA+VLSR VD I++RT +H  +++L +Y   P
Sbjct: 70  VGIYQLGGYGLFLSDRDIQIGRGEPIQDTARVLSRMVDGIMIRTFSHQEVVDLAKYCDKP 129

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HP QI+AD++T +EH+  +KG    + GDGNN+ +SL+ G  +    + IA
Sbjct: 130 VINGLTDYLHPTQILADMLTIKEHKEKIKGLKLVYIGDGNNVANSLLLGGTKVGMDVVIA 189

Query: 184 TPIGSEPRNEYLNWARNQGA----SVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREE 238
            P G +P  E +  A         S A+F D + A +GA  ++TD W SM QE + A   
Sbjct: 190 APQGYKPVPEIMALAAQNAEASGGSAAVFEDPLTAAEGADILYTDVWASMGQEEEAAVRR 249

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F  +Q+N +L+  A PDA+ +HCLPAHRGEE+  E+L+GPQSVVFDEAENRLH  KAI
Sbjct: 250 KAFAGYQINDTLLKAAKPDAIVLHCLPAHRGEEITEEILEGPQSVVFDEAENRLHAHKAI 309

Query: 299 LLWCF 303
           +    
Sbjct: 310 MSLIM 314


>gi|260431030|ref|ZP_05785001.1| ornithine carbamoyltransferase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260414858|gb|EEX08117.1| ornithine carbamoyltransferase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 314

 Score =  222 bits (565), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 155/310 (50%), Positives = 212/310 (68%), Gaps = 7/310 (2%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNS-----SENIFENKPLSGKVLAMIFEKPSTR 57
           T   HF D+    ++ L  +I+ A  +K +          + +PL+G+++A+IFEKPSTR
Sbjct: 5   TDMNHFLDIHKTDAAALRSMIDQAGAMKQARLGRPKAAPDDEQPLAGRMVALIFEKPSTR 64

Query: 58  TRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELT 117
           TRVSF+V ++ +GG T+ LSG +MQLG  ETI DTA+VLSRYVD I++RT + + L E+ 
Sbjct: 65  TRVSFDVGVRQMGGQTMVLSGKDMQLGHGETIADTARVLSRYVDMIMIRTFDETILTEMA 124

Query: 118 EYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFN 177
           EY+ VPVIN LTD THPCQI+AD++T+EEHRG + GK   W+GDGNN+  S +  A +F 
Sbjct: 125 EYSDVPVINGLTDRTHPCQIMADVLTYEEHRGPIAGKKVVWTGDGNNVCASFLHAAGQFG 184

Query: 178 YLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE 237
           + L    P   +P  E++ +AR +G+ V +  D  +AV+GA  V  DTW+SM+    A+E
Sbjct: 185 FDLTFTGPAQFDPEEEFIGFARQKGSKVVIERDPYKAVEGADLVVADTWVSMHDSQSAKE 244

Query: 238 EHVF--QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
                 +P+QVN  LMS A PDALFMHCLPAHR EE  +EV+DGP SV+FDEAENRLH Q
Sbjct: 245 RRHNLLRPYQVNADLMSHAKPDALFMHCLPAHREEEATSEVMDGPNSVIFDEAENRLHAQ 304

Query: 296 KAILLWCFGI 305
           KA++ WC G+
Sbjct: 305 KAVMRWCLGV 314


>gi|255658226|ref|ZP_05403635.1| ornithine carbamoyltransferase [Mitsuokella multacida DSM 20544]
 gi|260849536|gb|EEX69543.1| ornithine carbamoyltransferase [Mitsuokella multacida DSM 20544]
          Length = 310

 Score =  222 bits (565), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 140/308 (45%), Positives = 189/308 (61%), Gaps = 6/308 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M   K    + ++S   +  I+ +AK++K   +    ++ L GK L MIFEK STRTRVS
Sbjct: 1   MLKGKDMLSIHDLSVDEVQEILALAKELKAKQKAGVPHEILKGKTLGMIFEKSSTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  +FLS  ++QLGR E I DTA+VLSRY+D I++RT  H R+ EL ++A 
Sbjct: 61  FETGMYQLGGQALFLSNRDLQLGRGEPIRDTARVLSRYLDGIMIRTFGHDRVEELAKWAD 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSV-KGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +PVINALTD  HPCQ++ D++T EE++G   KG   ++ GDGNN+ +S + G A+     
Sbjct: 121 IPVINALTDLLHPCQVLTDLLTIEEYKGKNLKGLKMAYVGDGNNMTNSFLYGCAKVGMTF 180

Query: 181 NIATPIGSEP----RNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR 236
             ATP    P        L  A+  GA ++L  D  +AVK A  V TDTW SM QE +  
Sbjct: 181 VAATPEDYRPDETVFKNALEDAKETGAELSLVTDPKEAVKDADIVVTDTWASMGQEAEHE 240

Query: 237 -EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
             + +F P+QVN  L+  A    + MHCLPA+RGEE+  EVL+    V+FDEAENRLHTQ
Sbjct: 241 ARKKIFAPYQVNKELLKGADKRVIVMHCLPAYRGEEITEEVLEANADVIFDEAENRLHTQ 300

Query: 296 KAILLWCF 303
           KAI+    
Sbjct: 301 KAIMALTM 308


>gi|295702823|ref|YP_003595898.1| ornithine carbamoyltransferase [Bacillus megaterium DSM 319]
 gi|294800482|gb|ADF37548.1| ornithine carbamoyltransferase [Bacillus megaterium DSM 319]
          Length = 316

 Score =  222 bits (565), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 136/305 (44%), Positives = 193/305 (63%), Gaps = 5/305 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K    L ++SS ++  ++E A ++K   +N      L GK L +IFEK STRTRVSFE
Sbjct: 11  KGKDLLTLKDLSSDDIMSLLESAIELKEKHKNGEIVTSLKGKTLGLIFEKSSTRTRVSFE 70

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
             M  LGG+ +FLS  ++Q+GR ETI DTA+VLS ++DAI++RT  HS++ EL +YA++P
Sbjct: 71  AGMMQLGGNALFLSSQDLQIGRGETIADTARVLSEFIDAIMIRTFEHSKIEELADYASIP 130

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD+ HPCQ +AD++T  EH+ S +G   ++ GDGNN+ HSL+   A+    ++I 
Sbjct: 131 VINGLTDDYHPCQALADLLTIYEHKKSFEGLKVAYVGDGNNVAHSLMIACAKMGIDISIG 190

Query: 184 TPIGSEPRNEYLNWARNQGASV----ALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REE 238
            P G EP++    +     A+      +  D V+AVK A  ++ D W SM QE +A +  
Sbjct: 191 CPDGYEPKDFVTAYVHEIAATTGAKVTITKDPVEAVKNADAIYADVWTSMGQEEEAQQRL 250

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
            +F P+QVN  L + A  D LF+HCLPAHR EEV   ++DGP SVVF +A NR+H QKA+
Sbjct: 251 KIFAPYQVNEELAAYAKSDYLFLHCLPAHREEEVTASIIDGPNSVVFQQAGNRMHVQKAL 310

Query: 299 LLWCF 303
           L    
Sbjct: 311 LQAIL 315


>gi|148652590|ref|YP_001279683.1| ornithine carbamoyltransferase [Psychrobacter sp. PRwf-1]
 gi|189036337|sp|A5WDJ2|OTC_PSYWF RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|148571674|gb|ABQ93733.1| ornithine carbamoyltransferase [Psychrobacter sp. PRwf-1]
          Length = 306

 Score =  222 bits (565), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 126/298 (42%), Positives = 184/298 (61%), Gaps = 2/298 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++S + L  +I+ A +++         +P  G+ L MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLLDLSPAELEALIKRASELRKMQHAGEVYQPFVGRTLGMIFEKSSTRTRISFETG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M   GG  IFLS  + QLGR E I D+A+V+S  VD I++RT  H ++ +  +Y++VP+I
Sbjct: 64  MGQFGGHAIFLSPKDTQLGRGEPIEDSARVISSMVDIIMIRTFEHEKVEKFAQYSSVPII 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+ HPCQ++AD+ TF EHRGS+K K+ +W GDGNN+  S +  A +F + L +A P
Sbjct: 124 NALTDDFHPCQLLADMQTFYEHRGSIKDKIVTWVGDGNNMCSSFMAAANQFGFELRVAAP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G EP  E +   ++  + V    DA +           +     +  +      F P+Q
Sbjct: 184 YGFEPNPELMEKFKHCVSLVDDVQDAAKDAHLIVTDVWASM--GQESEQNTRARRFAPYQ 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           V  S++  A P+ LFMHCLPAHRGEE+ +++LD P+SVV+DEAENRLH QKA++ +  
Sbjct: 242 VTPSMLDKADPEVLFMHCLPAHRGEEISHDMLDDPRSVVWDEAENRLHAQKALMEFLL 299


>gi|121605903|ref|YP_983232.1| ornithine carbamoyltransferase [Polaromonas naphthalenivorans CJ2]
 gi|120594872|gb|ABM38311.1| ornithine carbamoyltransferase [Polaromonas naphthalenivorans CJ2]
          Length = 309

 Score =  222 bits (564), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 126/306 (41%), Positives = 183/306 (59%), Gaps = 5/306 (1%)

Query: 2   MTYP----KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTR 57
           M+ P    KH+   S++++ + + + E A  IK   +    ++PL  + + MIFEK STR
Sbjct: 1   MSSPPTPLKHYLQFSDLNADDYAYLFERAALIKKKFKAYERHQPLIDRTMVMIFEKASTR 60

Query: 58  TRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELT 117
           TRVSFE  M  LGG  + L+    QLGRAE I D+AKV+SR VD +++RT   +++    
Sbjct: 61  TRVSFEAGMYQLGGTVVNLTTEGSQLGRAEPIEDSAKVISRMVDLVMIRTFEQTKINRFA 120

Query: 118 EYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFN 177
           E++ VPVIN LT+  HPCQI+ADI T+ EHRGS++GK  +W GDGNN+ ++ ++ +    
Sbjct: 121 EHSRVPVINGLTNEFHPCQILADIFTYIEHRGSIQGKTVAWVGDGNNMANTWLQASEILG 180

Query: 178 YLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE 237
           + ++++TP G E          ++   V        A          T +    E +A  
Sbjct: 181 FKVHLSTPGGYEVDQSIAGIRSSESYQVFKDPMQACAGADLVTTDVWTSMGYEAENEA-R 239

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
           +  F  + V+  +M  A PDALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENR+H QKA
Sbjct: 240 KKAFADWCVDSEMMRAAKPDALFMHCLPAHRGEEVEAEVIDGPQSVVWDEAENRMHVQKA 299

Query: 298 ILLWCF 303
           ++ +  
Sbjct: 300 LMEFLL 305


>gi|52079621|ref|YP_078412.1| ornithine carbamoyltransferase [Bacillus licheniformis ATCC 14580]
 gi|52784984|ref|YP_090813.1| ornithine carbamoyltransferase [Bacillus licheniformis ATCC 14580]
 gi|319646585|ref|ZP_08000814.1| ArgF protein [Bacillus sp. BT1B_CT2]
 gi|52002832|gb|AAU22774.1| ornithine carbamoyltransferase [Bacillus licheniformis ATCC 14580]
 gi|52347486|gb|AAU40120.1| ArgF [Bacillus licheniformis ATCC 14580]
 gi|317391173|gb|EFV71971.1| ArgF protein [Bacillus sp. BT1B_CT2]
          Length = 316

 Score =  222 bits (564), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 141/303 (46%), Positives = 193/303 (63%), Gaps = 9/303 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K F  L + S   +  +++ A  +K +           GK LAMIFEK STRTRVSFE  
Sbjct: 17  KDFLSLKDFSKEEIVYLLKEAAAMKRNK----IQDIFKGKTLAMIFEKSSTRTRVSFEAG 72

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG+ +FLS  +MQLGR ETI DTAKVLSRYVDAI++RT  H ++ EL ++A +PVI
Sbjct: 73  MAQLGGNALFLSSKDMQLGRGETIADTAKVLSRYVDAIMIRTFEHEKVEELAKHAEIPVI 132

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ ++D++T +E +G++KG    + GDGNN+ HSL+ G A+    + +A+P
Sbjct: 133 NGLTDLFHPCQALSDLLTIQEMKGTLKGLKAVYVGDGNNVAHSLLIGCAKVGCDITVASP 192

Query: 186 IGSEPRNEYLNWARNQGAS----VALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHV 240
            G EP  + +  A          V + +D V AV+ A  +++D + SM QE +A     +
Sbjct: 193 KGYEPNQDVVKLAETFAEESGAAVTITNDPVSAVQQADVIYSDVFTSMGQEEEAEERMKI 252

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F P+QVN +L+S A PD +F+HCLPAHR EEV  E++DGP S VF +AENRLH QKA+L 
Sbjct: 253 FAPYQVNGTLVSHAKPDYIFLHCLPAHREEEVTAEIIDGPNSAVFQQAENRLHVQKALLK 312

Query: 301 WCF 303
              
Sbjct: 313 ALL 315


>gi|145589934|ref|YP_001156531.1| ornithine carbamoyltransferase [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|145048340|gb|ABP34967.1| ornithine carbamoyltransferase [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 326

 Score =  222 bits (564), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 124/299 (41%), Positives = 179/299 (59%), Gaps = 3/299 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH+   S+++      +++ +  +K   ++     PL  + LAMIFEK STRTR+SFE  
Sbjct: 25  KHYLQFSDLNREEYDYLLKRSAWLKAKFKSYETWHPLHDRTLAMIFEKHSTRTRLSFEAG 84

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  ++L+  + QLGR E + D A+V+SR  D I++RT     +      + VPVI
Sbjct: 85  IHQLGGHAVYLNTRDTQLGRGEPVEDAAQVISRMTDIIMIRTFGQEIIERFAANSRVPVI 144

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQ++ADI TF E RG ++GK  +W GD NN+ ++ ++ A   ++ L  + P
Sbjct: 145 NGLTNEFHPCQVLADIFTFVEARGPIQGKTVAWVGDANNMAYTWLQAAECLDFQLRFSAP 204

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQPF 244
            G +     L         +A+  D  +A KGA  V TD W SM  E +     + FQ +
Sbjct: 205 EGYQLDTSRLT--AKSAKYLAICSDPKEACKGADLVTTDVWTSMGYEDENTLRMNAFQDW 262

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
            V+  LMS+A PDALFMHCLPAHRGEEV   V+DGPQS+V++EAENRLH QKA++ +  
Sbjct: 263 MVDEELMSLAKPDALFMHCLPAHRGEEVSAGVIDGPQSIVWEEAENRLHVQKALMEYLL 321


>gi|254448634|ref|ZP_05062093.1| ornithine carbamoyltransferase [gamma proteobacterium HTCC5015]
 gi|198261823|gb|EDY86109.1| ornithine carbamoyltransferase [gamma proteobacterium HTCC5015]
          Length = 302

 Score =  222 bits (564), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 148/303 (48%), Positives = 193/303 (63%), Gaps = 5/303 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M+  +HF  L + SSS L  +I  A +++         +PL  +VLAM+FEK STRTR+S
Sbjct: 1   MSA-RHFLTLLDFSSSELEQLIARASELRQMQHRGEIYEPLKNQVLAMVFEKSSTRTRIS 59

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M   GG  IFLS    Q+GR E I DTA+V+SR VD I++RT  HS+L     ++ 
Sbjct: 60  FEAGMAQFGGHAIFLSPQGTQIGRGEPIEDTARVMSRMVDGIMVRTFEHSKLETFAAHSQ 119

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVINALTD+ HPCQ++AD+  F E RGS++G   +W GDGNN+ HS I  A +F + LN
Sbjct: 120 VPVINALTDDYHPCQLLADVQAFSEARGSIQGATVTWIGDGNNMCHSYINAARQFGFQLN 179

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHV 240
           IA P G EP+ + L  A   G +  +  D V+A + A  V TD W SM QE + +  E  
Sbjct: 180 IACPEGYEPKADILEAA---GDAARIVRDPVEAARDAQLVTTDVWASMGQEEEQKLREQA 236

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F  +QV+  +M  A  DALFMHCLPAHRGEEV   V+DGPQS+V+D+AENRLH QKA+L 
Sbjct: 237 FARYQVDDRVMQAADNDALFMHCLPAHRGEEVSASVIDGPQSIVWDQAENRLHAQKALLE 296

Query: 301 WCF 303
              
Sbjct: 297 TLM 299


>gi|317402720|gb|EFV83268.1| ornithine carbamoyltransferase [Achromobacter xylosoxidans C54]
          Length = 319

 Score =  222 bits (564), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 132/299 (44%), Positives = 187/299 (62%), Gaps = 3/299 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF    + SS+ ++ +++ A+ IK   +    + PL  + LAM+FEK STRTRVSFE  
Sbjct: 18  RHFLQFKDFSSAEIAYVLDRARLIKEKFKRYEPHMPLHDRTLAMVFEKASTRTRVSFEAG 77

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  +GG  I L+ ++ QLGR+E I DTA+V+SR VD +++RT   +R+     ++ VPVI
Sbjct: 78  MYQMGGSVINLTSNDSQLGRSEPIEDTARVISRMVDIVMIRTFEQTRIERFASHSRVPVI 137

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI T+ EHRG + GK  +W GD NN+ ++ ++ A    + L+++TP
Sbjct: 138 NGLTNEFHPCQILADIFTYIEHRGPIAGKTVAWVGDANNMAYTWLQAAEMLGFTLHVSTP 197

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G     E           +  F D +QA +GAH V TD W SM  E +       F  +
Sbjct: 198 AGY--ELEAARIGSPSDKVLRQFKDPMQACQGAHLVTTDVWTSMGYEAENEERRAAFADW 255

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
            V+  +M+ A P A+FMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA++ +  
Sbjct: 256 CVDAEMMAAADPQAVFMHCLPAHRGEEVTGEVIDGPQSVVWDEAENRLHVQKALMEFLL 314


>gi|302384429|ref|YP_003820252.1| ornithine carbamoyltransferase [Brevundimonas subvibrioides ATCC
           15264]
 gi|302195057|gb|ADL02629.1| ornithine carbamoyltransferase [Brevundimonas subvibrioides ATCC
           15264]
          Length = 305

 Score =  222 bits (564), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 145/307 (47%), Positives = 199/307 (64%), Gaps = 10/307 (3%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSE-----NIFENKPLSGKVLAMIFEKPST 56
           MT  +HF D+  + ++ L  I++ A   K + +      +  + P   +VLAMIFEK ST
Sbjct: 1   MT--RHFLDIHRLEAAELRAILDDAHARKAARKGWPRGRVDADAPAKDRVLAMIFEKNST 58

Query: 57  RTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLEL 116
           RTR SF+ A++ LGGD+I  +  +MQLGR E + DTA+VLSR VDA+++R  +H  +   
Sbjct: 59  RTRFSFDAAIRQLGGDSIIANAGDMQLGRGEPVEDTARVLSRMVDAVMIRANSHEDVERF 118

Query: 117 TEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARF 176
              ATVPV+N LTD +HPCQI+ADIMT EE RG ++GK  +W GDGNN+ HS +  A + 
Sbjct: 119 ARVATVPVVNGLTDRSHPCQILADIMTIEEQRGPIEGKTIAWIGDGNNVCHSFMHAAPKL 178

Query: 177 NYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR 236
            + LN+A P    P    L+     G +V L  D   AV+GA  V TDTW+SM       
Sbjct: 179 GFHLNVACPAEYHPD---LHDLAKGGNAVTLTSDPKDAVRGADVVVTDTWVSMGDGDYEA 235

Query: 237 EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
             H F+ + V+ +LM +A PDA+F+HCLPAHRGEEV + V+DGP+S+V+DEAENR+H QK
Sbjct: 236 RLHAFENYTVDEALMDLADPDAVFLHCLPAHRGEEVTDAVIDGPRSLVWDEAENRIHAQK 295

Query: 297 AILLWCF 303
           A+L WCF
Sbjct: 296 AVLAWCF 302


>gi|225458227|ref|XP_002281919.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|302142520|emb|CBI19723.3| unnamed protein product [Vitis vinifera]
          Length = 378

 Score =  222 bits (564), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 130/303 (42%), Positives = 183/303 (60%), Gaps = 3/303 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-PLSGKVLAMIFEKPSTRTRVSFEV 64
           K F  +++   + +  I++ A ++K   ++      P  GK +AMIF KPS RTRVSFE 
Sbjct: 76  KDFLHINDFDKTTILKILDRALEVKALLKSGERTFLPFKGKTMAMIFAKPSMRTRVSFET 135

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
               LGG  ++L   ++Q+G+ E   D A+VLS Y D I+ R   H  +L+L +YATVPV
Sbjct: 136 GFFLLGGHALYLGPDDIQMGKREETRDVARVLSCYNDIIMARVFAHQDILDLAKYATVPV 195

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD  HPCQI+AD +T  EH G ++G    + GDGNNI+HS +  AA   +    A 
Sbjct: 196 INGLTDYNHPCQIMADALTIIEHIGQLEGTKVVYVGDGNNIVHSWLLLAAVVPFHFVCAC 255

Query: 185 PIGSEPRNEYLNWARNQ-GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHVFQ 242
           P G EP  + +  A+    + + + +D  +AV+GA  V++D W SM Q+ +A     VFQ
Sbjct: 256 PKGFEPDEKTVQKAQQAGISKIEITNDPKEAVRGADVVYSDVWASMGQKEEASYRRQVFQ 315

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            FQV+  LM +A P A FMHCLPA RG EV + VL+ P S+VF +AENR+H Q AI+L  
Sbjct: 316 GFQVDEPLMKLAGPKAYFMHCLPAERGVEVTDGVLEAPNSIVFPQAENRMHAQNAIMLHV 375

Query: 303 FGI 305
            G+
Sbjct: 376 LGL 378


>gi|294339521|emb|CAZ87880.1| ornithine carbamoyltransferase [Thiomonas sp. 3As]
          Length = 311

 Score =  222 bits (564), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 136/306 (44%), Positives = 185/306 (60%), Gaps = 3/306 (0%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M T  +H+   S+++      +   A  IK   +    ++PL  + LAMIFEK STRTR+
Sbjct: 1   MKTTLRHYLQFSDLNREEYDYVFARAALIKAKFKRYEPHQPLVDRTLAMIFEKHSTRTRL 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFE  M  LGG  I+++  + QLGR E I D A+V SR VD +++RT     +     Y+
Sbjct: 61  SFEAGMHQLGGAAIYINTRDSQLGRGEPIEDAAQVFSRMVDLVMIRTYGQEIVERFAAYS 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
            VPVIN LT+  HPCQI+AD+MT+ EHRG ++GK  +W GD NN+ ++ ++ A    + L
Sbjct: 121 RVPVINGLTNEFHPCQILADVMTYIEHRGPIQGKTVAWIGDANNMFYTWLQAAEVLGFTL 180

Query: 181 NIATPIGSEPRNEYLNWA--RNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-RE 237
           + A P G         +     Q A +  F D  QA +GAH + TD W SM  E +    
Sbjct: 181 HFAGPKGYGVEKNRPGYPLSAAQIAHLREFDDPRQACEGAHLITTDVWTSMGYEAEKLAR 240

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
           E  F+ F V+  +M+ AHPDALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA
Sbjct: 241 EQAFKGFMVDGEMMARAHPDALFMHCLPAHRGEEVAAEVIDGPQSVVWDEAENRLHGQKA 300

Query: 298 ILLWCF 303
           ++ +  
Sbjct: 301 LMEFLL 306


>gi|307730811|ref|YP_003908035.1| ornithine carbamoyltransferase [Burkholderia sp. CCGE1003]
 gi|307585346|gb|ADN58744.1| ornithine carbamoyltransferase [Burkholderia sp. CCGE1003]
          Length = 309

 Score =  222 bits (564), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 127/304 (41%), Positives = 175/304 (57%), Gaps = 3/304 (0%)

Query: 2   MTYP--KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    +H+    + S  +   ++E A+ +K   +N     PL  + LAMIFEK STRTR
Sbjct: 1   MTAKKIRHYLQFKDFSLDDYEYVLERARILKRKFKNYETYHPLHDRTLAMIFEKNSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +F+S  + QLGR E I D A+V+SR VD I++RT     +    E 
Sbjct: 61  LSFEAGIFQLGGHAVFMSTRDTQLGRGEPIEDAAQVISRMVDIIMIRTFGQDIIQRFAEN 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT+  HPCQ++ADI T+ EHRG ++GK  +W GD NN+L++ IE A    + 
Sbjct: 121 SRVPVINGLTNEYHPCQVLADIFTYFEHRGPIRGKTVAWVGDANNMLYTWIEAAQILGFK 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L ++TP G +     +              +   A          T +    E +A  + 
Sbjct: 181 LRLSTPPGYKLDRALVAAESAPFYEEFDDPNEACAGADLVTTDVWTSMGFEAENEA-RKK 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  + V+  +MS AH DALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA++
Sbjct: 240 AFADWCVDAEMMSRAHTDALFMHCLPAHRGEEVSAEVIDGPQSVVWDEAENRLHVQKALM 299

Query: 300 LWCF 303
            +  
Sbjct: 300 EYLL 303


>gi|327439280|dbj|BAK15645.1| ornithine carbamoyltransferase [Solibacillus silvestris StLB046]
          Length = 322

 Score =  221 bits (563), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 128/303 (42%), Positives = 189/303 (62%), Gaps = 5/303 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    L + +S  +  ++E+A ++K  ++     + L GK L MIFEK STRTRVSFEV 
Sbjct: 19  KDLLTLLDYTSEEVKQLLELATQLKIITKAGKCPRLLEGKTLGMIFEKSSTRTRVSFEVG 78

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG  ++++  +MQ+GR E I DT +VLS Y+D I++R  +H+ + EL + A++PVI
Sbjct: 79  MQQLGGYGMYMNARDMQIGRGEPISDTGRVLSGYLDGIMIRANSHTMVEELADNASIPVI 138

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ +AD+ T  E++G +KG   ++ GDGNN+ H+LI  AA     + +ATP
Sbjct: 139 NGLTDLDHPCQALADLETIAENKGELKGLKIAYVGDGNNVAHALIAAAAHVGMHVAVATP 198

Query: 186 IGSEPRNEYLNWARNQGASV----ALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHV 240
            G E    ++  A+   +       + +D V AV  A  V+ D W SM QE +  +    
Sbjct: 199 PGYECDKRFIEKAQMIASRNGSTIVVTNDPVAAVTDADAVYADVWTSMGQEEETLKRLKD 258

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+ +Q+N  L++ A PD +F+HCLPAHR EEV   V+DGP S +F++AENRLH QKA+L+
Sbjct: 259 FEKYQINDELVAHAKPDYMFLHCLPAHREEEVATSVIDGPNSYIFEQAENRLHAQKAVLV 318

Query: 301 WCF 303
              
Sbjct: 319 SLL 321


>gi|163744067|ref|ZP_02151434.1| ornithine carbamoyltransferase [Phaeobacter gallaeciensis 2.10]
 gi|161382683|gb|EDQ07085.1| ornithine carbamoyltransferase [Phaeobacter gallaeciensis 2.10]
          Length = 335

 Score =  221 bits (563), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 159/307 (51%), Positives = 213/307 (69%), Gaps = 7/307 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNS-----SENIFENKPLSGKVLAMIFEKPSTRTR 59
             HF D+    +++L  II+ A   K +          +  PL  +++A+IFEKPSTRTR
Sbjct: 28  MNHFLDIHKTDATDLRAIIDQASATKQARLGRPKAAPDDELPLKDRMVALIFEKPSTRTR 87

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V ++ +GG T+ LSG++MQLG  ETI DTA+VLSRYVD I++RT + + L E+ EY
Sbjct: 88  VSFDVGVRQMGGQTMVLSGNDMQLGHGETIADTARVLSRYVDMIMIRTFDETVLTEMAEY 147

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           A+VPVIN LTD THPCQI+AD++T+EEHRG +KGK   W GDGNN+  S +  AA+F + 
Sbjct: 148 ASVPVINGLTDRTHPCQIMADVLTYEEHRGPIKGKKVVWCGDGNNVCASFLHAAAQFGFD 207

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKARE 237
           L    P   +P  E++  ARN G+ V +  DA +AV+GA  V  DTW+SM+  Q  K R 
Sbjct: 208 LTFTGPAQLDPEPEFIGLARNAGSQVIIERDAAKAVEGADLVVADTWVSMHDSQSSKERR 267

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
            ++ + +QVN +LM+ A PDALFMHCLPAHR EEV + V+DGPQSV+FDEAENRLH QKA
Sbjct: 268 HNMLRGYQVNDALMAHAKPDALFMHCLPAHREEEVTSAVMDGPQSVIFDEAENRLHAQKA 327

Query: 298 ILLWCFG 304
           I+ +C G
Sbjct: 328 IMRYCLG 334


>gi|163857000|ref|YP_001631298.1| ornithine carbamoyltransferase [Bordetella petrii DSM 12804]
 gi|163260728|emb|CAP43030.1| argF [Bordetella petrii]
          Length = 313

 Score =  221 bits (563), Expect = 9e-56,   Method: Composition-based stats.
 Identities = 131/299 (43%), Positives = 188/299 (62%), Gaps = 3/299 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF    + S + ++ ++E A+ IK+  +    + PL  + LAM+FEK STRTRVSFE  
Sbjct: 12  RHFLQFRDFSPAEIAYVLERARLIKDKFKRYEPHMPLHDRTLAMVFEKASTRTRVSFEAG 71

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  +GG  I L+ ++ QLGR+E I DTA+V+SR VD +++RT   +R+     ++ VPVI
Sbjct: 72  MYQMGGSVINLTSNDSQLGRSEPIEDTARVISRMVDIVMIRTFEQTRIERFASHSRVPVI 131

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI T+ EHRG + GK  +W GD NN+ ++ ++ A    + L+++TP
Sbjct: 132 NGLTNEFHPCQILADIFTYIEHRGPIAGKTVAWIGDANNMSYTWLQAAEMLGFSLHVSTP 191

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQPF 244
            G E     +         +  F D ++A +GAH V TD W SM  E +       F  +
Sbjct: 192 RGYELDPARV--GTPPAGVLRQFDDPIEACRGAHLVTTDVWTSMGYEAENDARRAAFADW 249

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
            V+  +M+ A P A+FMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA++ +  
Sbjct: 250 CVDAEMMAAADPQAVFMHCLPAHRGEEVTGEVIDGPQSVVWDEAENRLHVQKALMEFLL 308


>gi|167561807|ref|ZP_02354723.1| ornithine carbamoyltransferase [Burkholderia oklahomensis EO147]
          Length = 309

 Score =  221 bits (563), Expect = 9e-56,   Method: Composition-based stats.
 Identities = 123/304 (40%), Positives = 176/304 (57%), Gaps = 3/304 (0%)

Query: 2   MTYP--KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    +H+    + S  +   ++E    +K   +N     PL  + LAMIFEK STRTR
Sbjct: 1   MTAKTIRHYLQFKDFSLEDYEYVLERTGILKRKFKNYETYHPLHDRTLAMIFEKSSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +F+S  + QLGR E + D+A+V+SR VD I++RT     +    E 
Sbjct: 61  LSFEAGIFQLGGHAVFMSTRDTQLGRGEPVEDSAQVISRMVDIIMIRTFEQGIIQRFAEN 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT+  HPCQ++ADI T+ EHRG ++GK  +W GD NN+L++ I+ A   ++ 
Sbjct: 121 SRVPVINGLTNEYHPCQVLADIFTYYEHRGPIRGKTVAWVGDANNMLYTWIQAARILDFK 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L ++TP G     + ++        V    +              T +    E +A  + 
Sbjct: 181 LRLSTPPGYTLDAKLVDPESAPFYQVFDDPNEACKGADLVTTDVWTSMGFEAENEA-RKQ 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  + V+  +MS A+PDALFMHCLPAHRGEEV   V+DGPQSVV+DEAENRLH QKA++
Sbjct: 240 AFADWCVDEEMMSHANPDALFMHCLPAHRGEEVTASVIDGPQSVVWDEAENRLHVQKALM 299

Query: 300 LWCF 303
            +  
Sbjct: 300 EFLL 303


>gi|294497451|ref|YP_003561151.1| ornithine carbamoyltransferase [Bacillus megaterium QM B1551]
 gi|294347388|gb|ADE67717.1| ornithine carbamoyltransferase [Bacillus megaterium QM B1551]
          Length = 316

 Score =  221 bits (563), Expect = 9e-56,   Method: Composition-based stats.
 Identities = 139/305 (45%), Positives = 195/305 (63%), Gaps = 5/305 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K    L ++SS ++  ++E A ++K   +N      L GK L +IFEK STRTRVSFE
Sbjct: 11  KGKDLLTLKDLSSDDIMSLLESAIELKQKHKNGEIVTSLKGKTLGLIFEKSSTRTRVSFE 70

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
             M  LGG+ +FLS  ++Q+GR ETI DTA+VLS ++DAI++RT  HS++ EL +YA++P
Sbjct: 71  AGMMQLGGNALFLSSQDLQIGRGETIADTARVLSEFIDAIMIRTFEHSKIEELADYASIP 130

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD+ HPCQ +AD++T  EH+ S +G   ++ GDGNN+ HSL+   A+    ++I 
Sbjct: 131 VINGLTDDYHPCQALADLLTIYEHKKSFEGLKVAYVGDGNNVAHSLMIACAKMGIDISIG 190

Query: 184 TPIGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REE 238
            P G EP++    +    A   GA V +  D V+AVK A  ++ D W SM QE +A +  
Sbjct: 191 CPDGYEPKDFVTAYVNEIAATTGAKVTITKDPVEAVKNADAIYADVWTSMGQEEEAQQRL 250

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
            +F P+QVN  L + A  D LF+HCLPAHR EEV   ++DGP SVVF +A NR+H QKA+
Sbjct: 251 KIFAPYQVNEELAAYAKSDYLFLHCLPAHREEEVTASIIDGPNSVVFQQAGNRMHVQKAL 310

Query: 299 LLWCF 303
           L    
Sbjct: 311 LQAIL 315


>gi|120609851|ref|YP_969529.1| ornithine carbamoyltransferase [Acidovorax citrulli AAC00-1]
 gi|166918643|sp|A1TLB7|OTC_ACIAC RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|120588315|gb|ABM31755.1| ornithine carbamoyltransferase [Acidovorax citrulli AAC00-1]
          Length = 309

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 124/299 (41%), Positives = 179/299 (59%), Gaps = 1/299 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH+    + S+   + + E A  IK   +   ++ PL+ + LAMIFEK STRTRVSFE 
Sbjct: 7   MKHYLQFKDFSAQEYAYLFERAAVIKGKFKRYEKHHPLTDRTLAMIFEKASTRTRVSFEA 66

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG  + L+  + QLGRAE I D+AKV+SR VD +++RT   +++     ++ VPV
Sbjct: 67  GMYQLGGSVVHLTTGDSQLGRAEPIEDSAKVISRMVDLVMIRTYEQTKIERFAAHSRVPV 126

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LT+  HPCQI+ADI TF EHRGS++G+  +W GDGNN+ ++ ++ A    + ++++T
Sbjct: 127 INGLTNEFHPCQILADIFTFIEHRGSIQGRTVAWVGDGNNMANTWLQAAELLGFTVHVST 186

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P G E  +     A      V                   T +    E +A  +  F  +
Sbjct: 187 PSGYEVDSRVAGVAAGSHYKVFSDPLEACRGADLITTDVWTSMGYEAENEA-RKKAFADW 245

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
            V+  +M+ A P+ALFMHCLPAHRGEEV  +V+DGPQSVV+DEAENR+H QKA++ +  
Sbjct: 246 CVDAEMMAAARPEALFMHCLPAHRGEEVEADVIDGPQSVVWDEAENRMHVQKALMEYLL 304


>gi|257437643|ref|ZP_05613398.1| ornithine carbamoyltransferase [Faecalibacterium prausnitzii
           A2-165]
 gi|257199950|gb|EEU98234.1| ornithine carbamoyltransferase [Faecalibacterium prausnitzii
           A2-165]
          Length = 304

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 121/301 (40%), Positives = 165/301 (54%), Gaps = 2/301 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH   +S++S + L  I++VA+++K   +       L G+ +A++F K STRTR SFEV
Sbjct: 1   MKHLLKMSDLSPAELHHILDVAEELKAEQKAGTTPALLKGRSVALMFSKNSTRTRTSFEV 60

Query: 65  AMKHLGGDTIFLSGSEM-QLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
            +  LGG   +++ +   Q GR E + DTA+VL RY D +V RT     L E  E A VP
Sbjct: 61  GVYQLGGLGNYMNAATELQSGRGEPLKDTARVLGRYYDCVVWRTYRQCDLEEFAELAGVP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQ++AD+MT  E RG+++G+   + GDG ++ +SLI G       +   
Sbjct: 121 VINGLTDYAHPCQVLADLMTIRERRGTLEGQKLCFIGDGCSMANSLIVGGLLAGMRVTCV 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN-QEFKAREEHVFQ 242
            P G  P  + L +A   G    L  D  + VK A  V T  W +        R    F 
Sbjct: 181 CPEGYRPAADVLMFAHKYGEKFHLLTDPAEGVKDADVVVTAAWNTAPGTPESERRLRDFA 240

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            FQV   LM  A PDA+ +HCLPAHRGEE+   V +     +FDEAENRLH QKA+L   
Sbjct: 241 GFQVTSRLMEGAKPDAMLLHCLPAHRGEEISTAVFEEHADEIFDEAENRLHVQKAVLAIL 300

Query: 303 F 303
            
Sbjct: 301 L 301


>gi|332526344|ref|ZP_08402470.1| ornithine carbamoyltransferase [Rubrivivax benzoatilyticus JA2]
 gi|332110480|gb|EGJ10803.1| ornithine carbamoyltransferase [Rubrivivax benzoatilyticus JA2]
          Length = 303

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 130/300 (43%), Positives = 189/300 (63%), Gaps = 3/300 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH+    ++ +   + + E A+ IK   +N  + +PL  + LAMIFEK STRTRVSFE 
Sbjct: 1   MKHYLQFKDLRAEEYAYLFERARIIKTRFKNYEKYQPLVDRTLAMIFEKASTRTRVSFEA 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  +GG  + L+  + QLGRAE I D+A+V+SR VD +++RT   +++     ++ VPV
Sbjct: 61  GMYQMGGSVVHLTTGDSQLGRAEPIEDSARVISRMVDIVMIRTFEQAKIERFAAHSRVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LT+  HPCQI+AD+ T+ EHRGS++GK+ +W GDGNN+ ++ ++ A    + ++++T
Sbjct: 121 INGLTNEFHPCQILADLFTYIEHRGSIEGKVVAWVGDGNNMANTWLQAAEILGFTVHVST 180

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQP 243
           P G     +             +F D  +A +GAH V TD W SM  E +       F  
Sbjct: 181 PGGY--EVDPALAGIRDSGCYKVFADPREACRGAHLVTTDVWTSMGYEAENEARRTAFAD 238

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           + V+  +M+ A PDALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENR+H QKA++ +  
Sbjct: 239 WCVDAGMMAAAQPDALFMHCLPAHRGEEVSAEVIDGPQSVVWDEAENRMHVQKALMEYLL 298


>gi|30249409|ref|NP_841479.1| ornithine carbamoyltransferase [Nitrosomonas europaea ATCC 19718]
 gi|32699432|sp|Q82UP4|OTC_NITEU RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|30138772|emb|CAD85349.1| argF; ornithine carbamoyltransferase protein [Nitrosomonas europaea
           ATCC 19718]
          Length = 307

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 125/298 (41%), Positives = 171/298 (57%), Gaps = 1/298 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF    +        + +  + IKN  +      PL+ + LAMIFEK STRTR+SFE  
Sbjct: 4   RHFLQFKDFDRQEYEYLFDRTRWIKNEFKQYRRYWPLTDRTLAMIFEKHSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  I+LS  + QLGR E + D A+V+SR VD I +RT  H  +    E + VPVI
Sbjct: 64  MHQLGGSAIYLSTRDTQLGRGEPVEDAARVISRMVDIITLRTHEHGVIERFAENSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQI+ADI TF EHRGS+ GK  +W GD NN+ ++ ++ A  F++ ++++TP
Sbjct: 124 NGLTDEYHPCQILADIFTFMEHRGSIAGKTVAWIGDSNNVCNTWLQAAEVFDFNVHVSTP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G E   E             +                 T     ++     ++ F  F+
Sbjct: 184 PGYEVEPERAGLYGTDHYEQFVSPHDAVKDADLVTTDVWTS-MGFEDEADTRKNDFADFR 242

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           V+  +M+ A  +ALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLHTQKA++ +  
Sbjct: 243 VDAEMMACAKEEALFMHCLPAHRGEEVDAEVIDGPQSVVWDEAENRLHTQKALMEYLL 300


>gi|91776062|ref|YP_545818.1| ornithine carbamoyltransferase [Methylobacillus flagellatus KT]
 gi|122985479|sp|Q1H0L0|OTC_METFK RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|91710049|gb|ABE49977.1| ornithine carbamoyltransferase [Methylobacillus flagellatus KT]
          Length = 306

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 121/302 (40%), Positives = 173/302 (57%), Gaps = 2/302 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF   +++++  L+ I E  + IK   +   +  PL+ + L MIFEK STRTR+SFE  
Sbjct: 4   KHFLQFNDLNADELAHIFERTRWIKEQFKAYQQYWPLTDRTLVMIFEKASTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG  I+L+  + QLGR E + D A+V+SR  D +++RT     +      + VPVI
Sbjct: 64  MQQLGGSAIYLNTRDSQLGRGEPVEDAAQVISRMSDIVMIRTFEQEIIERFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI T+ EHRGS+KGK  +W GD NN+ ++ ++ A   ++ ++++TP
Sbjct: 124 NGLTNEYHPCQILADIFTYIEHRGSIKGKTVAWIGDSNNVCNTWLQAAEVLDFNVHVSTP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G E   E  N                            T +    E + R       +Q
Sbjct: 184 PGYEVEPERANLYGTDHYEEFTDPMEAARGADLVTTDVWTSMGFEAENEERRRDFH-DWQ 242

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL-LWCFG 304
           V+  +M +A  DALFMHCLPAHRGEEV  +V+DG QSVV+DEAENRLH QKA++     G
Sbjct: 243 VDADMMRVAGKDALFMHCLPAHRGEEVTADVIDGAQSVVWDEAENRLHVQKALMEYLLLG 302

Query: 305 II 306
            +
Sbjct: 303 KV 304


>gi|23016456|ref|ZP_00056212.1| COG0078: Ornithine carbamoyltransferase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 305

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 160/299 (53%), Positives = 206/299 (68%), Gaps = 4/299 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            +HF DL+   ++ L  I+++    K          PL+GK+LAMIFEKPSTRTRVSFEV
Sbjct: 10  RRHFLDLNEFDTATLRHILDLGLAYKQGK---GPKAPLAGKMLAMIFEKPSTRTRVSFEV 66

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            MK LGGD I L+  + QLGR ETI DTA+VLSR+VD +++RT    ++ EL +YA VPV
Sbjct: 67  GMKQLGGDVIMLAAGDTQLGRGETIADTARVLSRFVDVVMIRTNLPEKMTELAKYADVPV 126

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD +HPCQ++AD+MTFEEHRGS+KGK+ +W GDGNN+  S I  A  F   + +A 
Sbjct: 127 INGLTDESHPCQVMADVMTFEEHRGSLKGKVVAWVGDGNNVAASWIHAAGHFGCEIRLAC 186

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P    P  + ++WAR +G SV L     +AV GAH V TDTW+SM  +       + +P+
Sbjct: 187 PESLMPSRKAVDWARARGTSVVLTTHPAEAVAGAHLVLTDTWVSMGCQDD-NRHELLEPY 245

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           QVN +LM+ A PDALFMHCLPAHRGEEV + ++DG QSVV+DEAENR+H QK IL WC 
Sbjct: 246 QVNEALMAKASPDALFMHCLPAHRGEEVTDAIMDGHQSVVWDEAENRMHVQKGILTWCL 304


>gi|93006287|ref|YP_580724.1| ornithine carbamoyltransferase [Psychrobacter cryohalolentis K5]
 gi|122415260|sp|Q1QAR3|OTC_PSYCK RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|92393965|gb|ABE75240.1| ornithine carbamoyltransferase [Psychrobacter cryohalolentis K5]
          Length = 305

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 121/298 (40%), Positives = 182/298 (61%), Gaps = 2/298 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  LS+++   L  +I+ A ++++        +P  G+ L MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLSDLTKQELENLIKRASELRHMQHAGEIYQPFVGRTLGMIFEKSSTRTRISFETG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M   GG  IFLS ++ QLGR E I D+A+V+S  VD I++RT  H ++    +Y++VP+I
Sbjct: 64  MGQFGGSAIFLSPNDTQLGRGEPIEDSARVISSMVDIIMIRTFGHEKVETFAKYSSVPII 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD  HPCQ++AD+ T+ EHRGS++ K+ +W GDGNN+  S ++ A +F + L +A P
Sbjct: 124 NALTDEFHPCQLLADMQTYYEHRGSIENKIVTWVGDGNNMCASYMQAANQFGFELRVAAP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G EP  E +    +  + V    +A +           +     +  +      F  +Q
Sbjct: 184 YGFEPDPELMKRFSHCVSIVENVQEAAKDSHLIVTDVWASM--GQESEQNTRARRFSSYQ 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           V  SL+  A  + +FMHCLPAHRGEE+ +++LD P+SVV+DEAENRLH QKA++ +  
Sbjct: 242 VTPSLLDKADSEVVFMHCLPAHRGEEISHDMLDDPRSVVWDEAENRLHAQKALMEFLL 299


>gi|150400787|ref|YP_001324553.1| ornithine carbamoyltransferase [Methanococcus aeolicus Nankai-3]
 gi|189036328|sp|A6UTW9|OTC_META3 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|150013490|gb|ABR55941.1| ornithine carbamoyltransferase [Methanococcus aeolicus Nankai-3]
          Length = 304

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 131/304 (43%), Positives = 191/304 (62%), Gaps = 10/304 (3%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAM 66
           H   L N+   ++  I+  A   K + ++      L  K +A+IFE PSTRTR+SF++A+
Sbjct: 2   HLLTLENLERKDIENILNDAIYFKKNRKS---ENILKEKTVALIFESPSTRTRISFDIAV 58

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
             LGG ++ L+  E  + + E+  DTAKVLSR+VD IV R   HS L + T+Y  VPVIN
Sbjct: 59  NELGGHSLTLNTGETHVSKKESTKDTAKVLSRFVDVIVARVKEHSTLEDFTKYGNVPVIN 118

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI 186
           AL+D +HPCQI+AD++T +EH+  + G  F++ GDGNN+ +SLI G A     + +ATP 
Sbjct: 119 ALSDLSHPCQILADLLTIKEHKNKLSGLKFAYFGDGNNVCNSLILGCAIMGMDIFVATPE 178

Query: 187 GSEPRNEYLNWARNQGASV-----ALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE--H 239
           G EP  +++  A+            +  DA+   K A  ++TD W+SM+ + K  +E   
Sbjct: 179 GYEPNEKFVKMAQQIIDKQGEGSITITDDAIICAKDADVLYTDVWVSMSDKNKNIDEVLK 238

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           +F P+Q+N  L+S A  DA+ MHCLPA+RG E+ +EV+DG QSVV+DEAENRLH QKA+ 
Sbjct: 239 IFPPYQINEKLLSYAKKDAIVMHCLPANRGMEITDEVIDGEQSVVYDEAENRLHAQKAVF 298

Query: 300 LWCF 303
            + F
Sbjct: 299 KYIF 302


>gi|114332032|ref|YP_748254.1| ornithine carbamoyltransferase [Nitrosomonas eutropha C91]
 gi|122313269|sp|Q0AEE3|OTC_NITEC RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|114309046|gb|ABI60289.1| ornithine carbamoyltransferase [Nitrosomonas eutropha C91]
          Length = 307

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 126/298 (42%), Positives = 170/298 (57%), Gaps = 1/298 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF    +        + +  + IKN  +      PL+ + LAMIFEK STRTR+SFE  
Sbjct: 4   RHFLQFKDFDRLEFEYLFDRTRWIKNEFKQYRRYWPLTDRTLAMIFEKHSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  I+LS  + QLGR E + D A+V+SR VD I +RT  H  +    E + VPVI
Sbjct: 64  MHQLGGSAIYLSTRDTQLGRGEPVEDAARVISRMVDIITIRTHEHQIIERFAENSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQI+ADI TF EHRGS+ GK  +W GD NN+ ++ ++ A  F++ ++++TP
Sbjct: 124 NGLTDEYHPCQILADIFTFIEHRGSITGKTITWIGDSNNVCNTWLQAAEIFDFNVHVSTP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G E   E             +                 T +    E     ++ F  F 
Sbjct: 184 PGYEVEPERAGLYGTDHYEQFVSPHDAVKDADLVTTDVWTSMGFEDELD-TRKNDFADFC 242

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           V+  +M+ A  +ALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLHTQKA++ +  
Sbjct: 243 VDAEMMACAKKEALFMHCLPAHRGEEVDAEVIDGPQSVVWDEAENRLHTQKALMEYLL 300


>gi|114567795|ref|YP_754949.1| ornithine carbamoyltransferase [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
 gi|114338730|gb|ABI69578.1| ornithine carbamoyltransferase [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
          Length = 313

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 141/303 (46%), Positives = 198/303 (65%), Gaps = 5/303 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F  + + S   ++ I+EV  ++K   ++   +  L+GK LAMIF+K STRTRV+FEV 
Sbjct: 11  RDFISIHDFSREEIAYILEVGAELKKMQKSGIAHHYLAGKTLAMIFQKASTRTRVAFEVG 70

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLS  ++QLGR ETI DTA+VL+R VD I++RT  H  +LEL ++++VPVI
Sbjct: 71  MYQLGGHALFLSPRDIQLGRGETIKDTAQVLTRMVDGIMIRTFGHEEVLELAQWSSVPVI 130

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HP Q+I D+MT +EH+G+++G   ++ GDGNN+ HSL+ G A+    + IA+P
Sbjct: 131 NGLTDLLHPTQVIGDLMTIKEHKGTLQGLKCAFIGDGNNVAHSLLFGGAKVGMDVAIASP 190

Query: 186 IGSEPRNEYLNWARNQGASV----ALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHV 240
            G E     L  AR           +  D V+A+  A  V+TD W SM QE +A  +E  
Sbjct: 191 GGFEADVSILEMAREDAQESGARLQVLSDPVEAITDADVVYTDVWASMGQEEEADDKEQH 250

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F  +QVN  L+S+A PDA+ +HCLPA RG+E+ +EV+DGPQS VF+EAENRLH  KAI+ 
Sbjct: 251 FLQYQVNRKLLSLARPDAIVLHCLPAKRGKEITDEVMDGPQSRVFEEAENRLHAHKAIMA 310

Query: 301 WCF 303
              
Sbjct: 311 LLM 313


>gi|237653340|ref|YP_002889654.1| ornithine carbamoyltransferase [Thauera sp. MZ1T]
 gi|237624587|gb|ACR01277.1| ornithine carbamoyltransferase [Thauera sp. MZ1T]
          Length = 308

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 120/307 (39%), Positives = 171/307 (55%), Gaps = 3/307 (0%)

Query: 2   MTYP-KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M+ P KH+    + +      +   AK IK+  +      PL  + L MIFEK STRTR+
Sbjct: 1   MSSPIKHYLQFKDFTREEYEYVFARAKWIKDKFKRYEPYHPLFDRTLVMIFEKASTRTRL 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFE  M  LGG  I+L+  + QLGR E + D  +V+SR  D +++RT     +      +
Sbjct: 61  SFEAGMHQLGGSAIYLNTRDSQLGRGEPVEDAGQVISRMSDLVMIRTFEQDIVERFAANS 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
            VP+IN LT+  HPCQI+ADI+TF EHRGS++GK  +W GD NN+ ++ ++ A   ++ +
Sbjct: 121 RVPIINGLTNEYHPCQILADILTFIEHRGSIQGKTVAWIGDSNNMCNTWLQAAEVLDFNV 180

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
           +++TP G E   E                               T +    E +      
Sbjct: 181 HVSTPPGYEVEPERAGLYGTANFEQFADPMDACRGADLVTTDVWTSMGFEAENEE-RMKA 239

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F  + V+  +MS+AH +A+FMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA++ 
Sbjct: 240 FADWCVDAEMMSVAHKEAVFMHCLPAHRGEEVTAEVIDGPQSVVWDEAENRLHAQKALME 299

Query: 301 WC-FGII 306
           +   G I
Sbjct: 300 YLVLGRI 306


>gi|254477141|ref|ZP_05090527.1| ornithine carbamoyltransferase [Ruegeria sp. R11]
 gi|214031384|gb|EEB72219.1| ornithine carbamoyltransferase [Ruegeria sp. R11]
          Length = 308

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 157/307 (51%), Positives = 215/307 (70%), Gaps = 7/307 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFE-----NKPLSGKVLAMIFEKPSTRTR 59
             HF D+    +++L  II+ A+  K++ +   +      +PL  +++A+IFEKPSTRTR
Sbjct: 1   MNHFLDIHKTDAADLRAIIDQARITKDARQGRPKAALDDEQPLKDRMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V ++ +GG T+ LSG++MQLG  ETI DTA+VLSRYVD I++RT + + L E+ EY
Sbjct: 61  VSFDVGVRQMGGQTMVLSGNDMQLGHGETIADTARVLSRYVDMIMIRTFDETVLTEMAEY 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           A+VPVIN LTD THPCQI+AD++T+EEHRGS+KGK   W GDGNN+  S I  A +F + 
Sbjct: 121 ASVPVINGLTDRTHPCQIMADVLTYEEHRGSIKGKKVVWCGDGNNVCASFIHAAGQFGFD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKARE 237
           L    P   +P  E++  AR  G+ + +  D  +AV+GA  V  DTW+SM+  Q  K R 
Sbjct: 181 LTFTGPAQLDPEEEFVGLARKAGSQIIIERDVNKAVEGADLVVADTWVSMHDSQSSKERR 240

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
            ++ + +QVN +LM+ A PDALFMHCLPAHR EEV + V+DGPQSV+FDEAENRLH QKA
Sbjct: 241 HNMLRSYQVNEALMAQAKPDALFMHCLPAHREEEVTSAVMDGPQSVIFDEAENRLHAQKA 300

Query: 298 ILLWCFG 304
           I+ +C G
Sbjct: 301 IMRYCLG 307


>gi|169633324|ref|YP_001707060.1| ornithine carbamoyltransferase [Acinetobacter baumannii SDF]
 gi|169152116|emb|CAP01015.1| ornithine carbamoyltransferase [Acinetobacter baumannii]
          Length = 306

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 131/298 (43%), Positives = 181/298 (60%), Gaps = 2/298 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++S+  L+ I+E A ++K   ++    +P  GKVL MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLRDLSTLELNRILERASELKKMQQSNKVYQPFVGKVLGMIFEKSSTRTRISFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +   GG  IFLS  + QLGR E I D+A+V+S  +D +++RT  H  +     Y+ VPVI
Sbjct: 64  INQFGGSAIFLSPRDTQLGRGEPIEDSARVISSMLDIVMIRTFGHDIVERFASYSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ++AD+ T+ E+RGS++GK  +W GDGNN+ +S IE A    + L IA+P
Sbjct: 124 NGLTDDHHPCQLLADLQTYIEYRGSIEGKTVAWIGDGNNMCNSYIEAAHMMGFKLKIASP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G EP+ E+L    +         DA             +     +E +   E  F  FQ
Sbjct: 184 KGYEPKPEFLAEFGHCVELFDNAEDAAVNADLIVTDVWASM--GQEEEQKLREKAFADFQ 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN  LM +AHPD LFMHCLPAHRGEE+   +LD   +VV+DEAENRLH QKA++ +  
Sbjct: 242 VNEKLMGLAHPDCLFMHCLPAHRGEEISETMLDHKNAVVWDEAENRLHAQKALMEFLL 299


>gi|296157212|ref|ZP_06840048.1| ornithine carbamoyltransferase [Burkholderia sp. Ch1-1]
 gi|295892548|gb|EFG72330.1| ornithine carbamoyltransferase [Burkholderia sp. Ch1-1]
          Length = 309

 Score =  220 bits (561), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 126/304 (41%), Positives = 176/304 (57%), Gaps = 3/304 (0%)

Query: 2   MTYP--KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    +H+    + S  +   ++E A+ +K   +N     PL  + LAMIFEK STRTR
Sbjct: 1   MTAKKIRHYLQFKDFSLEDYEYVLERARILKRKFKNYETYHPLHDRTLAMIFEKNSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +F+S  + QLGR E I D A+V+SR VD I++RT     L   +E 
Sbjct: 61  LSFEAGIFQLGGHAVFMSTRDTQLGRGEPIEDAAQVISRMVDIIMIRTFGQDILQRFSEN 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT+  HPCQ++ADI T+ EHRG ++GK  +W GD NN+L++ IE A    + 
Sbjct: 121 SRVPVINGLTNEYHPCQVLADIFTYFEHRGPIRGKTVAWVGDANNMLYTWIEAAQILGFK 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L ++TP G +     +              +   A          T +    E +A  + 
Sbjct: 181 LRLSTPPGYKLDRAMVAAESAPFYEEFDDPNEACAGADLVTTDVWTSMGFEAENEA-RKK 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  + V+  +M+ A+ DALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA++
Sbjct: 240 AFADWCVDADMMARANADALFMHCLPAHRGEEVSAEVIDGPQSVVWDEAENRLHVQKALM 299

Query: 300 LWCF 303
            +  
Sbjct: 300 EYLL 303


>gi|332798248|ref|YP_004459747.1| Ornithine carbamoyltransferase [Tepidanaerobacter sp. Re1]
 gi|332695983|gb|AEE90440.1| Ornithine carbamoyltransferase [Tepidanaerobacter sp. Re1]
          Length = 321

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 137/307 (44%), Positives = 192/307 (62%), Gaps = 6/307 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K    L ++S+  +  I+   + +K   +   + +PL GK L MIFEK STRTRVSFE
Sbjct: 15  KGKDLLSLYDLSNLEIEEILNKCETLKTMHKLGADYQPLKGKTLGMIFEKSSTRTRVSFE 74

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VAM  LGG  +FLS  ++Q+GR ETI DTA+VLSRY+D I++R  +H  +  L +YA +P
Sbjct: 75  VAMWQLGGHALFLSNRDIQIGRGETIPDTARVLSRYLDGIMIRAYSHDDVKLLAKYADIP 134

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGD-GNNILHSLIEGAARFNYLLNI 182
           VIN LTD THPCQ++AD+ T +E +  + G   ++ GD  NN+ +SLI G ++    + +
Sbjct: 135 VINGLTDYTHPCQVLADLFTIQEKKKKLSGLKLAFIGDGKNNMANSLIFGCSKVGMDIAV 194

Query: 183 ATPIGSEPRNEYLNWAR----NQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-ARE 237
           A+P    P  E +N A+      G+ + L  D  +A K A  ++TD W SM QE +    
Sbjct: 195 ASPEEFLPDKEVVNKAKADAVMNGSKIILTDDVFEAAKDADVLYTDVWTSMGQEEETEYR 254

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
           + VF  +Q+N  L+S+A  + + MHCLPAHRGEE+  EV++G  SVVFDEAENRLH QKA
Sbjct: 255 KKVFAGYQINQELLSVADENVIVMHCLPAHRGEEITEEVIEGEHSVVFDEAENRLHVQKA 314

Query: 298 ILLWCFG 304
           IL    G
Sbjct: 315 ILSLVMG 321


>gi|167569030|ref|ZP_02361904.1| ornithine carbamoyltransferase [Burkholderia oklahomensis C6786]
          Length = 309

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 123/304 (40%), Positives = 176/304 (57%), Gaps = 3/304 (0%)

Query: 2   MTYP--KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    +H+    + S  +   ++E    +K   +N     PL  + LAMIFEK STRTR
Sbjct: 1   MTAKTIRHYLQFKDFSLEDYEYVLERTGILKRKFKNYETYHPLHDRTLAMIFEKSSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +F+S  + QLGR E + D+A+V+SR VD I++RT     +    E 
Sbjct: 61  LSFEAGIFQLGGHAVFMSTRDTQLGRGEPVEDSAQVISRMVDIIMIRTFEQGIIQRFAEN 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT+  HPCQ++ADI T+ EHRG ++GK  +W GD NN+L++ I+ A   ++ 
Sbjct: 121 SRVPVINGLTNEYHPCQVLADIFTYYEHRGPIRGKTVAWVGDANNMLYTWIQAARILDFK 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L ++TP G     + ++        V    +              T +    E +A  + 
Sbjct: 181 LRLSTPPGYTLDAKLVDPESAPFYQVFDDPNEACKGADLVTTDVWTSMGFEAENEA-RKQ 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  + V+  +MS A+PDALFMHCLPAHRGEEV   V+DGPQSVV+DEAENRLH QKA++
Sbjct: 240 AFADWCVDEEMMSHANPDALFMHCLPAHRGEEVTAGVIDGPQSVVWDEAENRLHVQKALM 299

Query: 300 LWCF 303
            +  
Sbjct: 300 EFLL 303


>gi|237747033|ref|ZP_04577513.1| ornithine carbamoyltransferase [Oxalobacter formigenes HOxBLS]
 gi|229378384|gb|EEO28475.1| ornithine carbamoyltransferase [Oxalobacter formigenes HOxBLS]
          Length = 303

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 130/301 (43%), Positives = 177/301 (58%), Gaps = 3/301 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT  KH+   S+ S S    +IE A+ IK   +N     PL  + L M+FEK STRTR+S
Sbjct: 1   MTI-KHYLQFSDFSLSEYEYLIERARIIKQKFKNYEPYHPLQDRTLVMVFEKSSTRTRLS 59

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  I+L+  + QLGR E I D A+V+SR  D I++RT  H  +      + 
Sbjct: 60  FEAGMHQLGGTAIYLNTRDSQLGRGEPIEDAAQVMSRMSDIIMVRTFGHDIIERFAACSR 119

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LT+  HPCQ+ AD+ TF EHRGS++GK  +W GD NN+L+S ++ A  F++ +N
Sbjct: 120 VPVINGLTNEHHPCQVFADVFTFIEHRGSIQGKTVTWIGDANNMLYSWLQAAEVFDFHVN 179

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           ++TP G +   + ++   +         DA +           +     +E  A  +  F
Sbjct: 180 VSTPKGYDIDFKLVSPDHSHFTRFDNPADACEGAHLVTTDVWTSM--GFEEENAARKKAF 237

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
             + V+   M  A  DALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA+L +
Sbjct: 238 ANWNVDSDKMRRAASDALFMHCLPAHRGEEVTAEVIDGPQSVVWDEAENRLHVQKALLEY 297

Query: 302 C 302
            
Sbjct: 298 L 298


>gi|296117453|ref|ZP_06836040.1| ornithine carbamoyltransferase [Gluconacetobacter hansenii ATCC
           23769]
 gi|295975974|gb|EFG82765.1| ornithine carbamoyltransferase [Gluconacetobacter hansenii ATCC
           23769]
          Length = 329

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 159/305 (52%), Positives = 207/305 (67%), Gaps = 4/305 (1%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK----PLSGKVLAMIFEKPSTRT 58
             P+HF DL ++ ++ L  I++VA  IK              PL G++L ++  KPSTRT
Sbjct: 12  AQPRHFLDLRDLDAATLRAILDVAAGIKRMQHGRARPLHPRLPLHGRMLGLMLSKPSTRT 71

Query: 59  RVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTE 118
           RVSFEV M+ LGGD I LS  +MQLGR E+I DTA+VLSR+VDA+V+RT     L EL +
Sbjct: 72  RVSFEVGMRQLGGDVILLSPGDMQLGRGESIADTARVLSRFVDALVLRTGRTQNLRELAK 131

Query: 119 YATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNY 178
           +++VPVIN LT ++HP QI+ADIMTFEEHRG + G+  +W GDGNN+  S IE AA F +
Sbjct: 132 WSSVPVINGLTPDSHPVQILADIMTFEEHRGPITGRTLAWVGDGNNVATSFIEAAALFGF 191

Query: 179 LLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE 238
            L +ATP    P    + WAR QGA + +  DA+ AV GA  V TDTW+SM+     +  
Sbjct: 192 RLRLATPPTHLPCTRAVEWARAQGADITVGTDAMTAVAGADAVITDTWVSMSDNASEQRA 251

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
           H F+P++V+ +LM+ A PDALF+HCLPAH GEEV  +V DGP SVVFDEAENRLH QK +
Sbjct: 252 HAFEPYRVDAALMARAAPDALFLHCLPAHIGEEVTADVFDGPNSVVFDEAENRLHAQKGL 311

Query: 299 LLWCF 303
           L+W  
Sbjct: 312 LVWAL 316


>gi|121595318|ref|YP_987214.1| ornithine carbamoyltransferase [Acidovorax sp. JS42]
 gi|222111602|ref|YP_002553866.1| ornithine carbamoyltransferase [Acidovorax ebreus TPSY]
 gi|120607398|gb|ABM43138.1| ornithine carbamoyltransferase [Acidovorax sp. JS42]
 gi|221731046|gb|ACM33866.1| ornithine carbamoyltransferase [Acidovorax ebreus TPSY]
          Length = 305

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 130/301 (43%), Positives = 190/301 (63%), Gaps = 2/301 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH+   ++ ++   + +   A  IK   ++  +  PL+ + LAMIFEK STRTRVSFE 
Sbjct: 1   MKHYLQFTDFTADEYNYLFSRAAIIKGKFKSYEKYHPLADRTLAMIFEKASTRTRVSFEA 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG  + L+  + QLGRAE I D+A+V+SR  D +++RT  H ++    EY+ VPV
Sbjct: 61  GMYQLGGSVVHLTTGDSQLGRAEPIEDSARVISRMTDLVMIRTFGHDKIERFAEYSRVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LT+  HPCQI+AD+ T+ EHRGS+ GK+ +W GDGNN+ ++ ++ A    + ++++T
Sbjct: 121 INGLTNEFHPCQIMADLFTYIEHRGSIAGKVVAWVGDGNNMANTWLQAADLLGFTVHVST 180

Query: 185 PIGSEPRNEYLNWARNQG-ASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQ 242
           P G E   +     +        +F D + A +GA  V TD W SM  E +       F 
Sbjct: 181 PGGYEVDEKLAFGGKPHRAGCYKVFADPMDACRGADLVTTDVWTSMGYEAENEARRKAFA 240

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            + V+  +M++A PDALFMHCLPAHRGEEV+ +V+DGPQSVV+DEAENR+H QKA++ + 
Sbjct: 241 DWCVDAEMMAVAKPDALFMHCLPAHRGEEVMADVIDGPQSVVWDEAENRMHVQKALMEYL 300

Query: 303 F 303
            
Sbjct: 301 L 301


>gi|115352652|ref|YP_774491.1| ornithine carbamoyltransferase [Burkholderia ambifaria AMMD]
 gi|115282640|gb|ABI88157.1| ornithine carbamoyltransferase [Burkholderia ambifaria AMMD]
          Length = 560

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 121/304 (39%), Positives = 172/304 (56%), Gaps = 3/304 (0%)

Query: 2   MTYP--KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    +H+    + S  +   ++E    +K   +N     PL  + LAMIFEK STRTR
Sbjct: 252 MTAKTIRHYLQFKDFSLEDYEYVLERTGILKRKFKNYETYHPLHDRTLAMIFEKSSTRTR 311

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +F+S  + QLGR E + D+A+V+SR VD I++RT     +    + 
Sbjct: 312 LSFEAGIFQLGGHAVFMSTRDTQLGRGEPVEDSAQVISRMVDIIMIRTFEQDVITRFAQN 371

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT++ HPCQ++ADI T+ EHRG + GK  +W GD NN+L++ IE A    + 
Sbjct: 372 SRVPVINGLTNDYHPCQVLADIFTYYEHRGPIAGKTVAWVGDANNMLYTWIEAAQILGFK 431

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L ++TP G     + ++        V    +              T +    E +A    
Sbjct: 432 LRLSTPPGYALDMKLVSPDSAPFYEVFDDPNEACKGADLVTTDVWTSMGFEAENEA-RMQ 490

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  + V+  +M  A+ DALFMHCLPAHRGEEV   V+DGPQSVV+DEAENRLH QKA++
Sbjct: 491 AFADWCVDEEMMGHANADALFMHCLPAHRGEEVTAGVIDGPQSVVWDEAENRLHVQKALM 550

Query: 300 LWCF 303
            +  
Sbjct: 551 EFLL 554


>gi|162147258|ref|YP_001601719.1| ornithine carbamoyltransferase [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161785835|emb|CAP55406.1| putative Ornithine carbamoyltransferase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 331

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 158/304 (51%), Positives = 208/304 (68%), Gaps = 4/304 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFEN----KPLSGKVLAMIFEKPSTRTRV 60
           P+HF DL +   + L  I+++  +IK             +PL G+ L ++  KPSTRTRV
Sbjct: 14  PRHFLDLRDFDGATLRAILDLGSRIKRMQHGRTRPLHPRQPLLGRALGLMLSKPSTRTRV 73

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFEV M+ LGGD I LS ++MQLGR E++ DTA+VLSR+VDAIV+RT N + L +L  +A
Sbjct: 74  SFEVGMRQLGGDVILLSPNDMQLGRGESVADTARVLSRFVDAIVLRTGNTAALHDLARWA 133

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +VPVIN LT ++HP QI+ADIMTFEEHRG + G+  +W GDGNN+  S IE A  F + L
Sbjct: 134 SVPVINGLTPDSHPVQILADIMTFEEHRGPIAGRTVAWVGDGNNVATSFIEAACLFGFRL 193

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            +ATP G  P  + L WAR +GA + +  D   AV GA CV TDTW+SM+    A+    
Sbjct: 194 RLATPPGHTPSVQALAWARQRGADIVVTTDPRAAVAGADCVVTDTWVSMSDTDAAQRLIA 253

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F P++V+ +LM++A PDALFMHCLPAH G+EV  +V +GP SVVFDEAENRLH QK +L+
Sbjct: 254 FDPYRVDAALMALAAPDALFMHCLPAHIGDEVTEDVFEGPHSVVFDEAENRLHAQKGLLV 313

Query: 301 WCFG 304
           W  G
Sbjct: 314 WAMG 317


>gi|261409620|ref|YP_003245861.1| ornithine carbamoyltransferase [Paenibacillus sp. Y412MC10]
 gi|329928726|ref|ZP_08282575.1| ornithine carbamoyltransferase [Paenibacillus sp. HGF5]
 gi|261286083|gb|ACX68054.1| ornithine carbamoyltransferase [Paenibacillus sp. Y412MC10]
 gi|328937507|gb|EGG33925.1| ornithine carbamoyltransferase [Paenibacillus sp. HGF5]
          Length = 318

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 133/305 (43%), Positives = 192/305 (62%), Gaps = 5/305 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             +   +L   S+  +  +++ A +IK   +N    +PL GK + +IFEK STRTRVSFE
Sbjct: 13  KGRDMIELDEYSTEEIQFLLDSAIEIKRKQKNGEVYQPLKGKTIGLIFEKSSTRTRVSFE 72

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
             M  LGG  +FLS +++QLGR E I DTA+V+SRY+D +++RT  H  ++ L +YA++P
Sbjct: 73  AGMFQLGGHALFLSKNDIQLGRGEPISDTAQVMSRYLDGLMIRTFGHDNVVNLAKYASIP 132

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN L+D  HPCQ++AD+ T  EH+G +KG   ++ GDGNN+ HSL+ G A+    + +A
Sbjct: 133 VINGLSDMAHPCQVLADLQTVLEHKGKLKGLKMAFIGDGNNMAHSLLIGGAKMGMHVAVA 192

Query: 184 TPIGSEPRNEYLN----WARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREE 238
           +P G E     +      A   G  + +  D ++A K A  ++TD W SM  E + A+ E
Sbjct: 193 SPKGYEADASIVKLSEEIAAQTGGKITITQDPLEAAKDADVIYTDVWASMGFEEEQAQRE 252

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F  +QVN  L+  A PD LF+HCLPAHRGEEV   V+DG  SV+FD+AENRLH QKA+
Sbjct: 253 AAFADYQVNEELVKAAKPDYLFLHCLPAHRGEEVSEGVIDGANSVIFDQAENRLHAQKAL 312

Query: 299 LLWCF 303
           ++   
Sbjct: 313 MVALM 317


>gi|209544308|ref|YP_002276537.1| ornithine carbamoyltransferase [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209531985|gb|ACI51922.1| ornithine carbamoyltransferase [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 331

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 158/304 (51%), Positives = 207/304 (68%), Gaps = 4/304 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFEN----KPLSGKVLAMIFEKPSTRTRV 60
           P+HF DL +   + L  I+++  +IK             +PL G+ L ++  KPSTRTRV
Sbjct: 14  PRHFLDLRDFDGATLRAILDLGSRIKRMQHGRTRPLHPRQPLLGRALGLMLSKPSTRTRV 73

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFEV M+ LGGD I LS ++MQLGR E++ DTA+VLSR+VDAIV+RT N + L +L  +A
Sbjct: 74  SFEVGMRQLGGDVILLSPNDMQLGRGESVADTARVLSRFVDAIVLRTGNTAALHDLARWA 133

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +VPVIN LT ++HP QI+ADIMTFEEHRG + G+  +W GDGNN+  S IE A  F + L
Sbjct: 134 SVPVINGLTPDSHPVQILADIMTFEEHRGPIAGRTVAWVGDGNNVATSFIEAARLFGFRL 193

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            +ATP G  P  + L WAR  GA + +  D   AV GA CV TDTW+SM+    A+    
Sbjct: 194 RLATPPGHMPSTQALAWARQGGADIVVTTDPRAAVAGADCVVTDTWVSMSDTDAAQRLIA 253

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F P++V+ +LM++A PDALFMHCLPAH G+EV  +V +GP SVVFDEAENRLH QK +L+
Sbjct: 254 FDPYRVDAALMALAAPDALFMHCLPAHIGDEVTEDVFEGPHSVVFDEAENRLHAQKGLLV 313

Query: 301 WCFG 304
           W  G
Sbjct: 314 WAMG 317


>gi|187478605|ref|YP_786629.1| ornithine carbamoyltransferase [Bordetella avium 197N]
 gi|123514691|sp|Q2KZD0|OTC_BORA1 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|115423191|emb|CAJ49722.1| ornithine carbamoyltransferase [Bordetella avium 197N]
          Length = 313

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 132/310 (42%), Positives = 196/310 (63%), Gaps = 10/310 (3%)

Query: 2   MTYP-------KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKP 54
           MT P       +HF    ++++S +  +++ A+ IK+  +    + PL  + LAM+FEK 
Sbjct: 1   MTLPTTQNGPLRHFLQFKDLTASEIGYVLDRARIIKDKFKRYEPHMPLHDRTLAMVFEKA 60

Query: 55  STRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLL 114
           STRTRVSFE  M  +GG  I L+ ++ QLGR+E I DTA+V+SR VD +++RT   +R+ 
Sbjct: 61  STRTRVSFEAGMYQMGGSVINLTSNDSQLGRSEPIEDTARVVSRMVDIVMIRTFEQTRIE 120

Query: 115 ELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAA 174
               ++ VPVIN LT+  HPCQI+ADI T+ EHRGS+ G++ +W GD NN+ ++ ++ A 
Sbjct: 121 RFAAHSRVPVINGLTNEYHPCQILADIFTYIEHRGSIAGRIVAWVGDANNMSYTWLQAAE 180

Query: 175 RFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK 234
              + L+++TP G +     +       + +  F D +QA +GAH V TD W SM  E +
Sbjct: 181 MLGFTLHVSTPAGYQLDPARIG--NPPPSVLKQFKDPMQACQGAHLVTTDVWTSMGYEAE 238

Query: 235 -AREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLH 293
                  F  + V+  +M+ A P+A+FMHCLPAHRGEEV  EV+DGPQSVV+DEAENR+H
Sbjct: 239 NEERRKAFADWCVDAEMMAAADPNAVFMHCLPAHRGEEVTGEVIDGPQSVVWDEAENRMH 298

Query: 294 TQKAILLWCF 303
            QKA++ +  
Sbjct: 299 AQKALMEFLL 308


>gi|114764001|ref|ZP_01443242.1| ornithine carbamoyltransferase [Pelagibaca bermudensis HTCC2601]
 gi|114543593|gb|EAU46607.1| ornithine carbamoyltransferase [Roseovarius sp. HTCC2601]
          Length = 308

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 161/307 (52%), Positives = 213/307 (69%), Gaps = 7/307 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSE-----NIFENKPLSGKVLAMIFEKPSTRTR 59
             HF D+      +L  II+ AK IK+           ++ PL  +++A+IFEKPSTRTR
Sbjct: 1   MNHFLDIHKTDKDDLRSIIDAAKAIKDKRNGRPRAAPDDDLPLKDRMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V ++ +GG T+ LSGS+MQLG  ETI DTA+VLSR+VD I++RT + + L E+ EY
Sbjct: 61  VSFDVGVRQMGGQTMVLSGSDMQLGHGETIADTARVLSRFVDMIMIRTFDEAVLTEMAEY 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           A VPVIN LTD THPCQI+ADI+TFEEHRG + GK   W GDGNN+  S +  A +F + 
Sbjct: 121 ADVPVINGLTDRTHPCQIMADILTFEEHRGPIAGKKVVWCGDGNNVCASFLHAAGQFGFD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKARE 237
           L    P+  +P  E++  ARNQG+++ +  D  +AV+GA  V  DTW+SM+  Q  K R 
Sbjct: 181 LTFTGPVQLDPEMEFVGLARNQGSTITIERDPFKAVEGADLVVADTWVSMHDAQSAKERR 240

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
            ++ +P+QVN  LM  A  DALFMHCLPAHRGEEV +E++DGPQSV++DEAENRLH QKA
Sbjct: 241 HNMLRPYQVNDKLMEAAGKDALFMHCLPAHRGEEVTSEIMDGPQSVIWDEAENRLHAQKA 300

Query: 298 ILLWCFG 304
           I+ WC G
Sbjct: 301 IMRWCVG 307


>gi|297538085|ref|YP_003673854.1| ornithine carbamoyltransferase [Methylotenera sp. 301]
 gi|297257432|gb|ADI29277.1| ornithine carbamoyltransferase [Methylotenera sp. 301]
          Length = 306

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 119/298 (39%), Positives = 170/298 (57%), Gaps = 1/298 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF   ++++   L  + E ++ IK   +   +  PL  + L MIFEK STRTR+SFE  
Sbjct: 4   KHFLQFNDLNREELEYVFERSRLIKKQFKAYQQYWPLQDRTLVMIFEKASTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  I+L+  + QLGR E + D A+V+SR  D +++RT     +      + VPVI
Sbjct: 64  MHQLGGSAIYLNTRDSQLGRGEPVEDAAQVISRMSDIVMIRTFEQEIIERFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI TF EHRGS++GK  +W GD NN+ ++ ++ A   ++ ++++TP
Sbjct: 124 NGLTNEYHPCQILADIFTFIEHRGSIQGKTVAWIGDSNNVCNTWLQAAEVLDFNVHVSTP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G E   E  N   +                        T +    E +      F  +Q
Sbjct: 184 PGYEVEAERANLYGHDHYEEFADPMEAAKGADLVTTDVWTSMGFEAENEE-RLRDFADWQ 242

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           V+  +M +A  DALFMHCLPAHRGEEV  +V+DG QSVV+DEAENRLH QKA++ +  
Sbjct: 243 VDGDMMRVAAKDALFMHCLPAHRGEEVAADVIDGSQSVVWDEAENRLHVQKALMEYLL 300


>gi|229577095|ref|YP_001085009.2| ornithine carbamoyltransferase [Acinetobacter baumannii ATCC 17978]
 gi|239501616|ref|ZP_04660926.1| ornithine carbamoyltransferase [Acinetobacter baumannii AB900]
 gi|260554738|ref|ZP_05826959.1| ornithine carbamoyltransferase [Acinetobacter baumannii ATCC 19606]
 gi|226739231|sp|A3M663|OTC_ACIBT RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|193077572|gb|ABO12407.2| ornithine carbamoyltransferase [Acinetobacter baumannii ATCC 17978]
 gi|260411280|gb|EEX04577.1| ornithine carbamoyltransferase [Acinetobacter baumannii ATCC 19606]
          Length = 306

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 132/298 (44%), Positives = 181/298 (60%), Gaps = 2/298 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++S+  L+ I+E A ++K   ++    +P  GKVL MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLRDLSTLELNRILERASELKKMQQSNKVYQPFVGKVLGMIFEKSSTRTRISFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +   GG  IFLS  + QLGR E I D+A+V+S  +D +++RT  H  +     Y+ VPVI
Sbjct: 64  INQFGGSAIFLSPRDTQLGRGEPIEDSARVISSMLDIVMIRTFGHDIVERFASYSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ++AD+ T+ EHRGS++GK  +W GDGNN+ +S IE A    + L IA+P
Sbjct: 124 NGLTDDHHPCQLLADLQTYIEHRGSIEGKTVAWIGDGNNMCNSYIEAAHMMGFKLKIASP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G EP+ E+L    +         DA             +     +E +   E  F  FQ
Sbjct: 184 KGYEPKPEFLAEFGHCVELFDNAEDAAVNADLIVTDVWASM--GQEEEQKLREKAFADFQ 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN  LM +AHPD LFMHCLPAHRGEE+   +LD   +VV+DEAENRLH QKA++ +  
Sbjct: 242 VNEKLMGLAHPDCLFMHCLPAHRGEEISETMLDHKNAVVWDEAENRLHAQKALMEFLL 299


>gi|110678980|ref|YP_681987.1| ornithine carbamoyltransferase [Roseobacter denitrificans OCh 114]
 gi|122972889|sp|Q169P2|OTC_ROSDO RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|109455096|gb|ABG31301.1| ornithine carbamoyltransferase [Roseobacter denitrificans OCh 114]
          Length = 308

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 159/308 (51%), Positives = 216/308 (70%), Gaps = 7/308 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSE-----NIFENKPLSGKVLAMIFEKPSTRTR 59
             HF D+     ++L  II+ A  +K++ +        + +PL  +++A+IFEKPSTRTR
Sbjct: 1   MNHFLDIHLTDPADLREIIDQAAIMKSARKGRPRGAPDDTQPLKDRIVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V ++ +GG T+ LSG++MQLG  ETI DTA+VLSRYVD I++RT + + L E+ E+
Sbjct: 61  VSFDVGVRQMGGQTMVLSGADMQLGHGETIADTARVLSRYVDLIMIRTFDEAVLTEMAEF 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ATVPVIN LTD THPCQI+ADI+TFEEHRG + GK   WSGDGNN+  S +  A +F + 
Sbjct: 121 ATVPVINGLTDRTHPCQIMADILTFEEHRGPIAGKKVVWSGDGNNVCASFLHAAGQFGFD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L    P   +P  E++  AR++G +VA+  D  +AV+GA  V TDTW+SM+    ARE  
Sbjct: 181 LTFTGPQTLDPDAEFVELARSKGVNVAVERDPAKAVEGADLVVTDTWVSMHDAQSARERR 240

Query: 240 VFQ--PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
             Q  P++V+ +LMS A P+ALFMHCLPAHR +E  +EV+DGPQSV+FDEAENRLH QKA
Sbjct: 241 HNQLRPYRVDAALMSRAKPEALFMHCLPAHRDDEATSEVMDGPQSVIFDEAENRLHAQKA 300

Query: 298 ILLWCFGI 305
           I+ WC  +
Sbjct: 301 IMRWCLAV 308


>gi|291613491|ref|YP_003523648.1| ornithine carbamoyltransferase [Sideroxydans lithotrophicus ES-1]
 gi|291583603|gb|ADE11261.1| ornithine carbamoyltransferase [Sideroxydans lithotrophicus ES-1]
          Length = 309

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 119/308 (38%), Positives = 168/308 (54%), Gaps = 4/308 (1%)

Query: 2   MTYP--KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           M+    KHF    ++  + L  + E  + IK   +   +  PL  + L MIFEK STRTR
Sbjct: 1   MSSKPIKHFLQFKDLDRNELEYLFERTRIIKERFKRYEKYWPLEDRTLVMIFEKASTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  M  LGG  I+L+  + QLGR E + D  +V+SR  D +++RT     +      
Sbjct: 61  LSFEAGMHQLGGSAIYLNTRDSQLGRGEPVEDAGQVISRMSDIVMIRTFEQDIIERFARN 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT+  HPCQ++ADI T+ EHRGS+KGK  +W GD NN+ ++ ++ A   ++ 
Sbjct: 121 SRVPVINGLTNEYHPCQVLADIYTYVEHRGSIKGKTVAWIGDSNNMCNTWLQAAEILDFN 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           ++++TP G E   E                               T +    E +     
Sbjct: 181 VHVSTPPGYEVEPERAGLFGEDHYEEFTDPMEAARNADLVTTDVWTSMGFEAENEE-RMK 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  +QV+  +M +A  DALFMHCLPAHRGEEV  EV+DG QSVV+DEAENRLH QKA++
Sbjct: 240 DFADWQVDGDMMRVAARDALFMHCLPAHRGEEVAAEVIDGSQSVVWDEAENRLHVQKALM 299

Query: 300 -LWCFGII 306
                G +
Sbjct: 300 EYLLLGKV 307


>gi|225569862|ref|ZP_03778887.1| hypothetical protein CLOHYLEM_05956 [Clostridium hylemonae DSM
           15053]
 gi|225161332|gb|EEG73951.1| hypothetical protein CLOHYLEM_05956 [Clostridium hylemonae DSM
           15053]
          Length = 681

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 110/312 (35%), Positives = 162/312 (51%), Gaps = 6/312 (1%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M    + F  L + +   +  ++++A  +K   +       L GK +A+IFEKPSTRTR 
Sbjct: 370 MNLKGRSFLTLKDFTPEEIVYLLDLAADLKEKKKQGITGNSLQGKNIALIFEKPSTRTRC 429

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           +F V     GG+  +L+GSE+QLG  E+I DTA+VL R  D I  R  + + +  L +Y+
Sbjct: 430 AFTVGAADEGGNPTYLAGSEIQLGHKESIEDTARVLGRMFDGIEFRGFSQAHVEALAKYS 489

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGD-GNNILHSLIEGAARFNYL 179
            VPV N LTD  HP QI+AD++T  EH G +KG  F++ GD  NN+ +SL+ G A+    
Sbjct: 490 GVPVWNGLTDEYHPTQILADLLTMREHFGYLKGLKFAYLGDGRNNMANSLMIGCAKVGVD 549

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK----A 235
                P    P  E  +  +   A           V                  +    A
Sbjct: 550 FINVAPKALWPTEELTDLCKKYAAESGASITITDDVNDVEGADVLYTDVWASMGEEDKAA 609

Query: 236 REEHVFQPFQVNLSLMSMAHPD-ALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHT 294
               + +P+Q+N  +M+    +  +FMHCLPA +G+EV  +V +G  SVVFDEAENRLHT
Sbjct: 610 ERIEMLRPYQINKEMMARTKKEGTIFMHCLPAVKGKEVTEDVFEGDASVVFDEAENRLHT 669

Query: 295 QKAILLWCFGII 306
            KA+++   G I
Sbjct: 670 IKAVMVATLGNI 681


>gi|169795676|ref|YP_001713469.1| ornithine carbamoyltransferase [Acinetobacter baumannii AYE]
 gi|213158379|ref|YP_002319677.1| ornithine carbamoyltransferase [Acinetobacter baumannii AB0057]
 gi|215483162|ref|YP_002325369.1| ornithine carbamoyltransferase [Acinetobacter baumannii AB307-0294]
 gi|301346288|ref|ZP_07227029.1| ornithine carbamoyltransferase [Acinetobacter baumannii AB056]
 gi|301512085|ref|ZP_07237322.1| ornithine carbamoyltransferase [Acinetobacter baumannii AB058]
 gi|301595685|ref|ZP_07240693.1| ornithine carbamoyltransferase [Acinetobacter baumannii AB059]
 gi|332852494|ref|ZP_08434233.1| ornithine carbamoyltransferase [Acinetobacter baumannii 6013150]
 gi|332871303|ref|ZP_08439852.1| ornithine carbamoyltransferase [Acinetobacter baumannii 6013113]
 gi|226739190|sp|B0V6G5|OTC_ACIBY RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|169148603|emb|CAM86469.1| ornithine carbamoyltransferase [Acinetobacter baumannii AYE]
 gi|213057539|gb|ACJ42441.1| ornithine carbamoyltransferase [Acinetobacter baumannii AB0057]
 gi|213989035|gb|ACJ59334.1| ornithine carbamoyltransferase [Acinetobacter baumannii AB307-0294]
 gi|332729196|gb|EGJ60539.1| ornithine carbamoyltransferase [Acinetobacter baumannii 6013150]
 gi|332731587|gb|EGJ62873.1| ornithine carbamoyltransferase [Acinetobacter baumannii 6013113]
          Length = 306

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 132/298 (44%), Positives = 181/298 (60%), Gaps = 2/298 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++S+  L+ I+E A ++K   ++    +P  GKVL MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLRDLSTLELNRILERASELKKMQQSNKVYQPFVGKVLGMIFEKSSTRTRISFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +   GG  IFLS  + QLGR E I D+A+V+S  +D +++RT  H  +     Y+ VPVI
Sbjct: 64  INQFGGSAIFLSPRDTQLGRGEPIEDSARVISSMLDIVMIRTFGHDIVERFASYSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ++AD+ T+ EHRGS++GK  +W GDGNN+ +S IE A    + L IA+P
Sbjct: 124 NGLTDDHHPCQLLADLQTYIEHRGSIEGKTVAWIGDGNNMCNSYIEAAHMMGFKLKIASP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G EP+ E+L    +         DA             +     +E +   E  F  FQ
Sbjct: 184 KGYEPKPEFLAEFGHCVELFDNAEDAAVNADLIVTDVWASM--GQEEEQKLREKAFANFQ 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN  LM +AHPD LFMHCLPAHRGEE+   +LD   +VV+DEAENRLH QKA++ +  
Sbjct: 242 VNEKLMGLAHPDCLFMHCLPAHRGEEISETMLDHKNAVVWDEAENRLHAQKALMEFLL 299


>gi|319944067|ref|ZP_08018347.1| ATP synthase F1 sector beta subunit [Lautropia mirabilis ATCC
           51599]
 gi|319742828|gb|EFV95235.1| ATP synthase F1 sector beta subunit [Lautropia mirabilis ATCC
           51599]
          Length = 309

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 126/303 (41%), Positives = 174/303 (57%), Gaps = 2/303 (0%)

Query: 1   MMTYP-KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           M T P KHF    + S   +  +++ A  IK   +N     PL  + L MIFEK STRTR
Sbjct: 1   MSTLPIKHFLKFDDFSREEIEYLLKRADFIKKRFKNYETWHPLQDRSLVMIFEKASTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  M  LGG  I+++  + QLGR E + D AKV+SR  D I+MRT     +      
Sbjct: 61  LSFEAGMLQLGGAAIYMNTRDSQLGRGEPVDDAAKVISRMCDIIMMRTFEQDIIERFAAA 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT+  HPCQI+ADI T+ EHRGS++GK  +W GD NN+ ++ ++ A   ++ 
Sbjct: 121 SRVPVINGLTNEYHPCQILADIFTYMEHRGSIQGKTVAWVGDANNMSYTWVQAARLLDFQ 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           ++I+TP G    +  ++ A  +            A          T +    E +AR   
Sbjct: 181 VHISTPPGYALDDARISDAERKHLRYFEDPREACAGADLVTTDVWTSMGYEAENEARAAA 240

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
                 V+  +M++A PDA+FMHCLPAHRGEEV   V+DGPQSVV+DEAENRLH QKA+L
Sbjct: 241 FANFC-VDEQMMALASPDAVFMHCLPAHRGEEVTAGVIDGPQSVVWDEAENRLHVQKALL 299

Query: 300 LWC 302
            + 
Sbjct: 300 EYL 302


>gi|320528888|ref|ZP_08029980.1| ornithine carbamoyltransferase [Selenomonas artemidis F0399]
 gi|320138518|gb|EFW30408.1| ornithine carbamoyltransferase [Selenomonas artemidis F0399]
          Length = 310

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 140/309 (45%), Positives = 190/309 (61%), Gaps = 5/309 (1%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           MM        + ++S+ ++  I+ +A  +K   +    +  L+GK L MIFEK STRTRV
Sbjct: 1   MMKSGMDLISIHDLSAGDVEEILALAADLKVRQKAGIPHPLLAGKTLGMIFEKSSTRTRV 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFEV M  LGG  +FLS  ++QLGR E I DTA+VLSRY+D I++RT  H R+ EL  +A
Sbjct: 61  SFEVGMYQLGGRALFLSSRDLQLGRGEPIADTARVLSRYLDGIMIRTYGHERIEELARWA 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
            VPVINAL+D  HPCQ + D++T  EH+G + G   ++ GDGNN+ HSL+  AA+     
Sbjct: 121 DVPVINALSDLLHPCQALTDLLTIREHKGRLAGLKMAYVGDGNNMTHSLMYAAAKVGMHF 180

Query: 181 NIATPIGSEPRNEYLNWARNQGASV----ALFHDAVQAVKGAHCVFTDTWISMNQEFKAR 236
             ATP G EP  + +  AR   +       L HD  +AV+ A  V TDTW SM QE +  
Sbjct: 181 AAATPAGYEPNEKVVQNARADASETGASVTLTHDPKEAVRDADVVVTDTWASMGQEEEHD 240

Query: 237 -EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
               VF+P+QVN  L++ A   A+ MHCLPA+R EE+  +V +   +V+FDEAENRLH Q
Sbjct: 241 ARTAVFRPYQVNPELLAAADARAVVMHCLPAYRNEEITADVFESFANVIFDEAENRLHVQ 300

Query: 296 KAILLWCFG 304
           KAI+    G
Sbjct: 301 KAIMALVMG 309


>gi|239787685|emb|CAX84193.1| Ornithine carbamoyltransferase [uncultured bacterium]
          Length = 301

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 163/305 (53%), Positives = 215/305 (70%), Gaps = 5/305 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M+  +HF +L       L  ++++    K     +   +PL G++LAMIFEKPSTRTRVS
Sbjct: 1   MSL-RHFLNLDRFDEIQLRHMLKLGLAFKQ--RKVANPQPLQGRILAMIFEKPSTRTRVS 57

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FEV MK LGGD + L  ++ QLGR ET+ DTA+VLSRYVDAI++RT + ++L EL ++A+
Sbjct: 58  FEVGMKQLGGDVVVLGQNDTQLGRGETVADTARVLSRYVDAIMIRTNDPAKLDELAKHAS 117

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD THPCQI+ADIMTFEEHRG + GK+ +WSGDGNN+ ++ I+ AA F + + 
Sbjct: 118 VPVINGLTDTTHPCQIMADIMTFEEHRGPIGGKVVAWSGDGNNVANTWIQAAALFGFDMR 177

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +A P    P    L WAR++GA++ L     +AVKGA  V TD W+SM  E +   +   
Sbjct: 178 LACPANLPPDAATLAWARSKGANILLTETPSEAVKGADAVITDAWVSMGFESE-NRQDHL 236

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
            P+ VN +LM++A PDALFMHCLPAHRGEEV + V+DGP SVV+DEAENRLH QK IL+W
Sbjct: 237 VPYAVNEALMALAKPDALFMHCLPAHRGEEVTDGVIDGPWSVVWDEAENRLHAQKGILMW 296

Query: 302 CF-GI 305
           C  G+
Sbjct: 297 CLEGV 301


>gi|15615457|ref|NP_243760.1| ornithine carbamoyltransferase [Bacillus halodurans C-125]
 gi|32699482|sp|Q9K8V8|OTC_BACHD RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|10175516|dbj|BAB06613.1| ornithine carbamoyltransferase [Bacillus halodurans C-125]
          Length = 319

 Score =  220 bits (559), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 132/305 (43%), Positives = 179/305 (58%), Gaps = 5/305 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             +    L + +   +  ++  A ++K  ++N      L+GK L MIFE  STRTRVSFE
Sbjct: 12  KGRDLLTLLDYTPEEVQQLLTQALELKQKAKNGEPTPYLTGKSLGMIFENASTRTRVSFE 71

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M  LGG  +FLS  ++Q+GR E I DTA VLSRYVDAI++RT +H  + EL  YATVP
Sbjct: 72  VGMTQLGGHALFLSPKDLQIGRGEPIKDTANVLSRYVDAIMIRTNSHESVEELAHYATVP 131

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINALTD  HPCQ +AD +T  E + ++ GK  ++ GDGNN+ HSL+   A+    + +A
Sbjct: 132 VINALTDAYHPCQALADALTILEKKETLIGKKLAYIGDGNNVCHSLLAIGAKTGMDVTVA 191

Query: 184 TPIGSEPRNEYLNWARN--QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA---REE 238
           TP G E   E    A    +     L       V   +     T +  +  ++A     E
Sbjct: 192 TPKGYEVDQEIFQRATEAAKETGATLVQTTNPQVAAENADAIYTDVWASMGYEAEQSERE 251

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
            VFQP+QVN  L+++A  D  F+HCLPAHRGEEV   V+DGP S ++D+AENRLH QKA+
Sbjct: 252 EVFQPYQVNDQLLTLAKKDVSFLHCLPAHRGEEVTASVIDGPHSAIYDQAENRLHAQKAV 311

Query: 299 LLWCF 303
           L    
Sbjct: 312 LTALL 316


>gi|237749186|ref|ZP_04579666.1| ornithine carbamoyltransferase [Oxalobacter formigenes OXCC13]
 gi|229380548|gb|EEO30639.1| ornithine carbamoyltransferase [Oxalobacter formigenes OXCC13]
          Length = 305

 Score =  220 bits (559), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 130/301 (43%), Positives = 179/301 (59%), Gaps = 3/301 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT  KH+   S+++ +    +I+ A  IK   +N     PL  + L M+FEK STRTR+S
Sbjct: 1   MTI-KHYLQFSDLTLAEYEHLIKRAHVIKRKFKNYEPYHPLLDRTLVMVFEKSSTRTRLS 59

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  I+L+  + QLGR E I D A+V+SR  D I++RT  H  +     Y+ 
Sbjct: 60  FEAGMHQLGGTAIYLNTRDSQLGRGEPIEDAAQVMSRMSDVIMVRTFGHEIIERFAAYSR 119

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LT+  HPCQ++AD+ TF EHRGS+KGK  +W GD NN+L+S ++ A  F + +N
Sbjct: 120 VPVINGLTNEHHPCQVLADVFTFIEHRGSIKGKTVTWIGDANNMLYSWLQAAEVFGFHVN 179

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           ++TP G +   + ++   +         DA +           +     +E  A  +  F
Sbjct: 180 VSTPRGYDIDFKLVSPDHSHFTQFDNPADACEGAHLVTTDVWTSM--GFEEENAVRKKAF 237

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
             + V+   M  A PDALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA+L +
Sbjct: 238 ANWNVDAEKMRHAAPDALFMHCLPAHRGEEVTAEVIDGPQSVVWDEAENRLHVQKALLEY 297

Query: 302 C 302
            
Sbjct: 298 L 298


>gi|184158423|ref|YP_001846762.1| ornithine carbamoyltransferase [Acinetobacter baumannii ACICU]
 gi|332873915|ref|ZP_08441855.1| ornithine carbamoyltransferase [Acinetobacter baumannii 6014059]
 gi|183210017|gb|ACC57415.1| Ornithine carbamoyltransferase [Acinetobacter baumannii ACICU]
 gi|322508749|gb|ADX04203.1| argF [Acinetobacter baumannii 1656-2]
 gi|323518352|gb|ADX92733.1| ornithine carbamoyltransferase [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332737901|gb|EGJ68788.1| ornithine carbamoyltransferase [Acinetobacter baumannii 6014059]
          Length = 306

 Score =  220 bits (559), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 131/298 (43%), Positives = 180/298 (60%), Gaps = 2/298 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++S+  L+ I+E A ++K   ++    +P  GKVL MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLRDLSTLELNRILERASELKKMQQSNKVYQPFVGKVLGMIFEKSSTRTRISFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +   GG  IFLS  + QLGR E I D+A+V+S  +D +++RT  H  +     Y+ VPVI
Sbjct: 64  INQFGGSAIFLSPRDTQLGRGEPIEDSARVISSMLDIVMIRTFGHDIVERFASYSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ++AD+ T+ EHRGS++GK  +W GDGNN+ +S IE A    + L IA+P
Sbjct: 124 NGLTDDHHPCQLLADLQTYIEHRGSIEGKTVAWIGDGNNMCNSYIEAAHMMGFKLKIASP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
              EP+ E+L    +         DA             +     +E +   E  F  FQ
Sbjct: 184 KSYEPKPEFLAEFGHCVELFDNAEDAAVNADLIVTDVWASM--GQEEEQKLREKAFADFQ 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN  LM +AHPD LFMHCLPAHRGEE+   +LD   +VV+DEAENRLH QKA++ +  
Sbjct: 242 VNEKLMGLAHPDCLFMHCLPAHRGEEISETMLDHKNAVVWDEAENRLHAQKALMEFLL 299


>gi|227501827|ref|ZP_03931876.1| ornithine carbamoyltransferase [Corynebacterium accolens ATCC
           49725]
 gi|227077852|gb|EEI15815.1| ornithine carbamoyltransferase [Corynebacterium accolens ATCC
           49725]
          Length = 306

 Score =  220 bits (559), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 131/303 (43%), Positives = 188/303 (62%), Gaps = 8/303 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRVSFEV 64
           +HF    ++S      ++++A ++K      F  +PL G K +A++F+K STRTR SFE 
Sbjct: 4   RHFLADDDLSPEEQKEVLDLAVQLKADP---FARRPLEGPKTVAVLFDKTSTRTRFSFET 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            + H+GG  I +  S   + + E+  DT  VLSRYV+AIV RT  H  L ++ E +T P+
Sbjct: 61  GIAHMGGSAITVDSSGTHMSKGESYQDTGAVLSRYVEAIVWRTYAHDNLEQMAETSTAPL 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGD-GNNILHSLIEGAARFNYLLNIA 183
           +NAL+D+ HPCQI+AD++T  E+ G + G+   + GD  NN+ +S + G A     ++I 
Sbjct: 121 VNALSDDLHPCQILADLLTCRENLGDLTGRKAVYLGDGNNNMANSYMIGFATAGMDISIV 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQ 242
           +P G +PR E++  AR +G       D V+ V GA  V TDTW+SM QE         F 
Sbjct: 181 SPEGFQPRPEFVERARQRGNVTVT--DDVEEVSGADVVITDTWVSMGQENDGQDRRTPFL 238

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           P+QV+  +M+ A  DA+F+HCLPA+RG EV  EV+DGPQS VFDEAENRLH QKA+L+W 
Sbjct: 239 PYQVSKDVMAKAKKDAIFLHCLPAYRGNEVTAEVIDGPQSRVFDEAENRLHAQKALLVWL 298

Query: 303 FGI 305
             I
Sbjct: 299 LDI 301


>gi|134094111|ref|YP_001099186.1| ornithine carbamoyltransferase [Herminiimonas arsenicoxydans]
 gi|226739201|sp|A4G3H2|OTC_HERAR RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|133738014|emb|CAL61059.1| ornithine carbamoyltransferase (OTCase) [Herminiimonas
           arsenicoxydans]
          Length = 304

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 129/302 (42%), Positives = 174/302 (57%), Gaps = 3/302 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF   S+++      +IE  + IK   +N   + PL  + L M+FEK STRTR+SFE  
Sbjct: 4   KHFLQFSDLTLDEFEYVIERTRIIKRKFKNYEPHHPLVDRTLVMVFEKNSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  I L+  + QLGR E + D A+V+SR  D I++RT     +      + VPVI
Sbjct: 64  MHQLGGAAIHLATRDSQLGRGEPVEDAAQVMSRMCDIIMIRTFGQDIIERFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQ++AD+ TF EHRGS+KGK  +W GD NN+L+S ++ A  F++ +N++TP
Sbjct: 124 NGLTNEHHPCQVLADVFTFIEHRGSIKGKTVAWIGDANNMLYSWLQAAQVFDFHVNVSTP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G E     +          A   DA             +     +E  A     F  + 
Sbjct: 184 KGYEIDPTLVAADNTHYKLYAAPSDACAGAHLVTTDVWTSM--GFEEENAARLKAFDGWI 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC-FG 304
           V+ + M  A PDALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA+L +   G
Sbjct: 242 VDAAKMKRAQPDALFMHCLPAHRGEEVAAEVIDGPQSVVWDEAENRLHAQKALLEYLVLG 301

Query: 305 II 306
            +
Sbjct: 302 KL 303


>gi|306836005|ref|ZP_07468997.1| ornithine carbamoyltransferase [Corynebacterium accolens ATCC
           49726]
 gi|304568171|gb|EFM43744.1| ornithine carbamoyltransferase [Corynebacterium accolens ATCC
           49726]
          Length = 306

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 131/303 (43%), Positives = 188/303 (62%), Gaps = 8/303 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRVSFEV 64
           +HF    ++S      ++++A ++K      F  +PL G K +A++F+K STRTR SFE 
Sbjct: 4   RHFLADDDLSPEEQKEVLDLAVQLKADP---FARRPLEGPKTVAVLFDKTSTRTRFSFET 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            + H+GG  I +  S   + + E+  DT  VLSRYV+AIV RT  H  L ++ E +T P+
Sbjct: 61  GIAHMGGSAITVDSSGTHMSKGESYQDTGAVLSRYVEAIVWRTYAHDNLEQMAETSTAPL 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGD-GNNILHSLIEGAARFNYLLNIA 183
           +NAL+D+ HPCQI+AD++T  E+ G + G+   + GD  NN+ +S + G A     ++I 
Sbjct: 121 VNALSDDLHPCQILADLLTCRENLGDLTGRKAVYLGDGNNNMANSYMIGFATAGMDISIV 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQ 242
           +P G +PR E++  AR +G       D V+ V GA  V TDTW+SM QE         F 
Sbjct: 181 SPEGFQPRPEFVERARQRGNVTVT--DDVEEVSGADVVITDTWVSMGQENDGQDRRTPFL 238

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           P+QV+  +M+ A  DA+F+HCLPA+RG EV  EV+DGPQS VFDEAENRLH QKA+L+W 
Sbjct: 239 PYQVSKDVMAKAKKDAIFLHCLPAYRGNEVTTEVIDGPQSRVFDEAENRLHAQKALLVWL 298

Query: 303 FGI 305
             I
Sbjct: 299 LDI 301


>gi|300310761|ref|YP_003774853.1| ornithine carbamoyltransferase [Herbaspirillum seropedicae SmR1]
 gi|300073546|gb|ADJ62945.1| ornithine carbamoyltransferase protein [Herbaspirillum seropedicae
           SmR1]
          Length = 304

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 118/297 (39%), Positives = 174/297 (58%), Gaps = 2/297 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH+   S+ +      +IE ++ IK   +N   +  L+ + L M+FEK STRTR+SFE  
Sbjct: 4   KHYLQFSDFTLDEYEYVIERSRVIKRKFKNYEPHHTLADRTLVMVFEKNSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  +GG  I+L+  + QLGR E + D A+V+SR  D I++RT     +    +++ VPVI
Sbjct: 64  MHQMGGAAIYLNTRDSQLGRGEPVEDAAQVMSRMCDVIMIRTYGQEIIERFAKHSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQ++AD+ T+ EH GS++GK+ +W GD NN+L+S ++ A  F + +N++TP
Sbjct: 124 NGLTNEQHPCQVLADVFTYIEHHGSIQGKIVAWVGDANNMLYSWLQAAEVFGFHVNVSTP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G +     ++         A   DA Q           +     +         F  + 
Sbjct: 184 KGYDIDPAQVSPGNKNYTFFADPADACQDADLVTTDVWTSM--GFEAENNARLKAFDGWI 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           V+ + M+ A  DALFMHCLPAHRGEEV  EV+DGPQSVV++EAENRLH QKA+L + 
Sbjct: 242 VDQAKMARAKKDALFMHCLPAHRGEEVAAEVIDGPQSVVWEEAENRLHVQKALLEYL 298


>gi|296270000|ref|YP_003652632.1| ornithine carbamoyltransferase [Thermobispora bispora DSM 43833]
 gi|296092787|gb|ADG88739.1| ornithine carbamoyltransferase [Thermobispora bispora DSM 43833]
          Length = 322

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 140/306 (45%), Positives = 188/306 (61%), Gaps = 8/306 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENI--FENKPLSG-KVLAMIFEKPSTRTRVSF 62
           +HF    +++    + ++++A  +K        F ++PL G K +A++F+K STRTRVSF
Sbjct: 11  RHFLRDDDLTPQEQARVLDLAAAMKKERAAGAGFTHRPLEGPKTVAVLFDKHSTRTRVSF 70

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
            VA+  LGG  + L     QLGR E I DTA+VL R V AIV RT    R+  +   +TV
Sbjct: 71  AVAITELGGAPLILDAGTSQLGRGEPIEDTARVLCRQVAAIVWRTAGQERIEAMASASTV 130

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLN 181
           PVINALTD  HPCQ++AD++T  EHRGS+ G+  ++ GDG NN+ HS + G A     + 
Sbjct: 131 PVINALTDEFHPCQVLADLLTIREHRGSLAGQTLTYLGDGANNMAHSYLLGGATAGMHVR 190

Query: 182 IATPIGSEPRNEYLNWARNQGASV----ALFHDAVQAVKGAHCVFTDTWISMNQEFKARE 237
           IA P G  P    L  A    A+     A+  D V A  GA  + TDTW+SM QE K + 
Sbjct: 191 IAAPAGYRPDPAVLRRAEEIAAATGGSVAVLDDPVAAAAGAGVIATDTWVSMGQEGKEQR 250

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
              F+P+QVN  L+  A PDA+ +HCLPA+RG E+  EV+DGPQSVV+DEAENRLH QKA
Sbjct: 251 IAAFRPYQVNAELLRHAAPDAIVLHCLPAYRGMEITAEVIDGPQSVVWDEAENRLHAQKA 310

Query: 298 ILLWCF 303
           +L W  
Sbjct: 311 LLHWLL 316


>gi|302386863|ref|YP_003822685.1| ornithine carbamoyltransferase [Clostridium saccharolyticum WM1]
 gi|302197491|gb|ADL05062.1| ornithine carbamoyltransferase [Clostridium saccharolyticum WM1]
          Length = 311

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 108/310 (34%), Positives = 159/310 (51%), Gaps = 6/310 (1%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M    ++F  L + S   +  ++++A  +K   +       L GK +A+IFEKPSTRTR 
Sbjct: 1   MNLKGRNFITLKDYSPEEIGYLLKLAADLKAKKKQGITGNSLKGKNIALIFEKPSTRTRC 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF VA    G    +L   ++QLG  E++ DTA+VL R  D I  R   H  + +L +YA
Sbjct: 61  SFVVAAVDEGAHPEYLGKDDIQLGHKESVEDTARVLGRVFDGIEFRGFKHKTVEDLGKYA 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGD-GNNILHSLIEGAARFNYL 179
            VPV N LTD+ HP QI+AD++T +EH G +KG  F ++GD  NN+ +SL+ G ++    
Sbjct: 121 GVPVWNGLTDDYHPTQILADLLTMKEHFGYLKGLHFVYAGDGRNNMANSLMIGMSKMGVH 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
             I  P    P+ E ++  +             +         T          +  +  
Sbjct: 181 FTILAPKSLWPKEELVDLCQGYAKESGSTITLTEDTDAVKDADTIYTDVWCSMGEEDKAA 240

Query: 240 VF----QPFQVNLSLMSMAHPD-ALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHT 294
                 +P+QVN  LM     D  +FMHCLPA +G EV  +V +   SVVFDEAENR+HT
Sbjct: 241 QRITLLKPYQVNKELMEKTGKDTTIFMHCLPAVKGNEVTEDVFESGASVVFDEAENRMHT 300

Query: 295 QKAILLWCFG 304
            KA+++   G
Sbjct: 301 IKAVMVATLG 310


>gi|294678650|ref|YP_003579265.1| ornithine carbamoyltransferase [Rhodobacter capsulatus SB 1003]
 gi|294477470|gb|ADE86858.1| ornithine carbamoyltransferase [Rhodobacter capsulatus SB 1003]
          Length = 308

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 156/308 (50%), Positives = 215/308 (69%), Gaps = 7/308 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFE-----NKPLSGKVLAMIFEKPSTRTR 59
             HF D+   S ++L  +I+ A+ +K +     +     ++PL+G ++A+IFEKPSTRTR
Sbjct: 1   MTHFLDIHTTSPADLRSMIDSARAMKTARLGRPKGALDDDQPLAGCMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V ++ +GG T+ LSG EMQLG  ETI DTA+VLSRYVD I++RT   + LLE+ EY
Sbjct: 61  VSFDVGVRQMGGQTMVLSGKEMQLGHGETIADTARVLSRYVDLIMIRTFEEATLLEMAEY 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           A+VPVIN LT+ THPCQI+ADIMT+EEHRG + G+   WSGDGNN+  S ++ A +F + 
Sbjct: 121 ASVPVINGLTNRTHPCQIMADIMTYEEHRGPIAGRKVVWSGDGNNVCASFLQAAGQFGFD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF--KARE 237
           L    P   +P  +++ +AR++G +V +  D  +AV+GA  V TDTW+SM+     K R 
Sbjct: 181 LTFTGPQALDPERDWIEFARSKGVNVVIERDPAKAVEGADLVVTDTWVSMHDPESAKERR 240

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
            +  +P+QVN +LM+ A PDALFMHCLPAHR +E  + V+DGP SV+FDEAENRLH QKA
Sbjct: 241 HNQLRPYQVNETLMAKAKPDALFMHCLPAHRNDEATSAVMDGPHSVIFDEAENRLHAQKA 300

Query: 298 ILLWCFGI 305
           I+ W  G 
Sbjct: 301 IMRWALGK 308


>gi|313895652|ref|ZP_07829208.1| ornithine carbamoyltransferase [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312975778|gb|EFR41237.1| ornithine carbamoyltransferase [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 309

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 140/308 (45%), Positives = 190/308 (61%), Gaps = 5/308 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M        + ++S+ ++  I+ +A  +K   +    +  L+GK L MIFEK STRTRVS
Sbjct: 1   MKSGMDLISIHDLSAGDVEEILALAADLKVRQKAGIPHPLLAGKTLGMIFEKSSTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FEV M  LGG  +FLS  ++QLGR E I DTA+VLSRY+D I++RT  H R+ EL  +A 
Sbjct: 61  FEVGMYQLGGQALFLSSRDLQLGRGEPIADTARVLSRYLDGIMIRTYGHERIEELARWAD 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVINAL+D  HPCQ + D++T  EH+G + G   ++ GDGNN+ HSL+  AA+      
Sbjct: 121 VPVINALSDLLHPCQALTDLLTIREHKGRLAGLKMAYVGDGNNMTHSLMYAAAKVGMHFA 180

Query: 182 IATPIGSEPRNEYLNWARNQGASV----ALFHDAVQAVKGAHCVFTDTWISMNQEFKAR- 236
            ATP G EP  + +  AR   +       L HD  +AV+ A  V TDTW SM QE +   
Sbjct: 181 AATPAGYEPNEKVVQNARADASETGASVTLTHDPKEAVRDADVVVTDTWASMGQEEEHDA 240

Query: 237 EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
              VF+P+QVN  L++ A   A+ MHCLPA+RGEE+  +V +   +V+FDEAENRLH QK
Sbjct: 241 RTAVFRPYQVNPELLAAADARAVVMHCLPAYRGEEITEDVFESFANVIFDEAENRLHVQK 300

Query: 297 AILLWCFG 304
           AI+    G
Sbjct: 301 AIMALVMG 308


>gi|77920009|ref|YP_357824.1| ornithine carbamoyltransferase [Pelobacter carbinolicus DSM 2380]
 gi|123573595|sp|Q3A1V3|OTC_PELCD RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|77546092|gb|ABA89654.1| ornithine carbamoyltransferase [Pelobacter carbinolicus DSM 2380]
          Length = 302

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 132/301 (43%), Positives = 186/301 (61%), Gaps = 1/301 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K F  L++ S   L  +  +A  +K   +   ++  L GK L M+FEK STRTRVSFE
Sbjct: 1   MKKDFLCLTDWSLEELENLFTLAADLKAKQKAGEQHHLLKGKTLGMLFEKSSTRTRVSFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M  LGG  +FLS    Q+GR E I DT +V+SRYVD I++RT +   + EL +++T+P
Sbjct: 61  VGMYQLGGHALFLSSGSTQMGRGEPIKDTGRVMSRYVDGIMIRTFSQEGVEELAQWSTIP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           +IN LTD  HPCQ++AD++T  EH+ + +   + W GDGNN+ +S I  AA F + L +A
Sbjct: 121 IINGLTDMYHPCQVMADLLTVIEHKKNYRDLTYCWIGDGNNMANSWINAAAMFGFELRVA 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQ 242
           TP G EP    +  A+  GA V   +D ++A +GAH + TD W SM QE + A+    F 
Sbjct: 181 TPKGYEPHALVVERAKKLGARVTYLNDPLEAARGAHVLNTDVWASMGQEEEQAKRAAAFA 240

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            FQ+N   ++ A P  + +HCLPAHR EE+ +E ++   +VVFDEAENRLH QKAI+   
Sbjct: 241 GFQINAETIAAADPACILLHCLPAHRDEEITDEAIESSHAVVFDEAENRLHIQKAIMATL 300

Query: 303 F 303
            
Sbjct: 301 M 301


>gi|329766353|ref|ZP_08257899.1| ornithine carbamoyltransferase [Candidatus Nitrosoarchaeum limnia
           SFB1]
 gi|329137122|gb|EGG41412.1| ornithine carbamoyltransferase [Candidatus Nitrosoarchaeum limnia
           SFB1]
          Length = 303

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 138/302 (45%), Positives = 193/302 (63%), Gaps = 2/302 (0%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M    K    L+ ++    + +I+ + K+K   ++  +   L  K L MIF+KPSTRTRV
Sbjct: 1   MKLKTKDLLTLAELTPKEFTGLIDYSIKLKKELKSGNKP-LLKNKTLTMIFQKPSTRTRV 59

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFEVAM  LGG  + LS +EMQL R E+I DTAK LSRY + I+ R  +HS L +L++ +
Sbjct: 60  SFEVAMYQLGGHAVNLSSNEMQLSRGESIEDTAKTLSRYTNCIMARVYDHSLLEKLSQSS 119

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           ++PVIN L+D+ HPCQI+AD MT +E +GS+KG   +W GDGNN+ +S+I G +     +
Sbjct: 120 SIPVINGLSDSFHPCQIMADFMTIKEKKGSLKGLKIAWIGDGNNVCNSMIYGCSLSGVSI 179

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
           +IATP G EP  + +  ++   +   L  D + A+K A  V TDT+ S++     R +  
Sbjct: 180 SIATPKGFEPDAKVIAESKKSTSI-ELTSDPLIAIKNADVVITDTFTSIHTNDPKRIKKF 238

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
              FQVN  L+S A  +A+FMHCLPA R  EV + V+DGPQSVV+DEAENRLHTQKA+L 
Sbjct: 239 LPKFQVNEKLLSHAKKNAIFMHCLPAKRDHEVTSSVIDGPQSVVWDEAENRLHTQKALLS 298

Query: 301 WC 302
             
Sbjct: 299 SI 300


>gi|167909826|ref|ZP_02496917.1| ornithine carbamoyltransferase [Burkholderia pseudomallei 112]
          Length = 309

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 124/304 (40%), Positives = 175/304 (57%), Gaps = 3/304 (0%)

Query: 2   MTYP--KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    +H+    + S  +   ++E    +K   +N     PL  + LAMIFEK STRTR
Sbjct: 1   MTAKTIRHYLQFKDFSLEDYEYVLERTGILKRKFKNYETYHPLHDRTLAMIFEKSSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +F+S  + QLGR E + D+A+V+SR VD I++RT     +    E 
Sbjct: 61  LSFEAGIFQLGGHAVFMSTRDTQLGRGEPVEDSAQVISRMVDIIMIRTFEQDIIQRFAEN 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT+  HPCQ++ADI T+ EHRG ++GK  +W GD NN+L++ I+ A    + 
Sbjct: 121 SRVPVINGLTNEYHPCQVLADIFTYYEHRGPIRGKTVAWVGDANNMLYTWIQAARILGFK 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L ++TP G     + ++        V    +              T +    E +A  + 
Sbjct: 181 LRLSTPPGYALDTKLVDAESTPFYQVFDDPNEACKGADLVTTDVWTSMGFEAENEA-RKQ 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  + V+  +MS AHPDALFMHCLPAHRGEEV   V+DGPQSVV+DEAENRLH QKA++
Sbjct: 240 AFADWCVDEEMMSHAHPDALFMHCLPAHRGEEVTAGVIDGPQSVVWDEAENRLHVQKALM 299

Query: 300 LWCF 303
            +  
Sbjct: 300 EFLL 303


>gi|77462556|ref|YP_352060.1| ornithine carbamoyltransferase [Rhodobacter sphaeroides 2.4.1]
 gi|123592692|sp|Q3J4X5|OTC_RHOS4 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|77386974|gb|ABA78159.1| ornithine carbamoyltransferase [Rhodobacter sphaeroides 2.4.1]
          Length = 308

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 155/308 (50%), Positives = 213/308 (69%), Gaps = 7/308 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFE-----NKPLSGKVLAMIFEKPSTRTR 59
             HF D+    ++ L  +++ A  +K + +   +     ++PL+G+++A+IFEKPSTRTR
Sbjct: 1   MNHFLDIHKTDTAELRQMMDSAHAMKAARKGRPKGQLDEDQPLAGRMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V ++ +GG T+ LSG EMQLG  ETI DTA+VLSRYVD I++RT   + LLE+ E+
Sbjct: 61  VSFDVGVRQMGGQTMVLSGKEMQLGHGETIADTARVLSRYVDLIMIRTFEEATLLEMAEH 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ATVPVIN LT+ THPCQI+AD+MT+EEHRG + G+   W+GDGNN+  S +  A +F + 
Sbjct: 121 ATVPVINGLTNRTHPCQIMADVMTYEEHRGPIAGRKVVWAGDGNNVCASFLHAAGQFGFD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
                P   +P  E++ +AR +G  V++  D  +AV GA  V TDTW+SM+    ARE  
Sbjct: 181 FTFTGPSTLDPEAEFVGYAREKGRRVSIERDPAKAVAGADLVVTDTWVSMHDPQSARERR 240

Query: 240 VFQ--PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
             Q  P+QVN +LM+ A PDALFMHCLPAHR +E  + V+DGP SV+FDEAENRLH QKA
Sbjct: 241 HNQLRPYQVNETLMAQAKPDALFMHCLPAHRDDEATSAVMDGPHSVIFDEAENRLHAQKA 300

Query: 298 ILLWCFGI 305
           I+ WC G+
Sbjct: 301 IMRWCLGL 308


>gi|50084545|ref|YP_046055.1| ornithine carbamoyltransferase [Acinetobacter sp. ADP1]
 gi|56404363|sp|Q6FCH8|OTC_ACIAD RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|49530521|emb|CAG68233.1| ornithine carbamoyltransferase [Acinetobacter sp. ADP1]
          Length = 306

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 129/298 (43%), Positives = 182/298 (61%), Gaps = 2/298 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++SS  L+ I++ A ++K         +P  GKVL MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLRDLSSLELNSILDRASELKRQQHANQVYQPFKGKVLGMIFEKSSTRTRISFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +   GG  IFLS  + QLGR E I D+A+V+S  +D +++RT  H+ +     ++ VPVI
Sbjct: 64  ICQFGGSAIFLSPRDTQLGRGEPIEDSARVISSMLDIVMIRTFGHNIVERFASFSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ++AD+ T++EHRGS+KGK  +W GDGNN+ +S +E A    + L + +P
Sbjct: 124 NGLTDDHHPCQLLADLQTYQEHRGSIKGKTVAWIGDGNNMCNSYMEAAHMMGFKLKVGSP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G EP+ E+L    +         DA             +     +E +   E  F  FQ
Sbjct: 184 KGYEPKPEFLAEFAHCVEVFNSAEDAAVNADLIVTDVWASM--GQEEEQKLREKAFLTFQ 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN +LM++AHP+ LFMHCLPAHRGEE+   +LD   SVV+DEAENRLH QKA++ +  
Sbjct: 242 VNEALMALAHPECLFMHCLPAHRGEEISENMLDHKNSVVWDEAENRLHAQKALMEFLL 299


>gi|221638411|ref|YP_002524673.1| ornithine carbamoyltransferase [Rhodobacter sphaeroides KD131]
 gi|254772732|sp|B9KMW0|OTC_RHOSK RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|221159192|gb|ACM00172.1| Ornithine carbamoyltransferase [Rhodobacter sphaeroides KD131]
          Length = 308

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 155/308 (50%), Positives = 213/308 (69%), Gaps = 7/308 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFE-----NKPLSGKVLAMIFEKPSTRTR 59
             HF D+    ++ L  +++ A  +K + +   +     ++PL+G+++A+IFEKPSTRTR
Sbjct: 1   MNHFLDIHKTDTAELRQMMDSAHAMKAARKGRPKGQFDEDQPLAGRMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V ++ +GG T+ LSG EMQLG  ETI DTA+VLSRYVD I++RT   + LLE+ E+
Sbjct: 61  VSFDVGVRQMGGQTMVLSGKEMQLGHGETIADTARVLSRYVDLIMIRTFEEATLLEMAEH 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ATVPVIN LT+ THPCQI+AD+MT+EEHRG + G+   W+GDGNN+  S +  A +F + 
Sbjct: 121 ATVPVINGLTNRTHPCQIMADVMTYEEHRGPIAGRKVVWAGDGNNVCASFLHAAGQFGFD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
                P   +P  E++ +AR +G  V++  D  +AV GA  V TDTW+SM+    ARE  
Sbjct: 181 FTFTGPPTLDPEAEFVGYAREKGRRVSIERDPAKAVAGADLVVTDTWVSMHDPQSARERR 240

Query: 240 VFQ--PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
             Q  P+QVN +LM+ A PDALFMHCLPAHR +E  + V+DGP SV+FDEAENRLH QKA
Sbjct: 241 HNQLRPYQVNEALMAQAKPDALFMHCLPAHRDDEATSAVMDGPHSVIFDEAENRLHAQKA 300

Query: 298 ILLWCFGI 305
           I+ WC G+
Sbjct: 301 IMRWCLGL 308


>gi|90416148|ref|ZP_01224080.1| ornithine carbamoyltransferase [marine gamma proteobacterium
           HTCC2207]
 gi|90331873|gb|EAS47087.1| ornithine carbamoyltransferase [marine gamma proteobacterium
           HTCC2207]
          Length = 304

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 143/301 (47%), Positives = 195/301 (64%), Gaps = 5/301 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++S + LS +I++A ++K +     +     GKVL MIFEK STRTRVSFE  
Sbjct: 4   RHFLSLRDLSPAELSQVIDLAIEMKAAKREGRQEPIFEGKVLGMIFEKSSTRTRVSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGGD IFLS ++ QLGR E + D+A+V+SR VD +++RT     +      + VPVI
Sbjct: 64  MAQLGGDAIFLSSNDTQLGRGEPVEDSARVISRMVDIVMIRTHGQEIVERFAANSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALT+  HPCQ++AD+ TF EHRGS++GK  +W GDGNN+  S I  A +F++ L IATP
Sbjct: 124 NALTNEYHPCQLLADVQTFVEHRGSIQGKTVAWIGDGNNMCSSWINAAIQFDFKLQIATP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
           +G EP    +  A   G  +++ +D V A  GA  V TD + SM QE +       F  F
Sbjct: 184 VGYEPNAALVAEA---GKRLSVSNDPVAAATGADLVTTDVFASMGQEAEQEERLKHFAGF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQ-SVVFDEAENRLHTQKAILLWCF 303
           QVN +LM+ A  +ALFMHCLPAHR EEV  E+++    SVV+DEAENRLH QKA++++  
Sbjct: 241 QVNHALMAHAADNALFMHCLPAHRDEEVSGELMEDEAISVVWDEAENRLHAQKALMVFLL 300

Query: 304 G 304
           G
Sbjct: 301 G 301


>gi|126461490|ref|YP_001042604.1| ornithine carbamoyltransferase [Rhodobacter sphaeroides ATCC 17029]
 gi|332557441|ref|ZP_08411763.1| ornithine carbamoyltransferase [Rhodobacter sphaeroides WS8N]
 gi|254772731|sp|A3PHL6|OTC_RHOS1 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|126103154|gb|ABN75832.1| ornithine carbamoyltransferase [Rhodobacter sphaeroides ATCC 17029]
 gi|332275153|gb|EGJ20468.1| ornithine carbamoyltransferase [Rhodobacter sphaeroides WS8N]
          Length = 308

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 155/308 (50%), Positives = 213/308 (69%), Gaps = 7/308 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFE-----NKPLSGKVLAMIFEKPSTRTR 59
             HF D+    ++ L  +++ A  +K + +   +     ++PL+G+++A+IFEKPSTRTR
Sbjct: 1   MNHFLDIHKTDTAELRQMMDSAHAMKAARKGRPKGQLDEDQPLAGRMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V ++ +GG T+ LSG EMQLG  ETI DTA+VLSRYVD I++RT   + LLE+ E+
Sbjct: 61  VSFDVGVRQMGGQTMVLSGKEMQLGHGETIADTARVLSRYVDLIMIRTFEEATLLEMAEH 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ATVPVIN LT+ THPCQI+AD+MT+EEHRG + G+   W+GDGNN+  S +  A +F + 
Sbjct: 121 ATVPVINGLTNRTHPCQIMADVMTYEEHRGPIAGRKVVWAGDGNNVCASFLHAAGQFGFD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
                P   +P  E++ +AR +G  V++  D  +AV GA  V TDTW+SM+    ARE  
Sbjct: 181 FTFTGPSTLDPEAEFVGYAREKGRRVSIERDPAKAVAGADLVVTDTWVSMHDPQSARERR 240

Query: 240 VFQ--PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
             Q  P+QVN +LM+ A PDALFMHCLPAHR +E  + V+DGP SV+FDEAENRLH QKA
Sbjct: 241 HNQLRPYQVNEALMAQAKPDALFMHCLPAHRDDEATSAVMDGPHSVIFDEAENRLHAQKA 300

Query: 298 ILLWCFGI 305
           I+ WC G+
Sbjct: 301 IMRWCLGL 308


>gi|296135415|ref|YP_003642657.1| ornithine carbamoyltransferase [Thiomonas intermedia K12]
 gi|295795537|gb|ADG30327.1| ornithine carbamoyltransferase [Thiomonas intermedia K12]
          Length = 311

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 135/306 (44%), Positives = 184/306 (60%), Gaps = 3/306 (0%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M T  +H+   S+++      +   A  IK   +    ++PL  + LAMIFEK STRTR+
Sbjct: 1   MKTTLRHYLQFSDLNREEYDYVFARAALIKAKFKRYEPHQPLVDRTLAMIFEKHSTRTRL 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFE  M  LGG  I+++  + QLGR E I D A+V SR VD +++RT     +     Y+
Sbjct: 61  SFEAGMHQLGGAAIYINTRDSQLGRGEPIEDAAQVFSRMVDLVMIRTYGQEIVERFAAYS 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
            VPVIN LT+  HPCQI+AD+MT+ EHRG ++GK  +W GD NN+ ++ ++ A    + L
Sbjct: 121 RVPVINGLTNEFHPCQILADVMTYIEHRGPIQGKTVAWIGDANNMFYTWLQAAEVLGFTL 180

Query: 181 NIATPIGSEPRNEYLNWA--RNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-RE 237
           + A P G         +     Q A +  F D  QA +GAH + TD W SM  E +    
Sbjct: 181 HFAGPKGYGVEKNRPGYPLSAAQIAHLREFDDPRQACEGAHLITTDVWTSMGYEAEKLAR 240

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
           E  F+ F V+  +M+ AH DALFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA
Sbjct: 241 EQAFKGFMVDGEMMARAHSDALFMHCLPAHRGEEVAAEVIDGPQSVVWDEAENRLHGQKA 300

Query: 298 ILLWCF 303
           ++ +  
Sbjct: 301 LMEFLL 306


>gi|87201152|ref|YP_498409.1| ornithine carbamoyltransferase [Novosphingobium aromaticivorans DSM
           12444]
 gi|123488054|sp|Q2G3J8|OTC_NOVAD RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|87136833|gb|ABD27575.1| ornithine carbamoyltransferase [Novosphingobium aromaticivorans DSM
           12444]
          Length = 311

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 149/306 (48%), Positives = 204/306 (66%), Gaps = 5/306 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-----PLSGKVLAMIFEKPSTRTRV 60
           KHF +L++     ++ ++  A   K++     + K     PL G+VLAM+FEK STRTRV
Sbjct: 6   KHFLNLTDAGGDAIAAMLNDALDRKSARAGQPKGKADADAPLGGRVLAMVFEKNSTRTRV 65

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF++AM+ LGG  + L     QLGR ETI DTA+VLSR  DAI++RT +H+++ EL  +A
Sbjct: 66  SFDIAMRQLGGSALILDAGTTQLGRGETIADTARVLSRMADAIMLRTDDHAKVEELARHA 125

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVIN LTD +HPCQI+AD++T  EH  ++ G   +W GDGNN+L+S++E A    + +
Sbjct: 126 TVPVINGLTDLSHPCQIMADLLTVIEHGKALPGLEVAWLGDGNNVLNSIVEAAGLMKFNV 185

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            I  P G E     +  A   GA + +  D V+AV+GA  V TDTWISM Q     +   
Sbjct: 186 RIGVPEGYESDAGMIEAAVLAGAGIRVIRDPVEAVRGADVVVTDTWISMGQAHAEAKLAA 245

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
             P+QVN +LM+ A PDA+F+HCLPAHRGEEV + V+DGP+SVV+DEAENR+H QK++L 
Sbjct: 246 MAPYQVNDALMAHAKPDAVFLHCLPAHRGEEVTDAVIDGPRSVVWDEAENRIHAQKSVLR 305

Query: 301 WCFGII 306
           W FG I
Sbjct: 306 WVFGQI 311


>gi|167901586|ref|ZP_02488791.1| ornithine carbamoyltransferase [Burkholderia pseudomallei NCTC
           13177]
          Length = 309

 Score =  219 bits (558), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 123/304 (40%), Positives = 174/304 (57%), Gaps = 3/304 (0%)

Query: 2   MTYP--KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    +H+    + S  +   ++E    +K   +N     PL  + LAMIFEK STRTR
Sbjct: 1   MTAKTIRHYLQFKDFSLEDYEYVLERTGILKRKFKNYETYHPLHDRTLAMIFEKSSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +F+S  + QLGR E + D+A+V+SR VD I++RT     +    E 
Sbjct: 61  LSFEAGIFQLGGHAVFMSTRDTQLGRGEPVEDSAQVISRMVDIIMIRTFEQDIIQRFAEN 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT+  HPCQ++ADI T+ EHRG ++GK  +W GD NN+L++  + A    + 
Sbjct: 121 SRVPVINGLTNEYHPCQVLADIFTYYEHRGPIRGKTVAWVGDANNMLYTWFQAARILGFK 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L ++TP G     + ++        V    +              T +    E +A  + 
Sbjct: 181 LRLSTPPGYALDTKLVDAESAPFYQVFDDPNEACKGADLVTTDVWTSMGFEAENEA-RKQ 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  + V+  +MS AHPDALFMHCLPAHRGEEV   V+DGPQSVV+DEAENRLH QKA++
Sbjct: 240 AFADWCVDEEMMSHAHPDALFMHCLPAHRGEEVTAGVIDGPQSVVWDEAENRLHVQKALM 299

Query: 300 LWCF 303
            +  
Sbjct: 300 EFLL 303


>gi|170290121|ref|YP_001736937.1| ornithine carbamoyltransferase [Candidatus Korarchaeum cryptofilum
           OPF8]
 gi|170174201|gb|ACB07254.1| ornithine carbamoyltransferase [Candidatus Korarchaeum cryptofilum
           OPF8]
          Length = 339

 Score =  219 bits (558), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 129/306 (42%), Positives = 180/306 (58%), Gaps = 5/306 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
           + K      ++S   +  I E  K++K++       + L GK L MIFE+PSTRTRVSFE
Sbjct: 34  FGKDLLTCQDLSRDEIWLIFETTKEMKHAYYRGERPRLLEGKNLGMIFEEPSTRTRVSFE 93

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VAM  LGG  ++L   E+ LG  ETI DTA+VLSRY+D I+ R   H  L EL ++AT+P
Sbjct: 94  VAMSQLGGHALYLRPGELHLGVRETIADTARVLSRYLDGIMARLLKHETLEELAKHATIP 153

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HP Q + D+ T  E  G +K    ++ GD  N+ +SL+   +R        
Sbjct: 154 VINGLTDWFHPVQALTDVYTMLEKFGDLKKIKVAFFGDATNVANSLLVLTSRLGMNFTFC 213

Query: 184 TPIGSEPRNEYLNWARNQG----ASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
            P    P+   +           A++ +  D  +A+K A+ V+TD W  + QE +A E  
Sbjct: 214 GPKKYWPKERVMKMVEENVAETGANIEITEDIDKAIKDANVVYTDLWWWVGQEHEAEERK 273

Query: 240 -VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             FQP+QVN +LM  A  +A+FMHCLPA RG EV ++V+DGP S+V+D+AENRLH +KAI
Sbjct: 274 AAFQPYQVNSNLMKRAAKNAVFMHCLPAARGMEVTDDVIDGPWSIVWDQAENRLHVEKAI 333

Query: 299 LLWCFG 304
           L+   G
Sbjct: 334 LVLLMG 339


>gi|307136374|gb|ADN34186.1| ornithine carbamoyltransferase [Cucumis melo subsp. melo]
          Length = 378

 Score =  219 bits (558), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 136/306 (44%), Positives = 184/306 (60%), Gaps = 3/306 (0%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-PLSGKVLAMIFEKPSTRTRVS 61
           T  K F  LS+   S L  I++ A ++K   ++   +  P  GK +AMIF KPS RTRVS
Sbjct: 73  TEKKDFLHLSDFDKSTLLKILDRAVEVKAQLKSGDRSFLPFKGKTMAMIFAKPSMRTRVS 132

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE     LGG  I+L    +Q+G+ E   D A+VLSRY D I+ R   H  +L+L +Y+T
Sbjct: 133 FETGFFLLGGHAIYLGPDTIQMGKREETRDIARVLSRYNDVIMARVFGHQDILDLAKYST 192

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD  HPCQ++AD +T  EH G ++G    + GDGNN++HS +  A+       
Sbjct: 193 VPVINGLTDYNHPCQVMADALTMIEHIGKLEGIKVVYVGDGNNMVHSWLLLASVVPLHFV 252

Query: 182 IATPIGSEPRNEYLNWARNQ-GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEH 239
            A P G EP    +  AR    + + + HD  +AVKGA  V++D W SM Q+ +A     
Sbjct: 253 CACPKGFEPDKNTVEKARQAGVSKIEITHDPKEAVKGADVVYSDVWASMGQKEEADYRRQ 312

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           VFQ FQVN  LM++A P A FMHCLPA RG EV + V++ P S+VF +AENR+H Q AI+
Sbjct: 313 VFQGFQVNEELMNLAGPKAYFMHCLPAERGVEVTDGVIEAPNSIVFPQAENRMHAQNAIM 372

Query: 300 LWCFGI 305
           L   G+
Sbjct: 373 LHVLGL 378


>gi|163737716|ref|ZP_02145133.1| ornithine carbamoyltransferase [Phaeobacter gallaeciensis BS107]
 gi|161389242|gb|EDQ13594.1| ornithine carbamoyltransferase [Phaeobacter gallaeciensis BS107]
          Length = 308

 Score =  219 bits (558), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 159/307 (51%), Positives = 213/307 (69%), Gaps = 7/307 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNS-----SENIFENKPLSGKVLAMIFEKPSTRTR 59
             HF D+    +++L  II+ A   K +          +  PL  +++A+IFEKPSTRTR
Sbjct: 1   MNHFLDIHKTDATDLRAIIDQASATKQARLGRPKAAPDDELPLKDRMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V ++ +GG T+ LSG++MQLG  ETI DTA+VLSRYVD I++RT + + L E+ EY
Sbjct: 61  VSFDVGVRQMGGQTMVLSGNDMQLGHGETIADTARVLSRYVDMIMIRTFDETVLTEMAEY 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           A+VPVIN LTD THPCQI+AD++T+EEHRG +KGK   W GDGNN+  S +  AA+F + 
Sbjct: 121 ASVPVINGLTDRTHPCQIMADVLTYEEHRGPIKGKKVVWCGDGNNVCASFLHAAAQFGFD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKARE 237
           L    P   +P  E++  ARN G+ V +  DA +AV+GA  V  DTW+SM+  Q  K R 
Sbjct: 181 LTFTGPAQLDPEPEFIGLARNAGSQVIIERDAAKAVEGADLVVADTWVSMHDSQSSKERR 240

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
            ++ + +QVN +LM+ A PDALFMHCLPAHR EEV + V+DGPQSV+FDEAENRLH QKA
Sbjct: 241 HNMLRGYQVNDALMAHAKPDALFMHCLPAHREEEVTSAVMDGPQSVIFDEAENRLHAQKA 300

Query: 298 ILLWCFG 304
           I+ +C G
Sbjct: 301 IMRYCLG 307


>gi|53718508|ref|YP_107494.1| ornithine carbamoyltransferase [Burkholderia pseudomallei K96243]
 gi|53725170|ref|YP_102192.1| ornithine carbamoyltransferase [Burkholderia mallei ATCC 23344]
 gi|67642865|ref|ZP_00441616.1| ornithine carbamoyltransferase [Burkholderia mallei GB8 horse 4]
 gi|76809888|ref|YP_332485.1| ornithine carbamoyltransferase [Burkholderia pseudomallei 1710b]
 gi|121600960|ref|YP_992021.1| ornithine carbamoyltransferase [Burkholderia mallei SAVP1]
 gi|124386609|ref|YP_001028468.1| ornithine carbamoyltransferase [Burkholderia mallei NCTC 10229]
 gi|126441362|ref|YP_001057968.1| ornithine carbamoyltransferase [Burkholderia pseudomallei 668]
 gi|126450893|ref|YP_001079703.1| ornithine carbamoyltransferase [Burkholderia mallei NCTC 10247]
 gi|126455355|ref|YP_001065202.1| ornithine carbamoyltransferase [Burkholderia pseudomallei 1106a]
 gi|134279616|ref|ZP_01766328.1| ornithine carbamoyltransferase [Burkholderia pseudomallei 305]
 gi|166998450|ref|ZP_02264310.1| ornithine carbamoyltransferase [Burkholderia mallei PRL-20]
 gi|167718396|ref|ZP_02401632.1| ornithine carbamoyltransferase [Burkholderia pseudomallei DM98]
 gi|167737443|ref|ZP_02410217.1| ornithine carbamoyltransferase [Burkholderia pseudomallei 14]
 gi|167814562|ref|ZP_02446242.1| ornithine carbamoyltransferase [Burkholderia pseudomallei 91]
 gi|167823034|ref|ZP_02454505.1| ornithine carbamoyltransferase [Burkholderia pseudomallei 9]
 gi|167844595|ref|ZP_02470103.1| ornithine carbamoyltransferase [Burkholderia pseudomallei B7210]
 gi|167893126|ref|ZP_02480528.1| ornithine carbamoyltransferase [Burkholderia pseudomallei 7894]
 gi|167917852|ref|ZP_02504943.1| ornithine carbamoyltransferase [Burkholderia pseudomallei BCC215]
 gi|217419508|ref|ZP_03451014.1| ornithine carbamoyltransferase [Burkholderia pseudomallei 576]
 gi|226192858|ref|ZP_03788471.1| ornithine carbamoyltransferase [Burkholderia pseudomallei Pakistan
           9]
 gi|237811117|ref|YP_002895568.1| ornithine carbamoyltransferase [Burkholderia pseudomallei MSHR346]
 gi|242317506|ref|ZP_04816522.1| ornithine carbamoyltransferase [Burkholderia pseudomallei 1106b]
 gi|254177150|ref|ZP_04883807.1| ornithine carbamoyltransferase [Burkholderia mallei ATCC 10399]
 gi|254187501|ref|ZP_04894013.1| ornithine carbamoyltransferase [Burkholderia pseudomallei Pasteur
           52237]
 gi|254196419|ref|ZP_04902843.1| ornithine carbamoyltransferase [Burkholderia pseudomallei S13]
 gi|254203872|ref|ZP_04910232.1| ornithine carbamoyltransferase [Burkholderia mallei FMH]
 gi|254208853|ref|ZP_04915201.1| ornithine carbamoyltransferase [Burkholderia mallei JHU]
 gi|254261285|ref|ZP_04952339.1| ornithine carbamoyltransferase [Burkholderia pseudomallei 1710a]
 gi|254296377|ref|ZP_04963834.1| ornithine carbamoyltransferase [Burkholderia pseudomallei 406e]
 gi|254298201|ref|ZP_04965653.1| ornithine carbamoyltransferase [Burkholderia pseudomallei 406e]
 gi|254360092|ref|ZP_04976362.1| ornithine carbamoyltransferase [Burkholderia mallei 2002721280]
 gi|56404341|sp|Q62M76|OTC_BURMA RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|56404344|sp|Q63WM2|OTC_BURPS RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|52208922|emb|CAH34861.1| putative ornithine carbamoyltransferase [Burkholderia pseudomallei
           K96243]
 gi|52428593|gb|AAU49186.1| ornithine carbamoyltransferase [Burkholderia mallei ATCC 23344]
 gi|76579341|gb|ABA48816.1| ornithine carbamoyltransferase [Burkholderia pseudomallei 1710b]
 gi|121229770|gb|ABM52288.1| ornithine carbamoyltransferase [Burkholderia mallei SAVP1]
 gi|124294629|gb|ABN03898.1| ornithine carbamoyltransferase [Burkholderia mallei NCTC 10229]
 gi|126220855|gb|ABN84361.1| ornithine carbamoyltransferase [Burkholderia pseudomallei 668]
 gi|126228997|gb|ABN92537.1| ornithine carbamoyltransferase [Burkholderia pseudomallei 1106a]
 gi|126243763|gb|ABO06856.1| ornithine carbamoyltransferase [Burkholderia mallei NCTC 10247]
 gi|134248816|gb|EBA48898.1| ornithine carbamoyltransferase [Burkholderia pseudomallei 305]
 gi|147745384|gb|EDK52464.1| ornithine carbamoyltransferase [Burkholderia mallei FMH]
 gi|147750729|gb|EDK57798.1| ornithine carbamoyltransferase [Burkholderia mallei JHU]
 gi|148029332|gb|EDK87237.1| ornithine carbamoyltransferase [Burkholderia mallei 2002721280]
 gi|157805863|gb|EDO83033.1| ornithine carbamoyltransferase [Burkholderia pseudomallei 406e]
 gi|157808449|gb|EDO85619.1| ornithine carbamoyltransferase [Burkholderia pseudomallei 406e]
 gi|157935181|gb|EDO90851.1| ornithine carbamoyltransferase [Burkholderia pseudomallei Pasteur
           52237]
 gi|160698191|gb|EDP88161.1| ornithine carbamoyltransferase [Burkholderia mallei ATCC 10399]
 gi|169653162|gb|EDS85855.1| ornithine carbamoyltransferase [Burkholderia pseudomallei S13]
 gi|217396812|gb|EEC36828.1| ornithine carbamoyltransferase [Burkholderia pseudomallei 576]
 gi|225935108|gb|EEH31082.1| ornithine carbamoyltransferase [Burkholderia pseudomallei Pakistan
           9]
 gi|237503157|gb|ACQ95475.1| ornithine carbamoyltransferase [Burkholderia pseudomallei MSHR346]
 gi|238524072|gb|EEP87507.1| ornithine carbamoyltransferase [Burkholderia mallei GB8 horse 4]
 gi|242140745|gb|EES27147.1| ornithine carbamoyltransferase [Burkholderia pseudomallei 1106b]
 gi|243065506|gb|EES47692.1| ornithine carbamoyltransferase [Burkholderia mallei PRL-20]
 gi|254219974|gb|EET09358.1| ornithine carbamoyltransferase [Burkholderia pseudomallei 1710a]
          Length = 309

 Score =  219 bits (558), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 124/304 (40%), Positives = 175/304 (57%), Gaps = 3/304 (0%)

Query: 2   MTYP--KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    +H+    + S  +   ++E    +K   +N     PL  + LAMIFEK STRTR
Sbjct: 1   MTAKTIRHYLQFKDFSLEDYEYVLERTGILKRKFKNYETYHPLHDRTLAMIFEKSSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +F+S  + QLGR E + D+A+V+SR VD I++RT     +    E 
Sbjct: 61  LSFEAGIFQLGGHAVFMSTRDTQLGRGEPVEDSAQVISRMVDIIMIRTFEQDIIQRFAEN 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT+  HPCQ++ADI T+ EHRG ++GK  +W GD NN+L++ I+ A    + 
Sbjct: 121 SRVPVINGLTNEYHPCQVLADIFTYYEHRGPIRGKTVAWVGDANNMLYTWIQAARILGFK 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L ++TP G     + ++        V    +              T +    E +A  + 
Sbjct: 181 LRLSTPPGYALDTKLVDAESAPFYQVFDDPNEACKGADLVTTDVWTSMGFEAENEA-RKQ 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  + V+  +MS AHPDALFMHCLPAHRGEEV   V+DGPQSVV+DEAENRLH QKA++
Sbjct: 240 AFADWCVDEEMMSHAHPDALFMHCLPAHRGEEVTAGVIDGPQSVVWDEAENRLHVQKALM 299

Query: 300 LWCF 303
            +  
Sbjct: 300 EFLL 303


>gi|254292720|ref|YP_003058743.1| ornithine carbamoyltransferase [Hirschia baltica ATCC 49814]
 gi|254041251|gb|ACT58046.1| ornithine carbamoyltransferase [Hirschia baltica ATCC 49814]
          Length = 308

 Score =  219 bits (558), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 134/303 (44%), Positives = 190/303 (62%), Gaps = 5/303 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSE-----NIFENKPLSGKVLAMIFEKPSTRTRV 60
           +HF D+  + +S L  I++ AK  KN+       ++  +  L+G  LAMIFEK STRTR+
Sbjct: 4   RHFLDIFPLPASELRAILDNAKSRKNARAGMPKGSVDPDAVLAGYTLAMIFEKSSTRTRL 63

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF++ ++ LGG +I L+ ++MQLGR ETI DT++VLSR +DA+++R  +H+ +      +
Sbjct: 64  SFDMGIRQLGGTSIVLNAADMQLGRGETIEDTSRVLSRMIDAVMIRANSHADVEAFAAVS 123

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
            VPVIN LT+ +HPCQI+AD+ T EEH   +KG   +W GDGNN+  S    A +F + L
Sbjct: 124 DVPVINGLTNTSHPCQIMADLQTLEEHGLDLKGARIAWVGDGNNVAASFAHAAPKFGFSL 183

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
            + TP G E     +   R +   + +++D  +AV GA  V  DT++SM      +    
Sbjct: 184 ALGTPQGYELPEIDIERGRQEQGRIDIYNDPAEAVAGADVVVADTFVSMGDTDADKRLKD 243

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
             PFQV   LM  A+  A F+HCLPAHRGEEV  EV+DG  S++FDEAENRLH QKA+L 
Sbjct: 244 LMPFQVTQDLMDKANGGAKFLHCLPAHRGEEVAAEVIDGSASLIFDEAENRLHAQKAVLE 303

Query: 301 WCF 303
           WC 
Sbjct: 304 WCL 306


>gi|260551682|ref|ZP_05825756.1| ornithine carbamoyltransferase [Acinetobacter sp. RUH2624]
 gi|260405425|gb|EEW98919.1| ornithine carbamoyltransferase [Acinetobacter sp. RUH2624]
          Length = 306

 Score =  219 bits (557), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 131/298 (43%), Positives = 182/298 (61%), Gaps = 2/298 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++S+  L  +++ A ++K   ++    +P  GKVL MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLRDLSTLELHRVLQRASELKKMQQSNKVYQPFVGKVLGMIFEKSSTRTRISFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +   GG  IFLS  + QLGR E I D+A+V+S  +D +++RT  H  +     Y+ VPVI
Sbjct: 64  INQFGGSAIFLSPRDTQLGRGEPIEDSARVISSMLDIVMIRTFGHDIVERFASYSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ++AD+ T+ EHRGS++GK  +W GDGNN+ +S IE A    + L IA+P
Sbjct: 124 NGLTDDHHPCQLLADLQTYIEHRGSIEGKTVAWIGDGNNMCNSYIEAAHLMGFKLKIASP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G EP+ E+L    +         DA             +     +E +   ++ F  FQ
Sbjct: 184 KGFEPKPEFLAEFGHCVELFDNAEDAAVNADLIVTDVWASM--GQEEEQKLRKNAFAAFQ 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN  LMS+AHPD LFMHCLPAHRGEE+   +LD   SVV+DEAENRLH QKA++ +  
Sbjct: 242 VNEKLMSLAHPDCLFMHCLPAHRGEEISETMLDHKNSVVWDEAENRLHAQKALMEFLL 299


>gi|256828061|ref|YP_003156789.1| ornithine carbamoyltransferase [Desulfomicrobium baculatum DSM
           4028]
 gi|256577237|gb|ACU88373.1| ornithine carbamoyltransferase [Desulfomicrobium baculatum DSM
           4028]
          Length = 298

 Score =  219 bits (557), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 141/299 (47%), Positives = 196/299 (65%), Gaps = 4/299 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KHF  ++++ ++    ++  AK++K+       +  L+GK LAMIFEK STRTRVSFEV
Sbjct: 1   MKHFLSINSLMATEAMDLVLRAKEMKDGDYR---SDLLAGKTLAMIFEKASTRTRVSFEV 57

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            ++HLGGDTIF++ ++ QLGR+E + DTA+VLSRYV  +V+RT     + +L  Y ++PV
Sbjct: 58  GIRHLGGDTIFMTPADSQLGRSEPLKDTARVLSRYVQGMVVRTFAQKNVEDLARYGSIPV 117

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           +NALTD  HPCQI++D++T  E    +K  + SW GDGNN+ HS I  +  F + LNIA+
Sbjct: 118 VNALTDMYHPCQIMSDMLTIYERTTHLKDLVISWIGDGNNMAHSWINASVYFGFQLNIAS 177

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV-FQP 243
           P G  P    L  A   GA V +  D   A+ G+H V TD W SM QE + +     F  
Sbjct: 178 PEGYAPNTAVLERAWKMGAKVFVTDDPKAAIAGSHFVNTDVWASMGQEAEQKRREKAFAG 237

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           +QV+  L+++A P+A  +HCLPAHRGEE+   V +GPQS+VFD+AENRLH QKAIL W 
Sbjct: 238 YQVDDELLALADPNAKVLHCLPAHRGEEISEAVFEGPQSIVFDQAENRLHMQKAILEWI 296


>gi|171464063|ref|YP_001798176.1| ornithine carbamoyltransferase [Polynucleobacter necessarius subsp.
           necessarius STIR1]
 gi|171193601|gb|ACB44562.1| ornithine carbamoyltransferase [Polynucleobacter necessarius subsp.
           necessarius STIR1]
          Length = 326

 Score =  219 bits (557), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 122/299 (40%), Positives = 176/299 (58%), Gaps = 3/299 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH+   S+++      +++ +  +K   ++     PL  + LAMIFEK STRTR+SFE  
Sbjct: 25  KHYLQFSDLTREEYDYLLKRSAWLKAKFKSYETWHPLHDRTLAMIFEKHSTRTRLSFEAG 84

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  ++L+  + QLGR E + D A+V+SR  D I++RT     +      + VPVI
Sbjct: 85  IHQLGGHAVYLNTRDTQLGRGEPVEDAAQVISRMTDIIMVRTFGQEIIERFASNSRVPVI 144

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQ++ADI TF E RG ++GK  +W GD NN+ ++ ++ A   ++ L  + P
Sbjct: 145 NGLTNEFHPCQVLADIFTFVEARGPIQGKTVAWVGDANNMAYTWLQAAECLDFQLRFSAP 204

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQPF 244
            G       L         + +  D  +A KGA  V TD W SM  E +     + FQ +
Sbjct: 205 EGYLLDPARLTP--KAVKHLTVCVDPKEACKGADLVTTDVWTSMGYEDENTSRMNAFQDW 262

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
            V+  LMS+A PDALFMHCLPAHRGEEV   V+DGPQS+V++EAENRLH QK ++ +  
Sbjct: 263 MVDEELMSLAKPDALFMHCLPAHRGEEVSAGVIDGPQSIVWEEAENRLHVQKVLMEYLL 321


>gi|86136553|ref|ZP_01055132.1| ornithine carbamoyltransferase [Roseobacter sp. MED193]
 gi|85827427|gb|EAQ47623.1| ornithine carbamoyltransferase [Roseobacter sp. MED193]
          Length = 308

 Score =  219 bits (557), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 161/308 (52%), Positives = 216/308 (70%), Gaps = 7/308 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFE-----NKPLSGKVLAMIFEKPSTRTR 59
             HF D+    ++ L  II+ AK +K + +   +      +PL+G+++A+IFEKPSTRTR
Sbjct: 1   MNHFLDIHTTDTTALHGIIDQAKLMKQARQGRPKGMPDDEQPLAGQMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SF+V ++ +GG ++ LSG +MQLG  ETI DTA+V+SRYVD I++RT + + L E+ EY
Sbjct: 61  ISFDVGVRQMGGQSMVLSGKDMQLGHGETIADTARVMSRYVDLIMIRTFDEAVLQEMAEY 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           A VPVIN LTD THPCQI+ADI T+EEHRGS+KGK   W+GDGNN+  S +  AA+F + 
Sbjct: 121 ADVPVINGLTDRTHPCQIMADIQTYEEHRGSIKGKKVVWAGDGNNVCASFLHAAAKFGFD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKARE 237
           L    P   +P  E++  AR  G+ V +  DA +AV+GA  V  DTW+SM+  Q  K R 
Sbjct: 181 LTFTGPAQLDPEEEFVGLARKAGSKVVIERDAFKAVEGADLVVADTWVSMHDSQSSKERR 240

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
            ++ +P+QVN  LMS A  DALFMHCLPAHR EEV + V+DGPQSV+FDEAENRLH QKA
Sbjct: 241 HNMLRPYQVNDELMSHAKSDALFMHCLPAHREEEVTSAVMDGPQSVIFDEAENRLHAQKA 300

Query: 298 ILLWCFGI 305
           I+ WC G+
Sbjct: 301 IMRWCLGV 308


>gi|254416771|ref|ZP_05030521.1| ornithine carbamoyltransferase [Microcoleus chthonoplastes PCC
           7420]
 gi|196176511|gb|EDX71525.1| ornithine carbamoyltransferase [Microcoleus chthonoplastes PCC
           7420]
          Length = 305

 Score =  219 bits (557), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 117/308 (37%), Positives = 177/308 (57%), Gaps = 10/308 (3%)

Query: 2   MT--YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    +    L+++S+  +  ++ +A ++K    N+        KVL ++F K STRTR
Sbjct: 1   MTALQGRDVLGLADLSADEIHELLHLAIQLKTGQVNLR-----CNKVLGLLFYKASTRTR 55

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF VAM  LGG  I L+ +  Q+GR E + DTA+VL RY+D + +RT     L    EY
Sbjct: 56  VSFSVAMYQLGGQVIDLNPNVTQVGRGEPVVDTARVLDRYLDILAIRTFEQKELETFAEY 115

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           A +P+INALTD  HPCQ++AD++T +E  GS+ G    + GDGNN+ HSL+ G A     
Sbjct: 116 AQIPIINALTDLEHPCQVLADLLTIQECFGSLAGATVVYLGDGNNVAHSLMVGCALMGMN 175

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR--- 236
           + +ATP   +P +  ++ A+    +  +                 T +  +   +A    
Sbjct: 176 VRVATPSTYQPNSLIVDRAKQLAVNSEVTITDDPKAAVKGANVIYTDVWASMGQEASADA 235

Query: 237 EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
              VF P+QVN  L+S+A  DA+ +HCLPAHRGEE+ +EV++G +S ++D+AENR+H QK
Sbjct: 236 RIPVFLPYQVNEQLLSLAAKDAIVLHCLPAHRGEEITDEVMEGSRSRIWDQAENRMHAQK 295

Query: 297 AILLWCFG 304
           A+L    G
Sbjct: 296 ALLASLLG 303


>gi|254251591|ref|ZP_04944909.1| Ornithine carbamoyltransferase [Burkholderia dolosa AUO158]
 gi|124894200|gb|EAY68080.1| Ornithine carbamoyltransferase [Burkholderia dolosa AUO158]
          Length = 309

 Score =  219 bits (557), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 122/304 (40%), Positives = 173/304 (56%), Gaps = 3/304 (0%)

Query: 2   MTYP--KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    +H+    + S  +   ++E    +K   +N     PL  + LAMIFEK STRTR
Sbjct: 1   MTAKTIRHYLQFKDFSLEDYEYVLERTGILKRKFKNYETYHPLHDRTLAMIFEKSSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +F+S  + QLGR E + D+A+V+SR VD I++RT     +    E 
Sbjct: 61  LSFEAGIFQLGGHAVFMSTRDTQLGRGEPVEDSAQVISRMVDIIMIRTFEQEIIQRFAEN 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT+  HPCQ++ADI T+ EHRG + GK  +W GD NN+L++ I+ A    + 
Sbjct: 121 SRVPVINGLTNEYHPCQVLADIFTYYEHRGPIAGKTVAWVGDANNMLYTWIQAAQILGFK 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L ++TP G     + ++        V    +              T +    E +A  + 
Sbjct: 181 LRLSTPPGYALDMKLVSPDSAPFYDVFDDPNEACKGADLVTTDVWTSMGFEAENEA-RKQ 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  + V+  +M  A+PDALFMHCLPAHRGEEV   V+DGPQSVV+DEAENRLH QKA++
Sbjct: 240 AFADWCVDEEMMGHANPDALFMHCLPAHRGEEVTAGVIDGPQSVVWDEAENRLHVQKALM 299

Query: 300 LWCF 303
            +  
Sbjct: 300 EFLL 303


>gi|209965756|ref|YP_002298671.1| ornithine carbamoyltransferase [Rhodospirillum centenum SW]
 gi|209959222|gb|ACI99858.1| ornithine carbamoyltransferase [Rhodospirillum centenum SW]
          Length = 306

 Score =  219 bits (557), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 157/298 (52%), Positives = 203/298 (68%), Gaps = 3/298 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF D+  + + +L  +++ A  +K + +     KPL G+ LA+IFEKPSTRTRVSFEV 
Sbjct: 10  RHFIDIHLLDAGSLRGMLDYAAALKRAKQ---PEKPLLGRTLALIFEKPSTRTRVSFEVG 66

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M+ LGG+ I L+G E+QLG  ETIGDTA+VLSR+VDAI++RT    +L E+ E A+VPVI
Sbjct: 67  MRQLGGEVITLTGKEIQLGHGETIGDTARVLSRFVDAIMLRTDAEEKLHEMAEAASVPVI 126

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD +HP QI+ADI+TFEE +G + GK+  WSGD NN+  S I  A RF++ L +A P
Sbjct: 127 NGLTDKSHPVQIMADILTFEERKGPITGKVVCWSGDANNVCESWIHAAVRFDFELRVACP 186

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
               P  E L W R     V +  DA  AV GA  V TDTW+SM+ +   R   + +P+Q
Sbjct: 187 AELAPSAETLEWVRRNDGRVIVTRDAEAAVAGADAVVTDTWVSMHHQDAERRHALLKPYQ 246

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN  LM +A  DA+FMHCLPAHR EEV   V+DGPQSVV+DEAENR+H QK IL WC 
Sbjct: 247 VNERLMGLAQKDAIFMHCLPAHRDEEVSTAVIDGPQSVVWDEAENRMHAQKGILAWCL 304


>gi|310816622|ref|YP_003964586.1| ornithine carbamoyltransferase [Ketogulonicigenium vulgare Y25]
 gi|308755357|gb|ADO43286.1| ornithine carbamoyltransferase [Ketogulonicigenium vulgare Y25]
          Length = 308

 Score =  219 bits (557), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 155/308 (50%), Positives = 213/308 (69%), Gaps = 7/308 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSE-----NIFENKPLSGKVLAMIFEKPSTRTR 59
            +HF D++   +  L  +I+ A  +K +           ++PL+ +++A+IFEKPSTRTR
Sbjct: 1   MQHFLDINTTPADQLRGMIDKALAMKQARAGLPKGAGDADQPLADRMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V ++ +GG T+ LSG++MQLG  ETI DTA+VLSRYVD I++RT   + LLE+ EY
Sbjct: 61  VSFDVGVRQMGGQTMVLSGADMQLGHGETIADTARVLSRYVDMIMIRTFEEATLLEMAEY 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ATVPVIN LT+ THPCQI+ADI+T+EEHRG + GK   WSGDGNN+ HS +  A +FN+ 
Sbjct: 121 ATVPVINGLTNRTHPCQIMADILTYEEHRGPITGKKVVWSGDGNNVFHSFVHAAQKFNFD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF--KARE 237
           L    P   +P    +  AR  GA++ +  D ++AV+GA  V TDTW+SM+     K R 
Sbjct: 181 LTFTGPQPLDPEAGIVAEARAAGANIVIERDPMKAVEGADLVVTDTWVSMHDPASAKERR 240

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
            +  + +QVN +LM+ A  DALFMHCLPAHR +EV + V+DGP SV+FDEAENRLH QKA
Sbjct: 241 HNQLRGYQVNDTLMARAKSDALFMHCLPAHREDEVTSSVMDGPHSVIFDEAENRLHAQKA 300

Query: 298 ILLWCFGI 305
           ++ WC G+
Sbjct: 301 VMRWCLGV 308


>gi|160944996|ref|ZP_02092222.1| hypothetical protein FAEPRAM212_02511 [Faecalibacterium prausnitzii
           M21/2]
 gi|158442727|gb|EDP19732.1| hypothetical protein FAEPRAM212_02511 [Faecalibacterium prausnitzii
           M21/2]
          Length = 304

 Score =  219 bits (557), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 112/301 (37%), Positives = 163/301 (54%), Gaps = 2/301 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            K+   +S++S + L+ I++VA ++K   +       L+GK +A++F K STRTR SFEV
Sbjct: 1   MKNLLKMSDLSPAELTHILDVADQLKADCKAGRTEPLLAGKSVALLFSKASTRTRTSFEV 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  +GG   +++ +E+Q GR E + DTA+VL RY D  V RT     L EL E + +PV
Sbjct: 61  GVYQMGGLGNYMNTAELQAGRGEPLRDTARVLGRYYDCAVWRTYRQRDLEELAELSGIPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD  HPCQ++AD+MT  E RG++ G    + GDG+N+ +SLI G       ++   
Sbjct: 121 INGLTDYAHPCQVLADLMTIRERRGTLAGLKLCFVGDGSNMANSLIVGGLLAGMQVSCVC 180

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQ--AVKGAHCVFTDTWISMNQEFKAREEHVFQ 242
           P G  P  + L +A   G +  L  D  +                +       +    F 
Sbjct: 181 PPGYRPAADVLMFAHKYGNAFHLTTDPAEGLRDADIVATAAWNTTAPGTAESEQRLRDFV 240

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            FQ+   L+  A PDAL +HCLPAHRGEE+   + +     +FDEAENRLH QKA+L   
Sbjct: 241 GFQLTGRLLENAKPDALVLHCLPAHRGEEISTALFEQHADEIFDEAENRLHVQKAVLAVL 300

Query: 303 F 303
            
Sbjct: 301 L 301


>gi|332703917|ref|ZP_08424005.1| Ornithine carbamoyltransferase [Desulfovibrio africanus str. Walvis
           Bay]
 gi|332554066|gb|EGJ51110.1| Ornithine carbamoyltransferase [Desulfovibrio africanus str. Walvis
           Bay]
          Length = 325

 Score =  219 bits (557), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 148/305 (48%), Positives = 202/305 (66%), Gaps = 4/305 (1%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M    KHF D+ ++  S    ++  AK++K++      ++ L+GKVL MIFEK STRTR+
Sbjct: 1   MPNKWKHFLDILDMPRSQSWALVTRAKEMKDTDHR---SQVLAGKVLVMIFEKASTRTRL 57

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFE+A++HLGGDTIF++  E QLGR+E + DTA+V+SRY   +++RT    +L EL EYA
Sbjct: 58  SFEMAVRHLGGDTIFMTPHESQLGRSEPLKDTARVISRYCAGMIVRTFGQEKLEELAEYA 117

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +VPV+NAL+D  HPCQ+++D++T  E   S K    +W GDGNN+ HS I  A  F + L
Sbjct: 118 SVPVVNALSDLHHPCQVLSDLLTMYERTPSFKDLKVAWIGDGNNMAHSWINAAIYFPFYL 177

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEH 239
           ++A P G EP    LN A   GA + + H+   A+ GAH V TD W SM QE +      
Sbjct: 178 SLAVPKGFEPDARILNKAVQLGARIHVSHEPKLAMDGAHYVNTDVWASMGQESEQGARSK 237

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  FQVN  L+ +A P+   MHCLPAHRGEE+ +EV++GP S+V+D+AENRLH QKAIL
Sbjct: 238 PFANFQVNDELLKLADPEVKVMHCLPAHRGEEITDEVMEGPASIVWDQAENRLHMQKAIL 297

Query: 300 LWCFG 304
            W FG
Sbjct: 298 EWVFG 302


>gi|197106399|ref|YP_002131776.1| ornithine carbamoyltransferase [Phenylobacterium zucineum HLK1]
 gi|196479819|gb|ACG79347.1| ornithine carbamoyltransferase [Phenylobacterium zucineum HLK1]
          Length = 312

 Score =  219 bits (557), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 156/307 (50%), Positives = 203/307 (66%), Gaps = 5/307 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNS-----SENIFENKPLSGKVLAMIFEKPSTRTR 59
           P+HF DL  +  + L  I+E AK  K +          E++P +G+ LAMIFEK STRTR
Sbjct: 6   PRHFIDLWKLDGTELRTILEDAKARKAARAGWPKGRPDEDRPAAGRTLAMIFEKNSTRTR 65

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
            SF+ AM+ LGGD I  +  +MQLGR E I DTA+VLSR VDA+++R+  H  +     +
Sbjct: 66  FSFDAAMRQLGGDVIISNAVDMQLGRGEPIEDTARVLSRMVDAVMIRSNVHEDVERFAHW 125

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ++VPVIN L+D +HPCQI+AD+MTFEEHRGSV G+ F+W GDGNN+  S I  A +  + 
Sbjct: 126 SSVPVINGLSDRSHPCQIMADLMTFEEHRGSVHGRTFAWIGDGNNVCASFIHAAPKLGFK 185

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           LNIATP    P    L  A  Q   V    D  +AV+GAHC+ TDTW+SM          
Sbjct: 186 LNIATPAIYHPDLVDLARAAEQQGHVTTTSDPREAVRGAHCIVTDTWVSMGDTDHDERFE 245

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             +P+QV+ +LM  A  DA+F+HCLPAHRGEEV + V+DGP+S+V+DEAENRLH QK+IL
Sbjct: 246 ALEPYQVDDALMDEAAEDAVFLHCLPAHRGEEVTDSVIDGPRSLVWDEAENRLHAQKSIL 305

Query: 300 LWCFGII 306
            WCFG I
Sbjct: 306 AWCFGAI 312


>gi|255324645|ref|ZP_05365762.1| ornithine carbamoyltransferase [Corynebacterium tuberculostearicum
           SK141]
 gi|255298551|gb|EET77851.1| ornithine carbamoyltransferase [Corynebacterium tuberculostearicum
           SK141]
          Length = 306

 Score =  219 bits (557), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 130/304 (42%), Positives = 192/304 (63%), Gaps = 7/304 (2%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRV 60
           M+  +HF    ++S    + ++++A+++K   ++ F  +PL G K +A++F+K STRTR+
Sbjct: 1   MSL-RHFLADDDLSPQEQATVLDLAERLK---KDPFAERPLEGPKTVAVLFDKTSTRTRL 56

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFE A+ ++GG  I +  S  Q+G+ E+  DTA VLSRYV+AIV RT +H  LL++ E A
Sbjct: 57  SFETAVANMGGKGITVDTSTTQMGKGESYQDTAAVLSRYVEAIVWRTFDHDNLLQMAETA 116

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGD-GNNILHSLIEGAARFNYL 179
           TVP++NAL+D+ HPCQI+AD++T  E+ G +KGK   + GD  NN+ +S + G A     
Sbjct: 117 TVPLVNALSDDLHPCQILADLLTCRENLGDLKGKKAVYLGDGDNNMANSYMIGFATAGMD 176

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           ++I  P G +PR E+++ AR +G           A        T T     +        
Sbjct: 177 VSIIAPEGFQPRQEFVDRARKRGNITITDDVDEVAGADVVITDTWTS-MGQENDGRDRRT 235

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F P+QV+ ++MS AH DA+F+HCLPA+RG EV  EV+DGPQS VFDEAENRLH QKA+L
Sbjct: 236 PFLPYQVDSTIMSKAHKDAIFLHCLPAYRGNEVTAEVIDGPQSRVFDEAENRLHAQKALL 295

Query: 300 LWCF 303
           +W  
Sbjct: 296 VWLL 299


>gi|254281925|ref|ZP_04956893.1| ornithine carbamoyltransferase [gamma proteobacterium NOR51-B]
 gi|219678128|gb|EED34477.1| ornithine carbamoyltransferase [gamma proteobacterium NOR51-B]
          Length = 301

 Score =  218 bits (556), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 128/303 (42%), Positives = 178/303 (58%), Gaps = 2/303 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M  P+HF  L +I++     II  A ++K        +    GKVLAMIF K STRTRVS
Sbjct: 1   MAQPRHFLTLDDINADEFRSIIARATELKRLQREGISHARYPGKVLAMIFAKASTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  +FLS ++ QLGR E + DTA+V+S  VDA+++RT  HS +      ++
Sbjct: 61  FEAGMTQLGGSAMFLSAADTQLGRGEPVEDTARVISSMVDAVMIRTFEHSTVERFARMSS 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LT++ HPCQ++AD+ T+ EHRG + G+   W GDGNN+  S I  A   ++ L 
Sbjct: 121 VPVINGLTNDFHPCQLLADMQTWFEHRGDIAGRRVCWLGDGNNMCQSYINAARLLDFELV 180

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           IA P G EP  + +     +         AV+ V         +     +E +   E   
Sbjct: 181 IACPEGYEPDADLVAKNAERVRIEHDADAAVEGVDLLVTDVWASM--GQEEEQKIREAAM 238

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
            PFQ++  L++ A  DAL++HCLPAHRGEE+  E++D P SV++DEAENRLH QKA+L +
Sbjct: 239 APFQLSRGLLARAAKDALYLHCLPAHRGEEITAELMDAPDSVIWDEAENRLHAQKALLEF 298

Query: 302 CFG 304
             G
Sbjct: 299 LLG 301


>gi|167585661|ref|ZP_02378049.1| ornithine carbamoyltransferase [Burkholderia ubonensis Bu]
          Length = 309

 Score =  218 bits (556), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 122/304 (40%), Positives = 172/304 (56%), Gaps = 3/304 (0%)

Query: 2   MTYP--KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    +H+    + S  +   ++E    +K   +N     PL  + LAMIFEK STRTR
Sbjct: 1   MTAKTIRHYLQFKDFSLEDYEYVLERTGILKRKFKNYETYHPLHDRTLAMIFEKSSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +F+S  + QLGR E + D+A+V+SR VD I++RT     +    E 
Sbjct: 61  LSFEAGIFQLGGHAVFMSTRDTQLGRGEPVEDSAQVISRMVDIIMIRTFEQEIIQRFAEN 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT+  HPCQ++ADI T+ EHRG + GK  +W GD NN+L++ I+ A    + 
Sbjct: 121 SRVPVINGLTNEFHPCQVLADIFTYYEHRGPIAGKTVAWVGDANNMLYTWIQAAQILGFK 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L ++TP G     + +         V    +              T +    E +A  + 
Sbjct: 181 LRLSTPPGYTLDMKLVAPESAPFYEVFDDPNEACKGADLVTTDVWTSMGFEAENEA-RKQ 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  + V+  +M  A+PDALFMHCLPAHRGEEV   V+DGPQSVV+DEAENRLH QKA++
Sbjct: 240 AFADWCVDEEMMGHANPDALFMHCLPAHRGEEVTAGVIDGPQSVVWDEAENRLHVQKALM 299

Query: 300 LWCF 303
            +  
Sbjct: 300 EFLL 303


>gi|149928236|ref|ZP_01916480.1| ornithine carbamoyltransferase [Limnobacter sp. MED105]
 gi|149823042|gb|EDM82283.1| ornithine carbamoyltransferase [Limnobacter sp. MED105]
          Length = 303

 Score =  218 bits (556), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 121/298 (40%), Positives = 170/298 (57%), Gaps = 2/298 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF   ++IS      +++ ++ +K   +      PL  + L MIFEK STRTR+SFE  
Sbjct: 4   KHFLQFNDISKDEFEYLMQSSRDVKARFKRYEPYYPLQDRTLVMIFEKASTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  I+L+  + QLGR E + D A+V+SR  D +++RT     +      + VPVI
Sbjct: 64  MHQLGGSAIYLNTKDSQLGRGEPVEDAAQVISRMCDIVMIRTYEQEIIERFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI TF EHRGS++GK  +W GDGNN+  + ++ A   ++ +NI+TP
Sbjct: 124 NGLTNEYHPCQILADIFTFIEHRGSIQGKTVAWVGDGNNMCATWLQAAELLDFKVNISTP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
                     N             DA +           +     +         F  FQ
Sbjct: 184 SDYNIDPAKTNIKGTHHEWFEDPMDACKGADLVTTDVWTSM--GFENENKARRRAFADFQ 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           V+  +M +A+P+ALFMHCLPAHRGEEV  EV+DGP+SVV+DEAENRLHTQKA++ +  
Sbjct: 242 VDTEMMDVANPEALFMHCLPAHRGEEVAAEVIDGPKSVVWDEAENRLHTQKALMEFLL 299


>gi|260886356|ref|ZP_05897619.1| ornithine carbamoyltransferase [Selenomonas sputigena ATCC 35185]
 gi|330838872|ref|YP_004413452.1| ornithine carbamoyltransferase [Selenomonas sputigena ATCC 35185]
 gi|260863877|gb|EEX78377.1| ornithine carbamoyltransferase [Selenomonas sputigena ATCC 35185]
 gi|329746636|gb|AEB99992.1| ornithine carbamoyltransferase [Selenomonas sputigena ATCC 35185]
          Length = 310

 Score =  218 bits (556), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 132/308 (42%), Positives = 185/308 (60%), Gaps = 6/308 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M   +    + ++S   +  I+ +A+++K   +   E++ L+GK L MIFEK STRTRVS
Sbjct: 1   MLKGRDLLSIHDLSVEEVEAILALAEELKAMQKAGIEHRVLAGKTLGMIFEKSSTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  +FLS  ++Q+GR E I DTA+VLSRY+D +++RT  H ++ E  +YA 
Sbjct: 61  FETGMFQLGGQALFLSNRDLQIGRGEPIKDTARVLSRYLDGVMIRTFEHEKVEEFAKYAD 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSV-KGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +PVINALTD  HPCQ + D++T  EH+G   KG   ++ GDGNN+ HSL+  AA+     
Sbjct: 121 IPVINALTDLLHPCQALTDLLTIREHKGKNLKGLKMAYVGDGNNMTHSLMYAAAKTGMNF 180

Query: 181 NIATPIGSEPRNEYLNWARNQGAS----VALFHDAVQAVKGAHCVFTDTWISMNQEFKA- 235
             ATP    P       A+         + L  D   A K A  + TDTW SM QE +  
Sbjct: 181 VAATPADYAPDEGVTQRAQEDAKETGASITLVTDPFAAAKDADILVTDTWASMGQEAEHE 240

Query: 236 REEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
             + +F P+Q+N  L++ A   A+ MHCLPA+RGEE+  +V++    V+FDEAENRLHTQ
Sbjct: 241 ERKKIFAPYQINGDLLAAADKRAIVMHCLPAYRGEEITEDVMEAFSDVIFDEAENRLHTQ 300

Query: 296 KAILLWCF 303
           KAIL    
Sbjct: 301 KAILALLM 308


>gi|170720294|ref|YP_001747982.1| ornithine carbamoyltransferase [Pseudomonas putida W619]
 gi|169758297|gb|ACA71613.1| ornithine carbamoyltransferase [Pseudomonas putida W619]
          Length = 306

 Score =  218 bits (556), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 144/302 (47%), Positives = 198/302 (65%), Gaps = 5/302 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M+  +HF  L + ++  L  +I    ++K+  +     +PL  +VL MIFEK STRTRVS
Sbjct: 1   MSA-RHFLSLLDFTTDELLGVIRRGIELKDLRKRGVLFEPLKNRVLGMIFEKSSTRTRVS 59

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  IFLS  + QLGR E I D+A VLS  VDA+++RT  HS L E    + 
Sbjct: 60  FEAGMIQLGGQAIFLSPRDTQLGRGEPISDSAIVLSSMVDAVMIRTHAHSTLTEFAANSR 119

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VP+IN L+D +HPCQ++AD+ TF EHRG+++GK  +W GDG N+ +S IE A +F++ L 
Sbjct: 120 VPLINGLSDESHPCQLLADMQTFHEHRGAIQGKTVAWIGDGFNMCNSYIEAARQFDFQLR 179

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHV 240
           IA P G +P   ++    ++   +    D  +AV+GAH V TD W SM QE + AR    
Sbjct: 180 IACPEGYDPDPRFMALGADRVQIIR---DPREAVRGAHLVTTDVWTSMGQEEETARRLAH 236

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F P+QVN  L+ +A PDALFMHCLPAHRGEE+ +++LD P+SV +D+AENRLH QKA+L 
Sbjct: 237 FAPYQVNRELLDLAAPDALFMHCLPAHRGEEISHDLLDDPRSVAWDQAENRLHAQKALLE 296

Query: 301 WC 302
           + 
Sbjct: 297 FL 298


>gi|212639970|ref|YP_002316490.1| ornithine carbamoyltransferase [Anoxybacillus flavithermus WK1]
 gi|259515582|sp|B7GM02|OTC_ANOFW RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|212561450|gb|ACJ34505.1| Ornithine carbamoyltransferase [Anoxybacillus flavithermus WK1]
          Length = 314

 Score =  218 bits (556), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 141/305 (46%), Positives = 196/305 (64%), Gaps = 5/305 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K F  L++ S   +  ++ +A ++K   +N     PLSGK LAMIFEKPSTRTRVSFE
Sbjct: 10  KGKDFLTLADYSKEEIEYLLHLAVELKEKQQNGERYTPLSGKTLAMIFEKPSTRTRVSFE 69

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M  LGG  + LS  ++Q+GR ETI DTA+VLS YVDAI++RT  H ++ EL  YAT+P
Sbjct: 70  VGMVQLGGHALHLSSRDLQIGRGETIADTARVLSEYVDAIMIRTFEHEKVEELAHYATIP 129

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD+ HPCQ +AD++T  E +G ++G   ++ GDGNN+ H+L+  AA+      +A
Sbjct: 130 VINGLTDDDHPCQALADLLTIYEVKGKLQGLKLAYIGDGNNMAHALMLAAAKVGMHCAVA 189

Query: 184 TPIGSEPRNEYLNWARNQGA----SVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           +P G EP+   +  A+        ++ + +D  +A+  A  V+TD W SM QE +A E  
Sbjct: 190 SPKGYEPKEAVVKEAKQIANESGATIVVTNDPYEAIADADVVYTDVWASMGQEAEANERM 249

Query: 240 V-FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F PFQVN +L+  A  D +F+HCLPAHRGEEV   V+DG +S +F +A NRLH QKA+
Sbjct: 250 HVFAPFQVNEALVQQAKQDFMFLHCLPAHRGEEVTEGVIDGVRSYIFQQAGNRLHAQKAL 309

Query: 299 LLWCF 303
           L+   
Sbjct: 310 LVSLL 314


>gi|149377079|ref|ZP_01894829.1| ornithine carbamoyltransferase [Marinobacter algicola DG893]
 gi|149358615|gb|EDM47087.1| ornithine carbamoyltransferase [Marinobacter algicola DG893]
          Length = 304

 Score =  218 bits (556), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 141/298 (47%), Positives = 196/298 (65%), Gaps = 4/298 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L+++SS  L  +++   +++N        + L  +VLAMIFEK STRTRVSFE  
Sbjct: 4   RHFLTLNDLSSDELESLVDHGTRLRNDWRRGAVRETLKNRVLAMIFEKSSTRTRVSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLS  + QLGR E I D+A V+S  VDA+++RT +H  +      + VPVI
Sbjct: 64  MTQLGGAALFLSPRDTQLGRGEPIEDSAIVISSMVDAVMIRTFSHDTVDAFAAASRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+ HPCQ++AD+ T+ EHRGS++G   +W GDGNN+  S I  A +F + L +A P
Sbjct: 124 NALTDDFHPCQLLADMQTYREHRGSIRGGTVAWIGDGNNMCQSYINAATQFGFNLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQPF 244
            G EP +E L   +     V++ HD  +A +GA  + TD W SM QE + +  +  FQ +
Sbjct: 184 EGYEPDSELL---KTHQDRVSVVHDPAEAARGADLLVTDVWASMGQEDEQKARQRAFQNY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           Q+N SLM MA  DALFMHCLPAHRGEE+  ++++ P+SVV+DEAENRLH QKA+L + 
Sbjct: 241 QINPSLMKMADKDALFMHCLPAHRGEEISADMMEHPRSVVWDEAENRLHAQKALLEFL 298


>gi|16126481|ref|NP_421045.1| ornithine carbamoyltransferase [Caulobacter crescentus CB15]
 gi|221235261|ref|YP_002517698.1| ornithine carbamoyltransferase [Caulobacter crescentus NA1000]
 gi|32699477|sp|Q9A653|OTC_CAUCR RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|13423751|gb|AAK24213.1| ornithine carbamoyltransferase, anabolic [Caulobacter crescentus
           CB15]
 gi|220964434|gb|ACL95790.1| ornithine carbamoyltransferase [Caulobacter crescentus NA1000]
          Length = 311

 Score =  218 bits (556), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 143/310 (46%), Positives = 193/310 (62%), Gaps = 5/310 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSE-----NIFENKPLSGKVLAMIFEKPST 56
           MT P+HF DL  +  + L  +++ A   K + +      +  + P   +VL+MIF+K ST
Sbjct: 1   MTQPRHFIDLWKLDGATLRLLLDDAHARKAARKGWPQGKVDADAPAKDRVLSMIFQKNST 60

Query: 57  RTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLEL 116
           RTR SF+ AM+ LGG  I  + S+MQLGR ETI DTAKVLSR VDA+++R  +H+ +   
Sbjct: 61  RTRFSFDAAMRQLGGSAIISTASDMQLGRGETIEDTAKVLSRMVDAVMIRANSHADVERF 120

Query: 117 TEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARF 176
            + +TVP+IN LTD +HPCQI+ADI+T EEHRG + GK  +W GDGNN+  S I  A   
Sbjct: 121 AQVSTVPIINGLTDKSHPCQIMADILTIEEHRGPIAGKTIAWVGDGNNVCSSFIHAAPLL 180

Query: 177 NYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR 236
            + L IA P         L  A      V++  D   AV GA  V  DTW+SM       
Sbjct: 181 GFELKIACPAVYHADLHDLARAEGLQGKVSMTTDPKAAVSGADVVVADTWVSMGDTDHDE 240

Query: 237 EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
                +P+QV+  LM +A  + +F+HCLPAHRGEEV + VLDGP+S+V+DEAENR+H QK
Sbjct: 241 RLAALEPYQVDDRLMDLAAGNGVFLHCLPAHRGEEVTDAVLDGPRSLVWDEAENRIHAQK 300

Query: 297 AILLWCFGII 306
           ++L WCFG I
Sbjct: 301 SVLAWCFGAI 310


>gi|325275186|ref|ZP_08141153.1| ornithine carbamoyltransferase [Pseudomonas sp. TJI-51]
 gi|324099673|gb|EGB97552.1| ornithine carbamoyltransferase [Pseudomonas sp. TJI-51]
          Length = 306

 Score =  218 bits (556), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 148/302 (49%), Positives = 196/302 (64%), Gaps = 5/302 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M+  +HF  L + ++  L  +I    ++K+  +     +PL  +VL MIFEK STRTRVS
Sbjct: 1   MSA-RHFLSLLDFTTDELLGVIRRGIELKDLRKRGVLFEPLKNRVLGMIFEKSSTRTRVS 59

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  IFLS  + QLGR E IGD+A VLS  +D +++RT  HS L E    + 
Sbjct: 60  FEAGMIQLGGQAIFLSPRDTQLGRGEPIGDSAIVLSSMLDVVMIRTHAHSTLTEFAANSR 119

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVINAL+D +HPCQ++AD+ TF EHRG+++GK  +W GDG N+ +S IE A +F++ L 
Sbjct: 120 VPVINALSDESHPCQLLADMQTFLEHRGTIQGKTVAWIGDGFNMCNSYIEAARQFDFQLR 179

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHV 240
           IA P G EP      +    G  V +  D  QAV GAH V TD W SM QE + AR    
Sbjct: 180 IACPEGYEP---DPRFMAIGGDHVQIVRDPKQAVSGAHLVTTDVWTSMGQEEETARRLAH 236

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F P+QV   L+ +A PDALFMHCLPAHRGEE+ +++LD P+SV +D+AENRLH QKA+L 
Sbjct: 237 FAPYQVTRELLDLAAPDALFMHCLPAHRGEEISHDLLDDPRSVAWDQAENRLHAQKALLE 296

Query: 301 WC 302
           + 
Sbjct: 297 FL 298


>gi|325295569|ref|YP_004282083.1| ornithine carbamoyltransferase [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325066017|gb|ADY74024.1| Ornithine carbamoyltransferase [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 309

 Score =  218 bits (556), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 139/303 (45%), Positives = 193/303 (63%), Gaps = 5/303 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            K F  + +     +  II ++  +K   +     +PL G   A+IFEKPSTRTRVSFEV
Sbjct: 1   MKDFISMVDADRLFIENIISLSSFLKEKQKKGELYRPLEGFTAALIFEKPSTRTRVSFEV 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG  I++     QLGR E I DTA+VLSRYV+ IV+RT    R+ EL +Y+ VPV
Sbjct: 61  GVYQLGGHGIYMDNRSSQLGRGEPIKDTARVLSRYVNLIVIRTFGQERVEELAKYSDVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALTD  HPCQ++ADI T  E++ ++KG   ++ GDGNN+ +S + GAA        AT
Sbjct: 121 INALTDEEHPCQVLADIFTIWEYKRNLKGLKVAYVGDGNNMCNSWLIGAAYTGMKFYAAT 180

Query: 185 PIGSEPRNEYLNWARNQGAS----VALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEH 239
           P G EP  EY+  A+         + + ++ ++AVK A  ++TD W SM QE +A + + 
Sbjct: 181 PKGFEPLIEYVEKAKEIAKDTGAEIVITNNPIEAVKEADIIYTDVWASMGQEDEAEKRKE 240

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           +F P+QVN  L+  A  D LFMHCLPAHRGEEV NE+++  +S+V+D+AENRLHTQKA++
Sbjct: 241 IFMPYQVNRELVKHAKSDFLFMHCLPAHRGEEVTNEIIESDRSIVWDQAENRLHTQKALI 300

Query: 300 LWC 302
           L  
Sbjct: 301 LKL 303


>gi|73542448|ref|YP_296968.1| ornithine carbamoyltransferase [Ralstonia eutropha JMP134]
 gi|123624181|sp|Q46XK9|OTC_RALEJ RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|72119861|gb|AAZ62124.1| ornithine carbamoyltransferase [Ralstonia eutropha JMP134]
          Length = 307

 Score =  218 bits (556), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 121/304 (39%), Positives = 175/304 (57%), Gaps = 2/304 (0%)

Query: 1   MMTYP-KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           M + P KH+   S+++      +++ A+ +K   +N     PL  + LAMIFEK STRTR
Sbjct: 1   MSSTPIKHYLQFSDLTPDEYEYLLDRARILKAKFKNYETWHPLHDRTLAMIFEKNSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +FL+  + QLGR E I D A+V+SR VD I++RT     +     +
Sbjct: 61  LSFEAGIHQLGGHAVFLNTRDSQLGRGEPIEDAAQVISRMVDIIMIRTFGQDIIERFAAH 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT+  HPCQ++AD+ T+ E RGS++GK  +W GD NN+ ++ I+ A R  + 
Sbjct: 121 SRVPVINGLTNEYHPCQVLADVFTYIEQRGSIRGKTVAWIGDANNMAYTWIQAAERLGFT 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
            + + P G +     +  +      V     A             T +    E +A  + 
Sbjct: 181 FHFSAPPGYQLDPALVPASAAGQLKVFEDPLAACKGASLVTTDVWTSMGFEAENEA-RKR 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            FQ + V  ++M  A PDALFMHCLPAHRGEEV   V+DGP+SVV+DEAENRLH QKA++
Sbjct: 240 AFQNWMVTTAMMDRAEPDALFMHCLPAHRGEEVEAAVIDGPKSVVWDEAENRLHVQKALM 299

Query: 300 LWCF 303
            +  
Sbjct: 300 EYLL 303


>gi|294650301|ref|ZP_06727669.1| ornithine carbamoyltransferase [Acinetobacter haemolyticus ATCC
           19194]
 gi|292823831|gb|EFF82666.1| ornithine carbamoyltransferase [Acinetobacter haemolyticus ATCC
           19194]
          Length = 306

 Score =  218 bits (556), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 132/298 (44%), Positives = 182/298 (61%), Gaps = 2/298 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++SS  L  I++ A+++K    +    +P +GKVL MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLRDLSSLELQRILDRAQELKRMQHSNTLYQPFAGKVLGMIFEKSSTRTRISFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +   GG  IFLS  + QLGR E I D+A+V+S  +D +++RT  H  +     Y+ VPVI
Sbjct: 64  ICQFGGSAIFLSPRDTQLGRGEPIEDSARVISSMLDIVMIRTFGHDIVERFASYSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ++AD+ TF+EHRGS++GK  +W GDGNN+ +S +E A    + L IA+P
Sbjct: 124 NGLTDDHHPCQLLADLQTFQEHRGSIEGKTVAWIGDGNNMCNSYVEAAHMMGFKLKIASP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G EP+ E+L    +         DA             +     +E +   E  F  FQ
Sbjct: 184 EGYEPKPEFLAEFADCVEVFNKAEDAAVNADLIVTDVWASM--GQEEEQKLREKAFADFQ 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN  LM +AHPD LFMHCLPAHRGEE+   +LD   +VV+DEAENRLH QKA++ +  
Sbjct: 242 VNEQLMDLAHPDCLFMHCLPAHRGEEISENMLDHKNAVVWDEAENRLHAQKALMEFLL 299


>gi|329893653|ref|ZP_08269787.1| Ornithine carbamoyltransferase [gamma proteobacterium IMCC3088]
 gi|328923580|gb|EGG30892.1| Ornithine carbamoyltransferase [gamma proteobacterium IMCC3088]
          Length = 303

 Score =  218 bits (556), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 129/302 (42%), Positives = 187/302 (61%), Gaps = 2/302 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT  +HF  L+++SSS L  +I+ A ++K       ++       +AMIFEK STRTRVS
Sbjct: 1   MTTTRHFLRLTDLSSSELKTLIQRAIELKAMQRKGEQHALFPNATMAMIFEKASTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M   GG  +FLS ++ QLGR E I DTAKV+SR VD +++RT+ H RL    + + 
Sbjct: 61  FEAGMAQFGGHALFLSPNDTQLGRGEPIEDTAKVISRMVDIVMIRTSAHERLEVFAQNSR 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVINAL+D +HPCQ++AD+MT+ EHRG ++GK  SW GDGNN+ HS I  A  F + LN
Sbjct: 121 VPVINALSDESHPCQLLADMMTWFEHRGDMQGKTASWIGDGNNMCHSFIRAAHLFGFHLN 180

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           IA P G +P    L+   +         +A +           +     ++        F
Sbjct: 181 IACPEGYDPDQALLDEYAHCVTLTRDPANAARGSDLLATDVWASM--GQEQEAKARMAAF 238

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           + F++N  L+++A+PDA+++HCLPAHRGEE+  +++D P SV++DEAENRLH QKA++ +
Sbjct: 239 EGFELNRELLNLANPDAIYLHCLPAHRGEEISADLMDDPSSVIWDEAENRLHAQKALIEF 298

Query: 302 CF 303
             
Sbjct: 299 LL 300


>gi|289208130|ref|YP_003460196.1| ornithine carbamoyltransferase [Thioalkalivibrio sp. K90mix]
 gi|288943761|gb|ADC71460.1| ornithine carbamoyltransferase [Thioalkalivibrio sp. K90mix]
          Length = 304

 Score =  218 bits (556), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 128/301 (42%), Positives = 181/301 (60%), Gaps = 3/301 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-PLSGKVLAMIFEKPSTRTRVSF 62
            P+H+    ++S+     ++E A ++K  +     +   L GK L MIFEK STRTRVSF
Sbjct: 2   KPRHYLSFHDLSADETRALLERAVELKRQTHAGEHHDDILRGKTLGMIFEKSSTRTRVSF 61

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           EV M+ LGG+ +FLS  + QLGR E I DTA+VLSR VD +++RT  H ++    ++++V
Sbjct: 62  EVGMQQLGGNALFLSPRDTQLGRGEPIEDTARVLSRMVDCVMIRTYEHEKIELFAQHSSV 121

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVIN LTD  HP Q++AD+ T+ EHRG ++GK  +W GDGNN+ HS +  A   ++ L  
Sbjct: 122 PVINGLTDREHPAQLLADLQTYLEHRGDIRGKRVAWIGDGNNMCHSYMYAAHLLDFQLVA 181

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQ 242
           A P G +P  + +   R+          A +           +     ++ K+     F 
Sbjct: 182 ACPEGYDPEEDVVGATRDHFELTRDARAAAEGADLVVTDVWASM--GQEQEKSARRRAFA 239

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            F V+  LM +A+ DALFMHCLPAHR EEV  EVL+GPQSVV+DEAENRLH QKA++ + 
Sbjct: 240 GFFVDADLMRLANDDALFMHCLPAHREEEVSTEVLEGPQSVVWDEAENRLHAQKALMEFL 299

Query: 303 F 303
            
Sbjct: 300 L 300


>gi|226954092|ref|ZP_03824556.1| ornithine carbamoyltransferase [Acinetobacter sp. ATCC 27244]
 gi|226835133|gb|EEH67516.1| ornithine carbamoyltransferase [Acinetobacter sp. ATCC 27244]
          Length = 310

 Score =  218 bits (556), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 132/298 (44%), Positives = 182/298 (61%), Gaps = 2/298 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++SS  L  I++ A+++K    +    +P +GKVL MIFEK STRTR+SFE  
Sbjct: 8   RHFLTLRDLSSLELQRILDRAQELKRMQHSNTLYQPFAGKVLGMIFEKSSTRTRISFEAG 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +   GG  IFLS  + QLGR E I D+A+V+S  +D +++RT  H  +     Y+ VPVI
Sbjct: 68  ICQFGGSAIFLSPRDTQLGRGEPIEDSARVISSMLDIVMIRTFGHDIVERFASYSKVPVI 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ++AD+ TF+EHRGS++GK  +W GDGNN+ +S +E A    + L IA+P
Sbjct: 128 NGLTDDHHPCQLLADLQTFQEHRGSIEGKTVAWIGDGNNMCNSYVEAAHMMGFKLKIASP 187

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G EP+ E+L    +         DA             +     +E +   E  F  FQ
Sbjct: 188 EGYEPKPEFLAEFADCVEVFNKAEDAAVNADLIVTDVWASM--GQEEEQKLREKAFADFQ 245

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN  LM +AHPD LFMHCLPAHRGEE+   +LD   +VV+DEAENRLH QKA++ +  
Sbjct: 246 VNEQLMDLAHPDCLFMHCLPAHRGEEISENMLDHKNAVVWDEAENRLHAQKALMEFLL 303


>gi|225175993|ref|ZP_03729985.1| ornithine carbamoyltransferase [Dethiobacter alkaliphilus AHT 1]
 gi|225168581|gb|EEG77383.1| ornithine carbamoyltransferase [Dethiobacter alkaliphilus AHT 1]
          Length = 309

 Score =  218 bits (555), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 132/303 (43%), Positives = 193/303 (63%), Gaps = 5/303 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F  +++     L+ I++ A ++K   +   E+  L GK L MIF+K STRTRVSFEV 
Sbjct: 7   RDFLAVNDFFREELAEILDFAIQLKAQHKEGKEHHLLRGKTLGMIFQKASTRTRVSFEVG 66

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLS +++Q+GR E I DTA+VLSRY+D I++RT +H  + +L  +A +PVI
Sbjct: 67  MYQLGGTALFLSANDLQIGRGEPIKDTARVLSRYLDGIMIRTFDHGEVEQLASFADIPVI 126

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQ +AD+MT  E +GS+K    ++ GDGNN+ +SL+   ++F   + +A+P
Sbjct: 127 NGLTDLLHPCQAMADLMTVMERKGSLKKLKLAYVGDGNNVANSLLLACSKFGMNVAVASP 186

Query: 186 IGSEPRNEYLNWARNQGAS----VALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHV 240
            G E   + +  A+         V L  +  +AVK A  V+TD W SM QE +      +
Sbjct: 187 KGYECPKDIVAAAQTNAKIGGTTVTLTDNPQEAVKNADVVYTDVWASMGQEDEHISRIRI 246

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+P+QVN  L+ +A+ +A+ +HCLPAHRGEE+   V++G QS VFD+AENRLH QKAI+ 
Sbjct: 247 FKPYQVNDELLKVANDEAMVLHCLPAHRGEEITESVMEGEQSAVFDQAENRLHVQKAIMA 306

Query: 301 WCF 303
              
Sbjct: 307 KVM 309


>gi|295104526|emb|CBL02070.1| ornithine carbamoyltransferase [Faecalibacterium prausnitzii SL3/3]
          Length = 304

 Score =  218 bits (555), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 111/301 (36%), Positives = 163/301 (54%), Gaps = 2/301 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            K+   +S++S + L+ I++VA ++K   +       L+GK +A++F K STRTR SFEV
Sbjct: 1   MKNLLKMSDLSPAELTHILDVADQLKADCKAGRTEPLLAGKSVALLFSKASTRTRTSFEV 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  +GG   +++ +E+Q GR E + DTA+VL RY D  V RT     L EL E + +PV
Sbjct: 61  GVYQMGGLGNYMNTAELQAGRGEPLRDTARVLGRYYDCAVWRTYRQRDLEELAELSGIPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD  HPCQ++AD+MT  E RG++ G    + GDG+N+ +SLI G       ++   
Sbjct: 121 INGLTDYAHPCQVLADLMTIRERRGTLAGLKLCFVGDGSNMANSLIVGGLLAGMQVSCVC 180

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQ--AVKGAHCVFTDTWISMNQEFKAREEHVFQ 242
           P G  P  + L +A   G +  L  D  +                +       +    F 
Sbjct: 181 PPGYRPAADVLMFAHKYGNAFHLTTDPAEGLRDADIVATAAWNTTAPGTAESEQRLRDFV 240

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            FQ+   L+  A P+AL +HCLPAHRGEE+   + +     +FDEAENRLH QKA+L   
Sbjct: 241 GFQLTGRLLENAKPNALVLHCLPAHRGEEISTALFEQHADEIFDEAENRLHVQKAVLAVL 300

Query: 303 F 303
            
Sbjct: 301 L 301


>gi|238028454|ref|YP_002912685.1| ornithine carbamoyltransferase [Burkholderia glumae BGR1]
 gi|237877648|gb|ACR29981.1| Ornithine carbamoyltransferase [Burkholderia glumae BGR1]
          Length = 309

 Score =  218 bits (555), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 121/308 (39%), Positives = 175/308 (56%), Gaps = 4/308 (1%)

Query: 2   MTYP--KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    +H+    + S  +   ++E    +K   ++     PL  + LAMIFEK STRTR
Sbjct: 1   MTAKTIRHYLQFKDFSLEDYEYVLERTGILKRKFKSYETYHPLHDRTLAMIFEKNSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +F+S  + QLGR E + D+A+V+SR VD I++RT     +    + 
Sbjct: 61  LSFEAGIFQLGGHAVFMSTRDTQLGRGEPVEDSAQVISRMVDIIMIRTFEQEIIQRFADN 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT+  HPCQ++ADI T+ EHRG ++GK  +W GD NN+L++ I+ A    + 
Sbjct: 121 SRVPVINGLTNEFHPCQVLADIFTYYEHRGPIRGKTVAWVGDANNMLYTWIQAAQILGFK 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L ++TP G       ++ A      V    +              T +    E +   + 
Sbjct: 181 LRLSTPPGYALDMALVDAASASAYEVVEDPNEACRGADLVTTDVWTSMGFEAENEV-RKQ 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  + V+  +M+ A+PDALFMHCLPAHRGEEV   V+DGPQSVV+DEAENRLH QKA++
Sbjct: 240 AFADWCVDEEMMAGANPDALFMHCLPAHRGEEVSAGVIDGPQSVVWDEAENRLHVQKALM 299

Query: 300 L-WCFGII 306
                G +
Sbjct: 300 EFLLLGKL 307


>gi|158313577|ref|YP_001506085.1| ornithine carbamoyltransferase [Frankia sp. EAN1pec]
 gi|254772726|sp|A8LE44|OTC_FRASN RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|158108982|gb|ABW11179.1| ornithine carbamoyltransferase [Frankia sp. EAN1pec]
          Length = 317

 Score =  218 bits (555), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 141/308 (45%), Positives = 201/308 (65%), Gaps = 7/308 (2%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFE-NKPLSGKVLAMIFEKPSTRTRV 60
           MT  +HF   ++++SS  + ++++A ++K +  +     +PL G+ +A+IFEKPSTRTR+
Sbjct: 1   MTA-RHFLLDTDLTSSEQAALLDLADQLKATRRDRKPARRPLEGRSVALIFEKPSTRTRL 59

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF+VA+  LGG  I +     QLGR ETI DTA VLSRYVDAIV+RT    R+  +   A
Sbjct: 60  SFDVAVAELGGHPIVIDSGSSQLGRGETIEDTAAVLSRYVDAIVIRTFAQDRVDRMAAAA 119

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVINAL+D+THPCQ +AD+ T  E RG + G   ++ GDGNN+ HSL+   A     +
Sbjct: 120 TVPVINALSDHTHPCQALADLQTIREIRGRLAGVTLAYLGDGNNVAHSLLLAGALAGLRV 179

Query: 181 NIATPIGSEPRNEYLNWARNQGASVA----LFHDAVQAVKGAHCVFTDTWISMNQEFKAR 236
           ++A+P G EP  + +  A   GA       + HDA++A  GA  ++TD W SM Q+ ++ 
Sbjct: 180 HVASPPGYEPIEQVVRHANEIGAVTGGEALVTHDALEAAAGADVLYTDVWASMGQDTESD 239

Query: 237 -EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
               VFQP++++  ++  A PDA+ MHCLPAHR  E+   VLDGP+SVVFD+AENRLH Q
Sbjct: 240 SRALVFQPYRLDEKVVEAASPDAIVMHCLPAHREMEISAAVLDGPRSVVFDQAENRLHAQ 299

Query: 296 KAILLWCF 303
           KA+L +  
Sbjct: 300 KALLSFLL 307


>gi|56695865|ref|YP_166216.1| ornithine carbamoyltransferase [Ruegeria pomeroyi DSS-3]
 gi|81350432|sp|Q5LUT9|OTC_SILPO RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|56677602|gb|AAV94268.1| ornithine carbamoyltransferase [Ruegeria pomeroyi DSS-3]
          Length = 308

 Score =  218 bits (555), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 156/307 (50%), Positives = 212/307 (69%), Gaps = 7/307 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNS-----SENIFENKPLSGKVLAMIFEKPSTRTR 59
             HF D+    +++L  +I+ A  +K +          + +PL  +++A+IFEKPSTRTR
Sbjct: 1   MNHFLDIHKTDAADLRAMIDQAGAMKQARLGRPKAAPDDEQPLKDRMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V ++ +GG T+ LSG++MQLG  ETI DTA+VLSRYVD I++RT + S L E+ EY
Sbjct: 61  VSFDVGVRQMGGQTMVLSGNDMQLGHGETIADTARVLSRYVDMIMIRTFDESVLAEMAEY 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           A VPVIN LTD +HPCQI+AD++T+EEHRG + GK   W+GDGNN+  S +  A +F + 
Sbjct: 121 ADVPVINGLTDRSHPCQIMADVLTYEEHRGPIAGKKVVWTGDGNNVCSSFLHAAGQFGFD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L  + P   +P  EY+ +AR +G+ + +  DAV+AV+GA  V  DTW+SM+    A+E  
Sbjct: 181 LTFSGPAQFDPEEEYMGFARQKGSKIVIERDAVKAVEGADLVVADTWVSMHDAQSAKERR 240

Query: 240 VF--QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
               +P+QVN  LM  A PDALFMHCLPAHR EE  +EV+DGP SV+FDEAENRLH QKA
Sbjct: 241 HNLLRPYQVNAELMRHAKPDALFMHCLPAHREEEATSEVMDGPHSVIFDEAENRLHAQKA 300

Query: 298 ILLWCFG 304
           I+ WC G
Sbjct: 301 IMRWCLG 307


>gi|226943522|ref|YP_002798595.1| ornithine carbamoyltransferase [Azotobacter vinelandii DJ]
 gi|226718449|gb|ACO77620.1| Ornithine carbamoyltransferase [Azotobacter vinelandii DJ]
          Length = 308

 Score =  218 bits (555), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 137/303 (45%), Positives = 195/303 (64%), Gaps = 4/303 (1%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           MM   +HF  L + +   L+ +I    ++K+        +PL  +VL MIFEK STRTR+
Sbjct: 1   MMMSARHFLSLMDCTPQELANLIRRGIELKDLRNGGALFEPLKNRVLGMIFEKASTRTRL 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFE  M  LGG  IFLS  + QL R E + DTA V+SR +DA+++RT +HS L    E +
Sbjct: 61  SFEAGMIQLGGQAIFLSPRDSQLNRGEPVSDTAIVMSRMLDAVMIRTFSHSTLRIFAENS 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
            +P+IN L+D+ HPCQ++AD+ TF E RGS++GK  +W GDGNN+ ++ IE A +F++ L
Sbjct: 121 RIPIINGLSDDLHPCQLLADMQTFHEQRGSIRGKTVAWIGDGNNMCNTYIEAAHQFDFQL 180

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREEH 239
            IA P G +P+ E++  A ++   V    D  +AV GAH V TD W SM  +  +     
Sbjct: 181 RIACPEGFDPQPEFIAIAPDRVQIVR---DPREAVAGAHLVSTDVWTSMGQETEEEDRLA 237

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+P+QV   L+ ++  D LFMHCLPAHRGEE+  ++LD P+SVV+D+AENRLH QKA+L
Sbjct: 238 RFKPYQVTGELLDLSADDVLFMHCLPAHRGEEISLDLLDDPRSVVWDQAENRLHAQKALL 297

Query: 300 LWC 302
            + 
Sbjct: 298 EFL 300


>gi|294464888|gb|ADE77949.1| unknown [Picea sitchensis]
          Length = 384

 Score =  218 bits (554), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 131/301 (43%), Positives = 187/301 (62%), Gaps = 3/301 (0%)

Query: 8   FADLSNISSSNLSCIIEVAKKIKNSSENIFEN-KPLSGKVLAMIFEKPSTRTRVSFEVAM 66
           F  +++     +  I++ A ++K+  ++   + +P  GK +AMIF KPS RTRVSFE   
Sbjct: 84  FLHINDFDKDTILHILQRAAEVKSLIKSGDRSFQPFRGKSMAMIFAKPSMRTRVSFETGF 143

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
             LGG  I+L   ++Q+G+ E   D A+VLS Y D I+ R  +H  +L+L +Y +VPVIN
Sbjct: 144 FLLGGHAIYLGPDDIQMGKREETRDVARVLSSYNDLIMARVFSHQDILDLAKYGSVPVIN 203

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI 186
            L+D  HPCQI+AD +T  EH G ++G    + GDGNNI+HS +  AA   +    A P 
Sbjct: 204 GLSDYNHPCQIMADALTIIEHLGGLEGVKVVYVGDGNNIVHSWLLLAAVVPFHFVCACPK 263

Query: 187 GSEPRNEYLNWARNQ-GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHVFQPF 244
           G EP    +  ARN   + + + +D  +AV+GA+ V+TD W SM Q+ +A      F+ F
Sbjct: 264 GFEPDRATVEKARNAGISKIEITNDPAEAVRGANIVYTDVWASMGQKDQASYRIERFKGF 323

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           QVN SLM++A P ALFMHCLPA RG EV + V++ P SVVF +AENR+H Q AI+L   G
Sbjct: 324 QVNESLMALASPKALFMHCLPAERGIEVTDGVIEAPNSVVFPQAENRMHAQNAIMLHALG 383

Query: 305 I 305
           +
Sbjct: 384 L 384


>gi|77919214|ref|YP_357029.1| aspartate carbamoyltransferase [Pelobacter carbinolicus DSM 2380]
 gi|123574145|sp|Q3A448|PYRB_PELCD RecName: Full=Aspartate carbamoyltransferase; AltName:
           Full=Aspartate transcarbamylase; Short=ATCase
 gi|77545297|gb|ABA88859.1| aspartate carbamoyltransferase [Pelobacter carbinolicus DSM 2380]
          Length = 313

 Score =  218 bits (554), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 83/309 (26%), Positives = 137/309 (44%), Gaps = 11/309 (3%)

Query: 2   MTYP-KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKP-LSGKVLAMIFEKPSTRTR 59
           M +  KH   +  +S+ +++ I++ A+  K+ S    +  P L GK +  +F + STRTR
Sbjct: 1   MAFNHKHILGIEQMSAEDITLILDTAESFKDVSLRSIKKVPTLRGKTVINVFFEASTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRY-VDAIVMRTTNHSRLLELTE 118
            SFE+A K L  DT+ +S S   + + ET+ DTAK L     D IVMR +       L E
Sbjct: 61  TSFEIAGKRLSADTVNISASTSAVVKGETLEDTAKNLEAMKPDIIVMRHSCSGAPHYLAE 120

Query: 119 YATVPVINA-LTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGD--GNNILHSLIEGAAR 175
                VINA    + HP Q + D++T  + +G ++G   +  GD   + +  S +    +
Sbjct: 121 RCDFSVINAGDGAHEHPSQALLDLLTIRQKKGHIEGLTVAIIGDITHSRVARSNVYALNK 180

Query: 176 FNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA 235
               + +  P    P       A+          D   +      +         +    
Sbjct: 181 LGAEVRLCGPGTMLPPGIERLGAQVFDRI-----DDAVSGADVVMMLRIQQERQGKTMLP 235

Query: 236 REEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
                   + +    M +A PDA+ MH  P +RG E+ + V DGPQ+V+ D+ EN +  +
Sbjct: 236 SLREYSMFYGLTPDRMKLAKPDAIVMHPGPMNRGVEISSAVADGPQNVILDQVENGVAVR 295

Query: 296 KAILLWCFG 304
            A+L    G
Sbjct: 296 MALLYLVSG 304


>gi|161523923|ref|YP_001578935.1| ornithine carbamoyltransferase [Burkholderia multivorans ATCC
           17616]
 gi|189351316|ref|YP_001946944.1| ornithine carbamoyltransferase [Burkholderia multivorans ATCC
           17616]
 gi|160341352|gb|ABX14438.1| ornithine carbamoyltransferase [Burkholderia multivorans ATCC
           17616]
 gi|189335338|dbj|BAG44408.1| ornithine carbamoyltransferase [Burkholderia multivorans ATCC
           17616]
          Length = 309

 Score =  218 bits (554), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 122/304 (40%), Positives = 172/304 (56%), Gaps = 3/304 (0%)

Query: 2   MTYP--KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    +H+    + S  +   ++E    +K   +N     PL  + LAMIFEK STRTR
Sbjct: 1   MTAKTIRHYLQFKDFSLEDYEYVLERTGILKRKFKNYETYHPLHDRTLAMIFEKSSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +F+S  + QLGR E + D+A+V+SR VD I++RT     +    E 
Sbjct: 61  LSFEAGIFQLGGHAVFMSTRDTQLGRGEPVEDSAQVISRMVDIIMIRTFEQDIIQRFAEN 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT+  HPCQ++ADI T+ EHRG + GK  +W GD NN+L++ I+ A    + 
Sbjct: 121 SRVPVINGLTNEYHPCQVLADIFTYYEHRGPIAGKTVAWVGDANNMLYTWIQAAQILGFK 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L ++TP G     + ++        V    +              T +    E +A    
Sbjct: 181 LRLSTPPGYALDMKLVSPDSAPFYEVFDDPNEACKGADLVTTDVWTSMGFEAENEA-RMK 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  + V+  +M  A+PDALFMHCLPAHRGEEV   V+DGPQSVV+DEAENRLH QKA++
Sbjct: 240 AFADWCVDEEMMGHANPDALFMHCLPAHRGEEVTAGVIDGPQSVVWDEAENRLHVQKALM 299

Query: 300 LWCF 303
            +  
Sbjct: 300 EFLL 303


>gi|134298154|ref|YP_001111650.1| ornithine carbamoyltransferase [Desulfotomaculum reducens MI-1]
 gi|134050854|gb|ABO48825.1| ornithine carbamoyltransferase [Desulfotomaculum reducens MI-1]
          Length = 315

 Score =  218 bits (554), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 127/304 (41%), Positives = 181/304 (59%), Gaps = 5/304 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             +    L + +   +  I++ A++IK   +    +  L GK L MIF+K STRTRVSFE
Sbjct: 9   KGRDLLTLHDYTVDEVKLILQEAQRIKAMQKAGIPHPYLQGKTLGMIFQKSSTRTRVSFE 68

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M  LGG  +FLS  ++Q+GR E++ DTA+VLSR +D I++RT     + EL EYA +P
Sbjct: 69  VGMYQLGGYALFLSPKDIQMGRGESVADTARVLSRMLDGIMIRTFAQEEVEELAEYADIP 128

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD THPCQI+AD +T +EH+G + G   ++ GDGNNI HSL+ G A+    + +A
Sbjct: 129 VINGLTDRTHPCQILADFLTIQEHKGQLAGLKLAYVGDGNNIAHSLLYGCAKVGMDICVA 188

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN-----QEFKAREE 238
           +P G +P  + ++ A+    +     + V     A          +      +  +   E
Sbjct: 189 SPEGYQPDAQIVSQAKEDARTTGAKVEVVSDPVVAMQAADVVITDVWASMGQEAEQRERE 248

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F  +QVN  L + A PD +F+HCLPAHRGEEV  E++DGP SVV+DEAENRLH QKA+
Sbjct: 249 RAFAGYQVNSDLCAHAKPDFIFLHCLPAHRGEEVTAEIIDGPHSVVWDEAENRLHAQKAV 308

Query: 299 LLWC 302
           +   
Sbjct: 309 MALL 312


>gi|84499549|ref|ZP_00997837.1| ornithine carbamoyltransferase [Oceanicola batsensis HTCC2597]
 gi|84392693|gb|EAQ04904.1| ornithine carbamoyltransferase [Oceanicola batsensis HTCC2597]
          Length = 308

 Score =  218 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 154/308 (50%), Positives = 210/308 (68%), Gaps = 7/308 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSE-----NIFENKPLSGKVLAMIFEKPSTRTR 59
             HF D+     + L  +I+ A+ +K +          + +PL+G+++A+IFEKPSTRTR
Sbjct: 1   MNHFLDIHTTERAALRQMIDQARSMKEARAGRSRGAPDDEQPLAGRMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V ++ +GG T+ LSG +MQLG  ETI DTA+VLSRYVD I++RT + + L E+ +Y
Sbjct: 61  VSFDVGVRQMGGQTMVLSGQDMQLGHGETIADTARVLSRYVDLIMLRTFDEAVLQEMADY 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           A+VPVIN LTD THPCQI+AD+MT+EEHRGS+ GK  +W GDGNN+  S +  A +F + 
Sbjct: 121 ASVPVINGLTDRTHPCQIMADVMTYEEHRGSIAGKNVTWLGDGNNVFASFLHAATQFGFN 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L    P   +P  E+L+ AR  G +V +  D  + V GA  V  DTW+SM+    +RE  
Sbjct: 181 LTFCGPQQLDPDREFLDQARAAGTNVRIERDPWKGVDGADLVVADTWVSMHDAQSSRERR 240

Query: 240 VF--QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
               + +QVN  LM+ A P+ALFMHCLPAHR EEV + V+DGPQSV+FDEAENRLH QKA
Sbjct: 241 HNLLRAYQVNDRLMAAASPEALFMHCLPAHREEEVTSSVMDGPQSVIFDEAENRLHAQKA 300

Query: 298 ILLWCFGI 305
           ++ WC G+
Sbjct: 301 VMRWCLGV 308


>gi|311740488|ref|ZP_07714315.1| ornithine carbamoyltransferase [Corynebacterium pseudogenitalium
           ATCC 33035]
 gi|311304008|gb|EFQ80084.1| ornithine carbamoyltransferase [Corynebacterium pseudogenitalium
           ATCC 33035]
          Length = 306

 Score =  218 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 141/305 (46%), Positives = 202/305 (66%), Gaps = 9/305 (2%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRV 60
           M+  +HF    ++S    + ++++A+++K   ++ F  +PL G K +A++F+K STRTR 
Sbjct: 1   MSL-RHFLADDDLSPQEQATVLDLAERLK---KDPFAERPLEGPKTVAVLFDKTSTRTRF 56

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFE A+ ++GG  I +  S  Q+G+ E+  DTA VLSRYV+AIV RT +H  LL++ E A
Sbjct: 57  SFETAVANMGGKGITVDTSTTQMGKGESYQDTAAVLSRYVEAIVWRTFDHDNLLQMAETA 116

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGD-GNNILHSLIEGAARFNYL 179
           TVP++NAL+D+ HPCQI+AD++T  E+ G + GK   + GD  NN+ +S + G A     
Sbjct: 117 TVPLVNALSDDLHPCQILADLLTCRENLGELTGKKAVYLGDGDNNMANSYMIGFATAGMD 176

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREE 238
           ++I  P G +PR E+++ AR +G       D V  V+GA  V TDTWISM QE       
Sbjct: 177 VSIIAPEGFQPRQEFVDRARKRGNITIT--DDVDEVEGADVVITDTWISMGQENDGRDRR 234

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F P+QV+ ++MS AH DA+F+HCLPA+RG EV  EV+DGPQS VFDEAENRLH QKA+
Sbjct: 235 TPFLPYQVDSTIMSKAHKDAIFLHCLPAYRGNEVTAEVIDGPQSRVFDEAENRLHAQKAL 294

Query: 299 LLWCF 303
           L+W  
Sbjct: 295 LVWLL 299


>gi|167462073|ref|ZP_02327162.1| ornithine carbamoyltransferase [Paenibacillus larvae subsp. larvae
           BRL-230010]
 gi|322383017|ref|ZP_08056847.1| ornithine carbamoyltransferase-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
 gi|321153040|gb|EFX45500.1| ornithine carbamoyltransferase-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
          Length = 319

 Score =  218 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 137/306 (44%), Positives = 190/306 (62%), Gaps = 5/306 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             + F  LS+ S   L  ++ +AK +K   ++   ++ L GK L MIFEK STRTRVSFE
Sbjct: 14  KGRDFLSLSDYSPEELHYLLHLAKDLKQKQKSGIPHQKLLGKSLGMIFEKSSTRTRVSFE 73

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M  LGG  +FLS +++QLGR ETI DTA+ LSRY+D I++RT  HS++++L   AT+P
Sbjct: 74  VGMFQLGGQALFLSKNDIQLGRGETIHDTAQTLSRYIDGIMIRTFEHSKVIDLARGATIP 133

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD++HPCQ + D MT  EH+G + G   ++ GDGNN++HSL+ GAA+F+    +A
Sbjct: 134 VINGLTDSSHPCQALTDYMTVLEHKGKLAGLKIAYIGDGNNMVHSLLIGAAKFSMQAAVA 193

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN-----QEFKAREE 238
           +P G  P  + +  A+   +         Q  K A       +  +      +E +A  E
Sbjct: 194 SPEGYMPDKQVIQTAKEVASQTGGSILITQEPKEAIAEADIVYTDVWASMGFEEEQAARE 253

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F  +QVN  L+  A PD LFMHCLPAHRGEEV  E++DG  S+VFD+AE RLH QKA+
Sbjct: 254 RAFVNYQVNEELVQFAKPDYLFMHCLPAHRGEEVSAEIIDGKHSIVFDQAEKRLHAQKAV 313

Query: 299 LLWCFG 304
           +L   G
Sbjct: 314 MLALMG 319


>gi|307152635|ref|YP_003888019.1| ornithine carbamoyltransferase [Cyanothece sp. PCC 7822]
 gi|306982863|gb|ADN14744.1| ornithine carbamoyltransferase [Cyanothece sp. PCC 7822]
          Length = 309

 Score =  218 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 132/305 (43%), Positives = 196/305 (64%), Gaps = 10/305 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    ++++S+  +S ++++A+ +K       E KP+  K+L ++F K STRTRVSF  A
Sbjct: 9   KDILSIADLSTKEISALLQLARDLKKG-----EKKPICQKILGLLFYKASTRTRVSFTTA 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  I L+ S  Q+GR E I DTA+VL+RY+D + +RT     L     YA +P+I
Sbjct: 64  MYQLGGQVIDLNPSVTQVGRGEPISDTARVLARYLDILAIRTFKQEDLQTFAHYADIPII 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NAL+D  HPCQI+AD++T +E  G+++G   S+ GDGNN+ HS++ G A     + IATP
Sbjct: 124 NALSDLEHPCQILADLLTIQECFGTLEGITLSYFGDGNNVAHSILLGGALMGMKVCIATP 183

Query: 186 IGSEPRNEYLNWAR----NQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHV 240
              +P +  +  A+    + G  + L  D V+A KG+H ++TD W SM QE  A     V
Sbjct: 184 DDYKPDSGVVEQAQALAASHGGEIFLTKDPVEAAKGSHVLYTDVWASMGQEASADARIPV 243

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           FQP+Q+N  L+S A  +A+ +HCLPAHRGEE+ +EV++G QS V+D+AENR+H QKA+++
Sbjct: 244 FQPYQLNEKLLSYADKEAIVLHCLPAHRGEEITSEVIEGKQSRVWDQAENRMHAQKALMV 303

Query: 301 WCFGI 305
              GI
Sbjct: 304 SVLGI 308


>gi|312136279|ref|YP_004003616.1| ornithine carbamoyltransferase [Methanothermus fervidus DSM 2088]
 gi|311223998|gb|ADP76854.1| ornithine carbamoyltransferase [Methanothermus fervidus DSM 2088]
          Length = 302

 Score =  218 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 151/304 (49%), Positives = 205/304 (67%), Gaps = 10/304 (3%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH   + +I    +  +I++A+K KN      + K L  KVLAMIFEKPSTRTRVSFEV
Sbjct: 1   MKHVLSVCDI-KDEVEELIDIAEKFKNGK---IKEKVLKDKVLAMIFEKPSTRTRVSFEV 56

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           A+  LGG+ ++L  SE+QLGR E I DTAKV+SRYVD I++R   H  ++EL +++T+PV
Sbjct: 57  AVLQLGGNALYLPSSELQLGRGELIADTAKVMSRYVDGIMIRANRHKDVIELAKHSTIPV 116

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD  HPCQ +AD+ T +E++G       ++ GDGNN+ +SLI  ++     +++A+
Sbjct: 117 INGLTDEEHPCQALADMQTIKEYKGGF-NIKLAFVGDGNNVCNSLILISSILGIDISVAS 175

Query: 185 PIGSEPRNEYLNWA----RNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEH 239
           P G EP N+ +N A    +  GA + +  DA++AVKGA  V+TD WISM QE +      
Sbjct: 176 PKGYEPSNKIVNKALKIAKKTGAKINITSDAIEAVKGADVVYTDVWISMGQENERKTRLK 235

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ +QVN  LMS A  DA+FMHCLPA RGEE  ++V+DGP SVV+D+AENRLHTQKAIL
Sbjct: 236 AFKKYQVNKKLMSHAKEDAIFMHCLPAVRGEETTSDVIDGPNSVVWDQAENRLHTQKAIL 295

Query: 300 LWCF 303
              F
Sbjct: 296 YKIF 299


>gi|107023491|ref|YP_621818.1| ornithine carbamoyltransferase [Burkholderia cenocepacia AU 1054]
 gi|116690573|ref|YP_836196.1| ornithine carbamoyltransferase [Burkholderia cenocepacia HI2424]
 gi|206561104|ref|YP_002231869.1| ornithine carbamoyltransferase [Burkholderia cenocepacia J2315]
 gi|123371345|sp|Q1BU60|OTC_BURCA RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|166918648|sp|A0K9X6|OTC_BURCH RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|226739193|sp|B4E9G6|OTC_BURCJ RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|105893680|gb|ABF76845.1| ornithine carbamoyltransferase [Burkholderia cenocepacia AU 1054]
 gi|116648662|gb|ABK09303.1| ornithine carbamoyltransferase [Burkholderia cenocepacia HI2424]
 gi|198037146|emb|CAR53067.1| putative ornithine carbamoyltransferase [Burkholderia cenocepacia
           J2315]
          Length = 309

 Score =  218 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 122/304 (40%), Positives = 173/304 (56%), Gaps = 3/304 (0%)

Query: 2   MTYP--KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    +H+    + S  +   ++E    +K   +N     PL  + LAMIFEK STRTR
Sbjct: 1   MTAKTIRHYLQFKDFSLEDYEYVLERTGILKRKFKNYETYHPLHDRTLAMIFEKSSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +F+S  + QLGR E + D+A+V+SR VD I++RT     +    + 
Sbjct: 61  LSFEAGIFQLGGHAVFMSTRDTQLGRGEPVEDSAQVISRMVDIIMIRTFEQDVITRFAQN 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT+  HPCQ++ADI T+ EHRG + GK  +W GD NN+L++ IE A    + 
Sbjct: 121 SRVPVINGLTNEYHPCQVLADIFTYYEHRGPIAGKTVAWVGDANNMLYTWIEAAQILGFK 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L ++TP G     + ++        V    +              T +    E +A  + 
Sbjct: 181 LRLSTPPGYALDMKLVSPDSAPFYEVFDDPNEACKGADLVTTDVWTSMGFEAENEA-RKQ 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  + V+  +M  A+PDALFMHCLPAHRGEEV   V+DGPQSVV+DEAENRLH QKA++
Sbjct: 240 AFADWCVDEEMMGHANPDALFMHCLPAHRGEEVTAGVIDGPQSVVWDEAENRLHVQKALM 299

Query: 300 LWCF 303
            +  
Sbjct: 300 EFLL 303


>gi|210610325|ref|ZP_03288354.1| hypothetical protein CLONEX_00544 [Clostridium nexile DSM 1787]
 gi|210152555|gb|EEA83561.1| hypothetical protein CLONEX_00544 [Clostridium nexile DSM 1787]
          Length = 678

 Score =  218 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 120/310 (38%), Positives = 170/310 (54%), Gaps = 6/310 (1%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M    ++F  L + +   +  ++++A  +K   +       L GK +A+IFEKPSTRTR 
Sbjct: 368 MNLKGRNFLTLKDFTPDEIMYLVDLAADLKEKKKQGITGNSLKGKNIALIFEKPSTRTRC 427

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           +F V     GG   +LS  ++QLG  E+I DTA+VL R  D I  R   H  +  L +Y+
Sbjct: 428 AFTVGACDEGGIPTYLSEHDIQLGHKESIQDTARVLGRMFDGIEFRGFKHEHVEALAKYS 487

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGD-GNNILHSLIEGAARFNYL 179
            VPV N LTD  HP QI+AD++T +EH G VKG  F + GD  NN+ +SL+ G ++    
Sbjct: 488 GVPVWNGLTDEYHPTQILADLLTMKEHFGYVKGLKFVYLGDGRNNMANSLMIGCSKVGVD 547

Query: 180 LNIATPIGSEPRNEYLNWARNQGAS---VALFHDAVQAVKGAHCVFTDTWISMNQEFK-A 235
             I  P    P  E +                 D++ AV+GA  ++TD W SM +E K A
Sbjct: 548 FVIIAPKKLWPGEELVTLCEGYAKEAGSSVCVTDSIDAVEGADVLYTDVWCSMGEEDKAA 607

Query: 236 REEHVFQPFQVNLSLMSMA-HPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHT 294
               +  P+Q+N  LM        +FMHCLPA +G+EV  +V +G  SVVFDEAENRLHT
Sbjct: 608 ERIALLSPYQINQELMDKTGKEGTIFMHCLPAVKGKEVTEDVFEGKASVVFDEAENRLHT 667

Query: 295 QKAILLWCFG 304
            KA+++   G
Sbjct: 668 IKAVMVATLG 677


>gi|167835685|ref|ZP_02462568.1| ornithine carbamoyltransferase [Burkholderia thailandensis MSMB43]
          Length = 309

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 123/304 (40%), Positives = 176/304 (57%), Gaps = 3/304 (0%)

Query: 2   MTYP--KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    +H+    + S  +   ++E    +K   +N     PL  + LAMIFEK STRTR
Sbjct: 1   MTAKTIRHYLQFKDFSLEDYEYVLERTGILKRKFKNYETYHPLHDRTLAMIFEKSSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +F+S  + QLGR E + D+A+V+SR VD I++RT     +    E 
Sbjct: 61  LSFEAGIFQLGGHAVFMSTRDTQLGRGEPVEDSAQVISRMVDIIMIRTFEQDIIQRFAEN 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT+  HPCQ++ADI T+ EHRG ++GK  +W GD NN+L++ I+ A   ++ 
Sbjct: 121 SRVPVINGLTNEYHPCQVLADIFTYYEHRGPIRGKTVAWVGDANNMLYTWIQAARILDFK 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L ++TP G     + ++        V    +              T +    E +A  + 
Sbjct: 181 LRLSTPPGYALDAKLVDAESALFYQVFDDPNEACKGADLVTTDVWTSMGFEAENEA-RKQ 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  + V+  +MS A+PDALFMHCLPAHRGEEV   V+DGPQSVV+DEAENRLH QKA++
Sbjct: 240 AFADWCVDGEMMSHANPDALFMHCLPAHRGEEVAASVIDGPQSVVWDEAENRLHVQKALM 299

Query: 300 LWCF 303
            +  
Sbjct: 300 EFLL 303


>gi|260177209|gb|ACX33932.1| putative ornithine carbamoyltransferase [uncultured prokaryote AT5]
          Length = 302

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 159/300 (53%), Positives = 209/300 (69%), Gaps = 2/300 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             + F DL +I    L  +IE ++     +      + L G+ LAMIF+KPSTRTRVSF+
Sbjct: 2   KGRDFLDLIDIPRQELRGMIESSRA--IKARRERAARALEGRTLAMIFDKPSTRTRVSFD 59

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VAM+ LGG  + L+G EMQLGR ETI DTA+VLSRYVD I++RT +H  L EL  +ATVP
Sbjct: 60  VAMRQLGGTAMLLTGQEMQLGRGETIADTARVLSRYVDIIMIRTLDHDMLTELARHATVP 119

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LT  +HPCQ++AD+MTFEEH G ++GK  +W+GD NN+L S +  A RF++ L +A
Sbjct: 120 VINGLTRRSHPCQVLADVMTFEEHCGPIRGKTVAWTGDANNVLASWMHAAERFDFRLRVA 179

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQP 243
           TP    P+    +WA+  GA++ +  D  +AVKG  CV TDTW+SM  +   R  ++ + 
Sbjct: 180 TPPELAPKKWLRDWAKTSGAAIDIGSDPEEAVKGCDCVVTDTWVSMGDKDGQRRHNLLKR 239

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +QVN  L+++A P A+FMHCLPAHRGEEV +EV+DGPQSVVFDEAENRLH QK IL WC 
Sbjct: 240 YQVNARLLALASPRAVFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKGILAWCL 299


>gi|289595836|ref|YP_003482532.1| ornithine carbamoyltransferase [Aciduliprofundum boonei T469]
 gi|289533623|gb|ADD07970.1| ornithine carbamoyltransferase [Aciduliprofundum boonei T469]
          Length = 306

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 150/304 (49%), Positives = 196/304 (64%), Gaps = 6/304 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K    + +I    L  II++  ++K     +   +PL  K +AMIFEKPSTRTRVSFE
Sbjct: 1   MKKDLISIVDI-KDELEEIIDLGLEMKRRQRMVEVYEPLKDKSMAMIFEKPSTRTRVSFE 59

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VAM  LGG  ++LS  +MQLGR ETI DTA+VLSRYVDAIV R   H  ++EL E A+VP
Sbjct: 60  VAMTQLGGHALYLSPRDMQLGRGETIADTARVLSRYVDAIVYRAYKHENVVELAENASVP 119

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINAL D  HPCQI+AD+MT +E +G  +G   ++ GDGNN+ HSL+ GAA       +A
Sbjct: 120 VINALDDLEHPCQIVADLMTIKEKKGGFRGLKLAYVGDGNNVAHSLMLGAAIVGMNFYMA 179

Query: 184 TPIGSEPRNEYLNWARNQGA----SVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREE 238
            P G EP+ + +  AR         + + HD V+AVK A  ++TD W+SM ++  K    
Sbjct: 180 CPDGYEPKKDIVGEARKIANETGAKIVITHDPVEAVKDADVIYTDVWVSMGDEAEKEIRL 239

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
            VF+P+QVN  L+  A  + +FMHCLPAHRG EV ++V+D   SVVFDEAENRLH QKAI
Sbjct: 240 KVFKPYQVNEELVRHAKSNYIFMHCLPAHRGYEVTDDVIDSRNSVVFDEAENRLHAQKAI 299

Query: 299 LLWC 302
           L+  
Sbjct: 300 LVRL 303


>gi|148554328|ref|YP_001261910.1| ornithine carbamoyltransferase [Sphingomonas wittichii RW1]
 gi|189036341|sp|A5V656|OTC_SPHWW RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|148499518|gb|ABQ67772.1| ornithine carbamoyltransferase [Sphingomonas wittichii RW1]
          Length = 309

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 154/308 (50%), Positives = 207/308 (67%), Gaps = 7/308 (2%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSE-----NIFENKPLSGKVLAMIFEKPST 56
           MT  + F DL++  ++ +  +++ A   K +           + PL+G  LAMIFEK ST
Sbjct: 1   MT--RSFLDLADAGAAGVRLMLDEAVSRKKARAGLPKGAPDRDAPLAGHTLAMIFEKNST 58

Query: 57  RTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLEL 116
           RTRVSF++AM+ LGG TI +    MQLGR ETI DTA+VLSRYVDAI++RT +H + ++L
Sbjct: 59  RTRVSFDMAMRQLGGTTIVMDAGSMQLGRGETIADTARVLSRYVDAIMIRTDDHRKAVDL 118

Query: 117 TEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARF 176
             YA VPVIN LTD +HPCQI+AD+ T  EH+G V+G  ++W GDGNN+LHS++E  +  
Sbjct: 119 ARYADVPVINGLTDRSHPCQIMADLQTILEHKGRVEGLGWAWLGDGNNVLHSIVEAGSLL 178

Query: 177 NYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR 236
            + + I  P G +P  E L  AR +G  + L  D  + V+GA  V TDTWISM Q     
Sbjct: 179 GFPVRIGCPEGYDPDAEVLAEARARGGDILLSRDPAEVVRGADVVVTDTWISMGQAHAEE 238

Query: 237 EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
           +     PFQV+ + M+ A PDA F+HCLPAHRGEEV++ V+DGP S+++DEAENRLH QK
Sbjct: 239 KLAAMMPFQVDEARMAQAAPDAAFLHCLPAHRGEEVVDAVIDGPHSLIWDEAENRLHAQK 298

Query: 297 AILLWCFG 304
           A+LLWC G
Sbjct: 299 AVLLWCLG 306


>gi|254465437|ref|ZP_05078848.1| ornithine carbamoyltransferase [Rhodobacterales bacterium Y4I]
 gi|206686345|gb|EDZ46827.1| ornithine carbamoyltransferase [Rhodobacterales bacterium Y4I]
          Length = 308

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 160/307 (52%), Positives = 210/307 (68%), Gaps = 7/307 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-----PLSGKVLAMIFEKPSTRTR 59
             HF D+     ++L  II+ AK  K +     +       PL  K++A+IFEKPSTRTR
Sbjct: 1   MNHFLDIHKTGPADLRAIIDQAKATKQARLGRPKAALDDELPLKDKMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V ++ +GG T+ LSG +MQLG  ETI DTA+VLSRYVD I++RT + + L E+ EY
Sbjct: 61  VSFDVGVRQMGGQTMVLSGKDMQLGHGETIADTARVLSRYVDMIMIRTFDETVLTEMAEY 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LTD THPCQI+AD++T+EEHRG ++GK   W GDGNN+  S +  A +F + 
Sbjct: 121 SDVPVINGLTDRTHPCQIMADVLTYEEHRGPIRGKKVVWCGDGNNVCASFLHAAGQFGFD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKARE 237
           L  A P   +P  E++  AR  G+ V +  DA +AV+GA  V TDTW+SM+  Q  K R 
Sbjct: 181 LTFAGPAQLDPEEEFVGLARKAGSKVVIERDAAKAVEGADLVVTDTWVSMHDSQSSKERR 240

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
            ++ +P+QVN  LMS A PDALFMHCLPAHR EE  ++V+DGP SV+FDEAENRLH QKA
Sbjct: 241 HNMLRPYQVNAELMSHAKPDALFMHCLPAHREEEATSQVMDGPNSVIFDEAENRLHAQKA 300

Query: 298 ILLWCFG 304
           I+ WC G
Sbjct: 301 IMRWCAG 307


>gi|157691830|ref|YP_001486292.1| ornithine carbamoyltransferase [Bacillus pumilus SAFR-032]
 gi|157680588|gb|ABV61732.1| ornithine carbamoyltransferase [Bacillus pumilus SAFR-032]
          Length = 316

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 137/305 (44%), Positives = 196/305 (64%), Gaps = 9/305 (2%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
           Y K F  L + S ++++ +IE A+++K +           GK LAMIFEK STRTRVSFE
Sbjct: 11  YGKDFLSLKDFSINDIAYLIEKAEEMKQNPYQ----DLFKGKTLAMIFEKSSTRTRVSFE 66

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
             M  LGG  +FLS +++Q+GR ETI DTA+VLS YVD I++RT  H ++ EL +YA++P
Sbjct: 67  AGMTQLGGHALFLSSNDLQIGRGETISDTAQVLSGYVDGIMIRTFEHEKVEELAQYASIP 126

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD +HPCQ +AD++T +E +G++KG   ++ GDGNN+ HSL+ G A+    + +A
Sbjct: 127 VINGLTDYSHPCQALADLLTIKEAKGTLKGIKVAYIGDGNNVAHSLMVGCAQLGCDIAVA 186

Query: 184 TPIGSEPRNEYLNWARNQGAS----VALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREE 238
           +P G EP  E  + A          V +  D V AV+ A  +++D + SM QE +  +  
Sbjct: 187 SPKGYEPLQEVTDTAHEFAKQSGAEVIVTTDPVAAVQNADVIYSDVFTSMGQEAETEKRL 246

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F+ +Q+N  LM  A  D +F+HCLPAHRGEEV  +++DGP S VF +AENRLH QKA+
Sbjct: 247 AEFKEYQINDELMRHAAKDYIFLHCLPAHRGEEVTADIIDGPHSKVFQQAENRLHVQKAL 306

Query: 299 LLWCF 303
           +    
Sbjct: 307 IKELM 311


>gi|288957258|ref|YP_003447599.1| ornithine carbamoyltransferase [Azospirillum sp. B510]
 gi|288909566|dbj|BAI71055.1| ornithine carbamoyltransferase [Azospirillum sp. B510]
          Length = 314

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 151/304 (49%), Positives = 201/304 (66%), Gaps = 3/304 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIF--ENKPLSGKVLAMIFEKPSTRTRVSFE 63
           +HF D+  +  + L  +++ A +IK   +      +  L+G+ LA+IFEKPSTRTRVSFE
Sbjct: 10  RHFLDIDRMDGATLRRLLDHAVRIKADLKKDRLAHSTLLAGRSLALIFEKPSTRTRVSFE 69

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M+  GG+ + L   +MQLGR ETIGDTA+VLSR+VDA+++RTT   R+ EL  +A++P
Sbjct: 70  VGMQQFGGNVVVLKPDDMQLGRGETIGDTARVLSRFVDAVMVRTTGEERVHELAAHASIP 129

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           +IN LTD THPCQI+AD+MTFEEHRG + G+  +W GD NN+  S    A RF + + +A
Sbjct: 130 IINGLTDQTHPCQIMADLMTFEEHRGPIGGRTVAWIGDCNNVAVSWAHAAVRFGFEMRLA 189

Query: 184 TPIGSEPRNEYLNWARNQGASV-ALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQ 242
            P    P  E L WA  +G     +     +AV+G  CV TD W SM+         +  
Sbjct: 190 CPSVYGPSPELLAWAEREGGGRLVVTESPEEAVRGVDCVITDAWASMHNTDVDERAAILA 249

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           P+QVN +LM+ AH DALFMHCLPAHR EEV + V+DG  SVV+DEAENRLH QKAIL WC
Sbjct: 250 PYQVNEALMAHAHHDALFMHCLPAHRNEEVTDGVIDGRHSVVWDEAENRLHAQKAILGWC 309

Query: 303 FGII 306
            G++
Sbjct: 310 MGVL 313


>gi|168702930|ref|ZP_02735207.1| ornithine carbamoyltransferase [Gemmata obscuriglobus UQM 2246]
          Length = 303

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 123/302 (40%), Positives = 176/302 (58%), Gaps = 3/302 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH  +L +++   L  ++  A ++K++         L+G+V+ ++FEKPS RTRVSFE 
Sbjct: 1   MKHLLNLIDLTGDELRHLLSEAARLKDAHARRIPAHSLTGRVVGLVFEKPSLRTRVSFES 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG  ++L G+E+ LG  E++ D A+ +S YVDA+V+R   HS L  +    +VPV
Sbjct: 61  GVAQLGGTALYLPGNEVGLGWRESLADFARTISNYVDALVLRVYKHSTLDGIAATGSVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN L+D +HPCQ +AD++T  E  GS  G+  ++ GDGNN+  SL  G  +      +A 
Sbjct: 121 INGLSDWSHPCQGLADLLTVRELFGSENGRTVAFVGDGNNVARSLAVGCGKLGANFVLAC 180

Query: 185 PIGSEPRNEYL--NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVF 241
           P G      +     AR  G     F+D   AVKGA  ++TD W SM QE +       F
Sbjct: 181 PPGYGFDEPFKADYAARVGGEPPKEFNDPFAAVKGADVIYTDVWTSMGQEAEREERLKKF 240

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
            PFQVN  L+S A P+   +HCLPAHRGEE+ +EV++GP    F +A NRLH QKA+L W
Sbjct: 241 APFQVNAQLLSKAAPNCKVLHCLPAHRGEEITDEVMEGPACAAFQQAGNRLHAQKAVLEW 300

Query: 302 CF 303
             
Sbjct: 301 LL 302


>gi|302814549|ref|XP_002988958.1| hypothetical protein SELMODRAFT_184194 [Selaginella moellendorffii]
 gi|300143295|gb|EFJ09987.1| hypothetical protein SELMODRAFT_184194 [Selaginella moellendorffii]
          Length = 363

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 134/305 (43%), Positives = 185/305 (60%), Gaps = 3/305 (0%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFEN-KPLSGKVLAMIFEKPSTRTRVS 61
           + P HF  + +     +  ++E A ++K   ++   + +P +GK +AMIF KPS RTRVS
Sbjct: 58  SKPLHFLHIDDFDKKEILHLLERAVEVKALLKSGDRSFRPFNGKSMAMIFTKPSMRTRVS 117

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE     LGG  I+L  S++Q+G+ E   D A+VLS Y D I+ R   H  LL+L +YA+
Sbjct: 118 FETGFFLLGGHAIYLGPSDIQIGKREETRDVARVLSGYNDVIMARLFAHQDLLDLAKYAS 177

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           +PVIN LTD  HPCQI+AD +T  EH G ++G    + GDGNNI+HS +  AA   +   
Sbjct: 178 IPVINGLTDYNHPCQIMADALTIIEHVGRIEGVKVVYVGDGNNIVHSWLRLAAVVPFHFV 237

Query: 182 IATPIGSEPRNEYLNWARNQG-ASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEH 239
            A P G EP  E +N A   G + + + +D ++AVKGAH V++D W SM Q+ + A    
Sbjct: 238 CACPRGFEPDKETVNRATAAGLSKIEITNDPLEAVKGAHVVYSDVWASMGQKDQTAARLE 297

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            FQ FQVN  LM  A   A FMHCLPA R  EV + V++ P S+VF +AENR+H Q AI+
Sbjct: 298 RFQGFQVNEKLMEAAGSQAYFMHCLPAERDVEVTDAVIESPNSIVFTQAENRMHAQNAIM 357

Query: 300 LWCFG 304
           L   G
Sbjct: 358 LHVLG 362


>gi|325122528|gb|ADY82051.1| ornithine carbamoyltransferase [Acinetobacter calcoaceticus PHEA-2]
          Length = 306

 Score =  217 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 133/298 (44%), Positives = 181/298 (60%), Gaps = 2/298 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++S+  L+ I+E A ++K    +    +P  GKVL MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLRDLSTLELNRILERASELKKMQHDNKVYQPFVGKVLGMIFEKSSTRTRISFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +   GG  IFLS  + QLGR E I D+A+V+S  +D +++RT  H  +     Y+ VPVI
Sbjct: 64  INQFGGSAIFLSPRDTQLGRGEPIEDSARVISSMLDIVMIRTFGHDIVERFASYSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ++AD+ T+ EHRGS++GK  +W GDGNN+ +S IE A    + L IA+P
Sbjct: 124 NGLTDDHHPCQLLADLQTYIEHRGSIEGKTVAWIGDGNNMCNSYIEAAHMMGFKLKIASP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G EP+ E+L    +         DA             +     +E +   E  F  FQ
Sbjct: 184 KGYEPKPEFLAEFGHCVELYDNAEDAAVNADLIVTDVWASM--GQEEEQKLREKAFADFQ 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN  LMS+AHPD LFMHCLPAHRGEE+   +LD   +VV+DEAENRLH QKA++ +  
Sbjct: 242 VNEKLMSLAHPDCLFMHCLPAHRGEEISETMLDYKNAVVWDEAENRLHAQKALVEFLL 299


>gi|317056741|ref|YP_004105208.1| ornithine carbamoyltransferase [Ruminococcus albus 7]
 gi|315449010|gb|ADU22574.1| ornithine carbamoyltransferase [Ruminococcus albus 7]
          Length = 304

 Score =  217 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 125/301 (41%), Positives = 187/301 (62%), Gaps = 1/301 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
             H   + ++S   +  I+ +A ++K  ++N  E+K L GK L MIF+K STRTRVSFE 
Sbjct: 1   MNHLLKMLDLSKEEIIDILNLADQLKYENKNGIEHKVLKGKTLGMIFQKSSTRTRVSFET 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG  +FLS  ++Q+GR E + DTA+VLSRY+D I++RT     + +L +Y ++P+
Sbjct: 61  GMYQLGGQALFLSNRDLQIGRGEPVQDTARVLSRYLDGIMIRTFEQKEVEDLAQYGSIPI 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD  HPCQ++AD+MT  E +G  +G    + GDGNN+ +SLI G  +    ++IA 
Sbjct: 121 INGLTDFCHPCQVLADLMTIREFKGQFEGLKMCYIGDGNNMANSLIVGGLKVGMSVSIAC 180

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQP 243
           P G  P  E L +A+  G    +    ++A K A  +FTD W SM +E +  + +  F  
Sbjct: 181 PEGYRPDPEVLEFAKQYGDKFFMTDKPIEAAKDADVLFTDVWTSMGEEAETEKRKVAFAG 240

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +Q+N  +M+ A PDA+  HCLPAHR EE+  +V +   + +F+EAENRLH QKA+++   
Sbjct: 241 YQINDDIMAAAKPDAMVQHCLPAHREEEITEKVFEAHANEIFEEAENRLHAQKAVMVKVM 300

Query: 304 G 304
           G
Sbjct: 301 G 301


>gi|51244289|ref|YP_064173.1| ornithine carbamoyltransferase [Desulfotalea psychrophila LSv54]
 gi|56404356|sp|Q6AR58|OTC_DESPS RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|50875326|emb|CAG35166.1| probable ornithine carbamoyltransferase [Desulfotalea psychrophila
           LSv54]
          Length = 303

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 140/303 (46%), Positives = 191/303 (63%), Gaps = 2/303 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
            P H + L + +   ++ +I  A ++K        ++ L+GK +A+IFEKPSTRTRVSFE
Sbjct: 1   MPDHLSSLGDFTGEEIASLIARAIELKEERSRGIRHQQLAGKSVALIFEKPSTRTRVSFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
            AM  LGG  +FLSG + QL R+E + D A+V+SRYVD IV+RT     + EL +YATVP
Sbjct: 61  SAMYGLGGQVLFLSGRDTQLSRSEPLKDMARVMSRYVDGIVVRTFGQEVVNELAQYATVP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINALTD  HPCQI++DIMT  E +G+++     W GDGNN+ +S I+ AA+  + L +A
Sbjct: 121 VINALTDLHHPCQILSDIMTVIEKKGAIQDLKIVWVGDGNNMANSWIQAAAKLGFELILA 180

Query: 184 TPIGSEPRNEYLNWAR-NQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVF 241
            P G +P  E L  A+      + L  D   AV GA  +  D + SM QE +  E   +F
Sbjct: 181 CPEGYDPDAEILAAAQAEGAKPITLLRDPQTAVLGADVINVDVFASMGQESEQDERLKIF 240

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
             +QVN  +M+ A  DA+ +HCLPAHRGEE+  +VL+GPQ V FDEAEN++H  KAIL  
Sbjct: 241 ASYQVNAEMMAKAADDAIVLHCLPAHRGEEITEDVLEGPQCVAFDEAENKMHMHKAILER 300

Query: 302 CFG 304
             G
Sbjct: 301 FLG 303


>gi|254485891|ref|ZP_05099096.1| ornithine carbamoyltransferase [Roseobacter sp. GAI101]
 gi|214042760|gb|EEB83398.1| ornithine carbamoyltransferase [Roseobacter sp. GAI101]
          Length = 301

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 143/306 (46%), Positives = 191/306 (62%), Gaps = 10/306 (3%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSE-----NIFENKPLSGKVLAMIFEKPSTRTR 59
             HF D+     ++L  II+ A  +K+S +        + +PL   ++A+IFEKPSTRTR
Sbjct: 1   MNHFLDIHQTDPADLRHIIDRAAAMKSSRQGRPRGAPDDEQPLKDHMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V ++ +GG T+ LSG++MQLG  ETI DTA+VLSRYVD I++RT   + LLE+ EY
Sbjct: 61  VSFDVGVRQMGGQTMVLSGADMQLGHGETIADTARVLSRYVDLIMIRTFEEATLLEMAEY 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           A+VPVIN LT+ THPCQI+ADIMTFEEH G +KGK   WSGDGNN+  S    A  F++ 
Sbjct: 121 ASVPVINGLTNRTHPCQIMADIMTFEEHSGPIKGKKVVWSGDGNNVFASFAHAAKSFDFE 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L    P   +        A N   +V    +            T   +   Q  + R  +
Sbjct: 181 LVFTGPPTLD-----PEPALNGLYTVERDPNKAVEGADLVVTDTWVSMHDPQSARERRHN 235

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             + +QVN +LM+ A PDALFMHCLPAHR +EV + V+DGP SV+FDEAENRLH QK+++
Sbjct: 236 QLRGYQVNDALMAKAKPDALFMHCLPAHRDDEVTSSVMDGPHSVIFDEAENRLHAQKSVM 295

Query: 300 LWCFGI 305
            WC G 
Sbjct: 296 RWCLGK 301


>gi|83952797|ref|ZP_00961527.1| ornithine carbamoyltransferase [Roseovarius nubinhibens ISM]
 gi|83835932|gb|EAP75231.1| ornithine carbamoyltransferase [Roseovarius nubinhibens ISM]
          Length = 308

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 157/308 (50%), Positives = 213/308 (69%), Gaps = 7/308 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSS-----ENIFENKPLSGKVLAMIFEKPSTRTR 59
              F D+    +  L  I++ A ++K +          +++PL+  ++A+IFEKPSTRTR
Sbjct: 1   MPDFLDIHKTDAGALRDILDQASQMKQARLGRKRGAPDDDQPLANHMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+  ++ +GG T+ LSG+E+QLG  ETI DTA+VLSRYVD I++RT + S LLEL E+
Sbjct: 61  VSFDAGVRQMGGQTMLLSGAELQLGHGETIADTARVLSRYVDLIMIRTFDESVLLELAEH 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LTD THPCQI+ADI+T+EEHRG +KGK   WSGDGNN+  S +  A +F + 
Sbjct: 121 SQVPVINGLTDRTHPCQIMADILTYEEHRGPIKGKKVVWSGDGNNVCASFLHAAGKFGFD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKARE 237
                P   +P  E++  AR  G  V +  DA +AV+GA  V TDTW+SM+  Q  K R 
Sbjct: 181 FTYTGPQQLDPEEEFIGEARRAGVQVTIERDAAKAVEGADLVVTDTWVSMHDSQSTKERR 240

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
            ++ + +QVN +LMS A PDALFMHCLPAHR EEV ++V+DGPQSV++DEAENRLH QKA
Sbjct: 241 HNLLRSYQVNDALMSHAKPDALFMHCLPAHREEEVTSKVMDGPQSVIWDEAENRLHAQKA 300

Query: 298 ILLWCFGI 305
           ++ WC G+
Sbjct: 301 VMRWCLGV 308


>gi|126739950|ref|ZP_01755640.1| ornithine carbamoyltransferase [Roseobacter sp. SK209-2-6]
 gi|126718769|gb|EBA15481.1| ornithine carbamoyltransferase [Roseobacter sp. SK209-2-6]
          Length = 308

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 155/306 (50%), Positives = 208/306 (67%), Gaps = 7/306 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-----PLSGKVLAMIFEKPSTRTR 59
            KHF D+     ++L  II+ A   K +     +       PL  +++A+IFEKPSTRTR
Sbjct: 1   MKHFLDIHKTDPADLRAIIDQASATKQARLGRPKAALDDELPLKDRMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V ++ +GG T+ LSG +MQLG  ETI DTA+VLSRYVD I++RT + + L E+ EY
Sbjct: 61  VSFDVGVRQMGGQTMVLSGKDMQLGHGETIADTARVLSRYVDMIMIRTFDETVLTEMAEY 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           A VPVIN LTD THPCQI+AD++T+EEHRG +KGK   W+GDGNN+  S +  A +F + 
Sbjct: 121 ADVPVINGLTDRTHPCQIMADVLTYEEHRGPIKGKKVVWAGDGNNVCASFLHAAGQFGFD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKARE 237
           L    P   +P  E++  AR  G+ +++  DA +AV+GA  +  DTW+SM+  Q  K R 
Sbjct: 181 LTFTGPAQLDPEEEFIGLARKAGSKISIERDAFKAVEGADLIVADTWVSMHDSQSSKERR 240

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
            ++ +P+QVN  LMS A  DALFMHCLPAHR EEV + V+DG QSV+FDEAENRLH QKA
Sbjct: 241 HNMLRPYQVNDELMSHAKSDALFMHCLPAHREEEVTSSVMDGAQSVIFDEAENRLHAQKA 300

Query: 298 ILLWCF 303
           ++ WC 
Sbjct: 301 VMRWCL 306


>gi|221199210|ref|ZP_03572254.1| ornithine carbamoyltransferase [Burkholderia multivorans CGD2M]
 gi|221206593|ref|ZP_03579605.1| ornithine carbamoyltransferase [Burkholderia multivorans CGD2]
 gi|221211434|ref|ZP_03584413.1| ornithine carbamoyltransferase [Burkholderia multivorans CGD1]
 gi|221168795|gb|EEE01263.1| ornithine carbamoyltransferase [Burkholderia multivorans CGD1]
 gi|221173248|gb|EEE05683.1| ornithine carbamoyltransferase [Burkholderia multivorans CGD2]
 gi|221180495|gb|EEE12898.1| ornithine carbamoyltransferase [Burkholderia multivorans CGD2M]
          Length = 317

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 122/304 (40%), Positives = 172/304 (56%), Gaps = 3/304 (0%)

Query: 2   MTYP--KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    +H+    + S  +   ++E    +K   +N     PL  + LAMIFEK STRTR
Sbjct: 9   MTAKTIRHYLQFKDFSLEDYEYVLERTGILKRKFKNYETYHPLHDRTLAMIFEKSSTRTR 68

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +F+S  + QLGR E + D+A+V+SR VD I++RT     +    E 
Sbjct: 69  LSFEAGIFQLGGHAVFMSTRDTQLGRGEPVEDSAQVISRMVDIIMIRTFEQDIIQRFAEN 128

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT+  HPCQ++ADI T+ EHRG + GK  +W GD NN+L++ I+ A    + 
Sbjct: 129 SRVPVINGLTNEYHPCQVLADIFTYYEHRGPIAGKTVAWVGDANNMLYTWIQAAQILGFK 188

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L ++TP G     + ++        V    +              T +    E +A    
Sbjct: 189 LRLSTPPGYALDMKLVSPDSAPFYEVFDDPNEACKGADLVTTDVWTSMGFEAENEA-RMK 247

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  + V+  +M  A+PDALFMHCLPAHRGEEV   V+DGPQSVV+DEAENRLH QKA++
Sbjct: 248 AFADWCVDEEMMGHANPDALFMHCLPAHRGEEVTAGVIDGPQSVVWDEAENRLHVQKALM 307

Query: 300 LWCF 303
            +  
Sbjct: 308 EFLL 311


>gi|16332048|ref|NP_442776.1| ornithine carbamoyltransferase [Synechocystis sp. PCC 6803]
 gi|3183105|sp|Q55497|OTC_SYNY3 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|1001360|dbj|BAA10847.1| ornithine carbamoyltransferase chain f [Synechocystis sp. PCC 6803]
          Length = 308

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 122/305 (40%), Positives = 189/305 (61%), Gaps = 9/305 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +    +++++   +  ++++A  +K+         P   K+L ++F K STRTRVSF  A
Sbjct: 9   RDLLAIADLTIEEMKSLLQLAADLKSGVLK-----PHCRKILGLLFYKASTRTRVSFTAA 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  + L+ S  Q+GR E I DTA+VL RY+D + +RT   + L    ++A +P+I
Sbjct: 64  MYQLGGQVLDLNPSVTQVGRGEPIQDTARVLDRYIDILAVRTFKQTDLQTFADHAKMPII 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NAL+D  HPCQI+AD+ T +E  G ++G   ++ GDGNN+ HSLI G       + +ATP
Sbjct: 124 NALSDLEHPCQILADLQTIKECFGKLEGLTVTYLGDGNNVAHSLILGGVMMGMTVRVATP 183

Query: 186 IGSEPRNEYLNWARNQGAS---VALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVF 241
              EP  E +  A+   A    V L  D   A +G+H ++TD W SM QE  A     +F
Sbjct: 184 KNYEPLAEIVQQAQQIAAPGGKVELTDDPKAAAQGSHILYTDVWASMGQEDLADSRIPIF 243

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q+N  L+++A P+A+ +HCLPAHRGEE+ + V++GPQS ++D+AENR+H QKA+++ 
Sbjct: 244 QPYQINQELLALADPEAIVLHCLPAHRGEEITDAVMEGPQSRLWDQAENRMHAQKALMVA 303

Query: 302 CFGII 306
             G++
Sbjct: 304 LLGLV 308


>gi|261855943|ref|YP_003263226.1| ornithine carbamoyltransferase [Halothiobacillus neapolitanus c2]
 gi|261836412|gb|ACX96179.1| ornithine carbamoyltransferase [Halothiobacillus neapolitanus c2]
          Length = 312

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 141/303 (46%), Positives = 192/303 (63%), Gaps = 5/303 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L + S ++   I+  A+ +K + +       L  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSLLDYSQADYRRILARAEALKKAYDAGVRPDTLRQRVLGMIFEKASTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  IFLS  + QLGR E I D+A+V+SR VDA+++R  +H  + +   Y+ VPVI
Sbjct: 64  IAQLGGTAIFLSPRDTQLGRGEPIEDSARVISRMVDAVMIRAKDHHMVEQFAAYSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD  HPCQ++AD+  FE++RGS++GK  +W GDG N+ HS I  A  F++ L IATP
Sbjct: 124 NALTDLNHPCQLLADVFAFEQNRGSIQGKRVAWIGDGFNMCHSYINAAQVFDFELMIATP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVFQPF 244
            G +P    +  A ++   V     A +A  GA  V TD W SM QE +       F+ F
Sbjct: 184 EGYQPDPAVVAAAGDRVHIVR---TAHEAASGADLVVTDVWASMGQEDERERRLRDFKTF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC-F 303
            ++  +M+ A+ DALFMHCLPAHRGEEV  EV+DGPQSVV+ EAE RLHTQKA+L +   
Sbjct: 241 VIDDGVMAHANSDALFMHCLPAHRGEEVTAEVIDGPQSVVWQEAEARLHTQKALLEFLIL 300

Query: 304 GII 306
           G +
Sbjct: 301 GDV 303


>gi|315649810|ref|ZP_07902893.1| ornithine carbamoyltransferase [Paenibacillus vortex V453]
 gi|315274784|gb|EFU38165.1| ornithine carbamoyltransferase [Paenibacillus vortex V453]
          Length = 318

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 132/305 (43%), Positives = 194/305 (63%), Gaps = 5/305 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             +   +L   S+  +  +++ A +IK   +N    +PL GK + +IFEK STRTR+SFE
Sbjct: 13  KGRDMIELDEYSTEEIQFLLDSAIEIKRKQKNGEVYQPLKGKTIGLIFEKSSTRTRISFE 72

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
             M  LGG  +FLS +++QLGR E I D A+V+SRY+D +++RT  H  ++ L +YA++P
Sbjct: 73  TGMFQLGGHALFLSKNDIQLGRGEPISDMAQVMSRYLDGLMIRTFGHDNVVNLAKYASIP 132

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN L+D  HPCQ++AD+ T  EH+G +KG   ++ GDGNN+ HSL+ G A+    + +A
Sbjct: 133 VINGLSDMAHPCQVLADLQTVLEHKGKLKGLKMAFIGDGNNMAHSLLIGGAKMGMHVALA 192

Query: 184 TPIGSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREE 238
           +P G E     +    + A   G S+ +  D ++A K A+ ++TD W SM  E + A+ E
Sbjct: 193 SPKGYEADAGIVKLSEDIAAQTGGSITITQDPIEAAKDANVIYTDVWASMGFEEEQAQRE 252

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F  +QVN  L+  A PD LF+HCLPAHRGEEV   V+DG  SV+FD+AENRLH QKA+
Sbjct: 253 VAFADYQVNEELVKAAKPDYLFLHCLPAHRGEEVSEGVIDGVNSVIFDQAENRLHAQKAL 312

Query: 299 LLWCF 303
           ++   
Sbjct: 313 MVALM 317


>gi|293609260|ref|ZP_06691562.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827712|gb|EFF86075.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 306

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 132/298 (44%), Positives = 180/298 (60%), Gaps = 2/298 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++S+  L+ I+E A ++K    +    +P  GKVL MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLRDLSTLELNRILERASELKKMQHDNKVYQPFVGKVLGMIFEKSSTRTRISFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +   GG  IFLS  + QLGR E I D+A+V+S  +D +++RT  H  +     Y+ VPVI
Sbjct: 64  INQFGGSAIFLSPRDTQLGRGEPIEDSARVISSMLDIVMIRTFGHDIVERFASYSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ++AD+ T+ EHR S++GK  +W GDGNN+ +S IE A    + L IA+P
Sbjct: 124 NGLTDDHHPCQLLADLQTYIEHRDSIEGKTVAWIGDGNNMCNSYIEAAHMMGFKLKIASP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G EP+ E+L    +         DA             +     +E +   E  F  FQ
Sbjct: 184 KGYEPKPEFLAEFGHCVELYDNAEDAAVNADLIVTDVWASM--GQEEEQKLREKAFADFQ 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN  LMS+AHPD LFMHCLPAHRGEE+   +LD   +VV+DEAENRLH QKA++ +  
Sbjct: 242 VNEKLMSLAHPDCLFMHCLPAHRGEEISETMLDYKNAVVWDEAENRLHAQKALVEFLL 299


>gi|170733913|ref|YP_001765860.1| ornithine carbamoyltransferase [Burkholderia cenocepacia MC0-3]
 gi|169817155|gb|ACA91738.1| ornithine carbamoyltransferase [Burkholderia cenocepacia MC0-3]
          Length = 309

 Score =  217 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 122/304 (40%), Positives = 173/304 (56%), Gaps = 3/304 (0%)

Query: 2   MTYP--KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    +H+    + S  +   ++E    +K   +N     PL  + LAMIFEK STRTR
Sbjct: 1   MTAKTIRHYLQFKDFSLEDYEYVLERTGILKRKFKNYETYHPLHDRTLAMIFEKSSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +F+S  + QLGR E + D+A+V+SR VD I++RT     +    + 
Sbjct: 61  LSFEAGIFQLGGHAVFMSTRDTQLGRGEPVEDSAQVISRMVDIIMIRTFEQDVITRFAQN 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT+  HPCQ++ADI T+ EHRG + GK  +W GD NN+L++ IE A    + 
Sbjct: 121 SRVPVINGLTNEYHPCQVLADIFTYYEHRGPIAGKTVAWVGDANNMLYTWIEAAQILGFK 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L ++TP G     + ++        V    +              T +    E +A  + 
Sbjct: 181 LRLSTPPGYALDMKLVSPDSAPFYEVFDDPNEACKGADLVTTDVWTSMGFEAENEA-RKQ 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  + V+  +M  A+PDALFMHCLPAHRGEEV   V+DGPQSVV+DEAENRLH QKA++
Sbjct: 240 AFADWCVDEEMMGHANPDALFMHCLPAHRGEEVTARVIDGPQSVVWDEAENRLHVQKALM 299

Query: 300 LWCF 303
            +  
Sbjct: 300 EFLL 303


>gi|148546363|ref|YP_001266465.1| ornithine carbamoyltransferase [Pseudomonas putida F1]
 gi|148510421|gb|ABQ77281.1| ornithine carbamoyltransferase [Pseudomonas putida F1]
          Length = 306

 Score =  217 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 146/302 (48%), Positives = 195/302 (64%), Gaps = 5/302 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M+  +HF  L + ++  L  +I    ++K+  +     +PL  +VL MIFEK STRTRVS
Sbjct: 1   MSA-RHFLSLLDFTTDELLGVIRRGIELKDLRKRGVLFEPLKNRVLGMIFEKSSTRTRVS 59

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  IFLS  + QLGR E IGD+A VLS  VD +++RT  HS L E    + 
Sbjct: 60  FEAGMIQLGGQAIFLSPRDTQLGRGEPIGDSAIVLSSMVDVVMIRTHAHSTLTEFAAKSR 119

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN L+D +HPCQ++AD+ TF EHRGS++GK  +W GDG N+ +S IE A +F++ L 
Sbjct: 120 VPVINGLSDESHPCQLLADMQTFVEHRGSIQGKTVTWIGDGFNMCNSYIEAARQFDFQLR 179

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHV 240
           IA P G EP   ++    ++   +    DA +AV+ AH V TD W SM QE + AR    
Sbjct: 180 IACPEGYEPDQRFMALGGDRVQIIR---DAKEAVRDAHLVVTDVWTSMGQEEETARRLAH 236

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F P+QV   L+ +A PD LFMHCLPAHRGEE+  ++LD P+SV +DEAENRLH QKA+L 
Sbjct: 237 FAPYQVTRELLDLAAPDVLFMHCLPAHRGEEISQDLLDDPRSVAWDEAENRLHAQKALLE 296

Query: 301 WC 302
           + 
Sbjct: 297 FL 298


>gi|300864212|ref|ZP_07109096.1| ornithine carbamoyltransferase [Oscillatoria sp. PCC 6506]
 gi|300337786|emb|CBN54242.1| ornithine carbamoyltransferase [Oscillatoria sp. PCC 6506]
          Length = 306

 Score =  217 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 128/305 (41%), Positives = 182/305 (59%), Gaps = 9/305 (2%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             +    L+++S   L+ ++++A  +K+    +        KVL ++F K STRTRVSF 
Sbjct: 5   KGRDLLSLADLSFEELNYLLDLAANLKSGMLKLQ-----RNKVLGLVFSKASTRTRVSFS 59

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VAM  LGG  I L+ +  Q+ R E + DTA+VL RY+D + +RT  H  L    +YA +P
Sbjct: 60  VAMYQLGGQVIDLNPNVTQVSRGEPLVDTARVLDRYLDIVAIRTFEHKDLETFADYAKIP 119

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINALTD  HPCQ++AD+MT +E  GS +G   ++ GDGNN+ +SL+ G A     + IA
Sbjct: 120 VINALTDLEHPCQVLADLMTVKECFGSFEGLTLAYFGDGNNMANSLLLGCAMVGMNVRIA 179

Query: 184 TPIGSEPRNEYLNWARNQGASVALFH---DAVQAVKGAHCVFTDTWISMNQEFKA-REEH 239
           TP   +P    +  A+             DA  A++G   V+TD W SM QE +A     
Sbjct: 180 TPSDYQPDAGIVKQAKAIAKGKTEVMITTDAATAMQGVQVVYTDVWASMGQEEEARMRIP 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           VFQP+QVN  LM +A  DA+ +HCLPAHR EE+ + V++G +S V+DEAENR+H QKA+L
Sbjct: 240 VFQPYQVNEKLMELADKDAIVLHCLPAHRDEEITDAVIEGARSRVWDEAENRMHAQKALL 299

Query: 300 LWCFG 304
               G
Sbjct: 300 ATLLG 304


>gi|194290623|ref|YP_002006530.1| ornithine carbamoyltransferase [Cupriavidus taiwanensis LMG 19424]
 gi|226739198|sp|B3R6D6|OTC_CUPTR RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|193224458|emb|CAQ70469.1| putrescine carbamoyltransferase [Cupriavidus taiwanensis LMG 19424]
          Length = 307

 Score =  217 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 128/305 (41%), Positives = 184/305 (60%), Gaps = 4/305 (1%)

Query: 1   MMTYP-KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           M + P KH+   S+ +      +++ A+ +K   +N     PL  + LAMIFEK STRTR
Sbjct: 1   MSSTPIKHYLQFSDFTPDEYEYLLDRARILKAKFKNYETWHPLHDRTLAMIFEKNSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +FL+  + QLGR E I D A+V+SR VD I++RT     +     +
Sbjct: 61  LSFEAGIHQLGGHAVFLNTRDSQLGRGEPIEDAAQVISRMVDIIMIRTFGQDIIDRFAAH 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT+  HPCQ++AD+ T+ E RGS++GK  +W GD NN+ ++ I+ A R  + 
Sbjct: 121 SRVPVINGLTNEYHPCQVLADVFTYIEQRGSIRGKTVAWIGDANNMAYTWIQAAERLGFT 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EE 238
            + + P G +     +  +      V +F D + A +GA  V TD W SM  E +    +
Sbjct: 181 FHFSAPPGYQLDPVMVPAS--ASGLVKVFDDPLAACQGASLVTTDVWTSMGFEAENDARK 238

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F+ + V  ++M  A PDALFMHCLPAHRGEEV   V+DGP+SVV+DEAENRLH QKA+
Sbjct: 239 RAFKDWMVTTAMMDRAEPDALFMHCLPAHRGEEVEAAVIDGPKSVVWDEAENRLHVQKAL 298

Query: 299 LLWCF 303
           + +  
Sbjct: 299 MEYLL 303


>gi|319762101|ref|YP_004126038.1| ornithine carbamoyltransferase [Alicycliphilus denitrificans BC]
 gi|330826080|ref|YP_004389383.1| Ornithine carbamoyltransferase [Alicycliphilus denitrificans K601]
 gi|317116662|gb|ADU99150.1| ornithine carbamoyltransferase [Alicycliphilus denitrificans BC]
 gi|329311452|gb|AEB85867.1| Ornithine carbamoyltransferase [Alicycliphilus denitrificans K601]
          Length = 306

 Score =  217 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 126/301 (41%), Positives = 187/301 (62%), Gaps = 2/301 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH+   +++ +   + +   A  IK   ++  +  PL+ + LAMIFEK STRTRVSFE 
Sbjct: 1   MKHYLQFADLGADEYNYLFSRAAIIKGKFKSYEKYHPLADRTLAMIFEKASTRTRVSFEA 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  +GG  + L+  + QLGRAE I D+A+V+SR  D +++RT    ++    E++ VPV
Sbjct: 61  GMYQMGGSVVHLTTGDSQLGRAEPIEDSARVISRMTDLVMIRTFGQDKIARFAEFSRVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LT+  HPCQI+ADI T+ EHRGS+ GK  +W GDGNN+ ++ ++ A    + ++++T
Sbjct: 121 INGLTNEFHPCQIMADIFTYIEHRGSITGKTVAWVGDGNNMANTWLQAADLLGFTVHVST 180

Query: 185 PIGSEPRNEYLNWARNQGA-SVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQ 242
           P G E   +     +        +F + + A + A  V TD W SM  E +       F 
Sbjct: 181 PGGYEVDEKLAFGGKPHRPGCYKVFANPMDACRDADLVTTDVWTSMGYEAENEARRKAFA 240

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            + V+  +M++A PDALFMHCLPAHRGEEV+ +V+DGPQSVV+DEAENR+H QKA++ + 
Sbjct: 241 DWCVDAEMMAVAKPDALFMHCLPAHRGEEVMADVIDGPQSVVWDEAENRMHVQKALMEYL 300

Query: 303 F 303
            
Sbjct: 301 L 301


>gi|254510326|ref|ZP_05122393.1| ornithine carbamoyltransferase [Rhodobacteraceae bacterium KLH11]
 gi|221534037|gb|EEE37025.1| ornithine carbamoyltransferase [Rhodobacteraceae bacterium KLH11]
          Length = 308

 Score =  217 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 154/308 (50%), Positives = 211/308 (68%), Gaps = 7/308 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNS-----SENIFENKPLSGKVLAMIFEKPSTRTR 59
             HF D+    ++ L  +I+ A  +K +          +++PL   ++A+IFEKPSTRTR
Sbjct: 1   MNHFLDIHKTDAAALRGMIDQAGAMKQARLGRPKAAPDDDQPLKDHMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V ++ +GG T+ LSG +MQLG  ETI DTA+VLSRYVD I++RT + + L E+ EY
Sbjct: 61  VSFDVGVRQMGGQTMVLSGKDMQLGHGETIADTARVLSRYVDMIMIRTFDETILTEMAEY 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LTD THPCQI+AD++T+EEHRG +KGK   W+GDGNN+  S +  A +F + 
Sbjct: 121 SDVPVINGLTDRTHPCQIMADVLTYEEHRGPIKGKKVVWTGDGNNVCASFLHAAGQFGFD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKARE 237
           L    P   +P  E++  AR +G+ + +  D  +AV+GA  V  DTW+SM+  Q  K R 
Sbjct: 181 LTFTGPAQLDPEEEFMGLARQKGSKITIERDPFKAVEGADLVVADTWVSMHDSQSAKERR 240

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
            ++ +P+QVN  LMS A PDALFMHCLPAHR EE  +EV+DGP SV+FDEAENRLH QKA
Sbjct: 241 HNMLRPYQVNADLMSHAKPDALFMHCLPAHREEEATSEVMDGPNSVIFDEAENRLHAQKA 300

Query: 298 ILLWCFGI 305
           ++ WC G+
Sbjct: 301 VMRWCLGV 308


>gi|331083392|ref|ZP_08332504.1| ornithine carbamoyltransferase [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|330404085|gb|EGG83633.1| ornithine carbamoyltransferase [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 332

 Score =  217 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 113/328 (34%), Positives = 171/328 (52%), Gaps = 24/328 (7%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M    +HF  L + +   +  +++++ ++K   +       L GK +A+IFEK STRTR 
Sbjct: 1   MDLKGRHFLTLKDFTKEEIEYLVDLSAELKRKKKQGIPVDTLKGKNVALIFEKTSTRTRS 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFEVA   LG  + +L     Q+G+ E+I DTA+VL R  D I  R     ++ EL +YA
Sbjct: 61  SFEVAAHDLGMGSTYLDPKSSQIGKKESIKDTARVLGRVYDGIEYRGFGQEKVEELAKYA 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNIL-HSLIEGAARFNYL 179
            VPV N LT+  HP Q++AD++T  EH G V+G    + GD    + +SL+   A+    
Sbjct: 121 GVPVWNGLTNEYHPTQMLADLLTIREHLGRVEGVKLVYMGDARYNMGNSLMILCAKIGMH 180

Query: 180 LNIATPIGSEPRN----EYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA 235
                P    P +    E   +A   G ++ L  D ++  KGA  ++TD W+SM +  + 
Sbjct: 181 FVACAPKKYFPNDALVEECKGFAEKSGGTITLTEDVMEGTKGADVIYTDVWVSMGEPEEV 240

Query: 236 REEHVFQ--PFQVNLSLMSMAHPDALFMHCLPAHR-----------------GEEVINEV 276
            EE + +  P++V + +M  A   A+F+HCLPA                     EV +EV
Sbjct: 241 WEERIKELTPYKVTMDVMRNAGEQAIFLHCLPAFHDLQTDIGKEMGEKFGIEDMEVTDEV 300

Query: 277 LDGPQSVVFDEAENRLHTQKAILLWCFG 304
            +  QSVVFDEAENR+HT KA++    G
Sbjct: 301 FESKQSVVFDEAENRMHTIKAVMAATLG 328


>gi|83954535|ref|ZP_00963246.1| ornithine carbamoyltransferase [Sulfitobacter sp. NAS-14.1]
 gi|83840819|gb|EAP79990.1| ornithine carbamoyltransferase [Sulfitobacter sp. NAS-14.1]
          Length = 301

 Score =  217 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 143/306 (46%), Positives = 190/306 (62%), Gaps = 10/306 (3%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSS-----ENIFENKPLSGKVLAMIFEKPSTRTR 59
            KHF D+     ++L  II+ A  +K+S          + +PL   ++A+IFEKPSTRTR
Sbjct: 1   MKHFLDIHQTDPADLRSIIDNAATMKSSRLGRPRGAPDDEQPLKDHMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V ++ +GG T+ LSG++MQLG  ETI DTA+VLSRYVD I++RT   + LLE+ EY
Sbjct: 61  VSFDVGVRQMGGQTMVLSGADMQLGHGETIADTARVLSRYVDLIMIRTFEEATLLEMAEY 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           A+VPVIN LT+ THPCQI+ADIMTFEEH G +KGK   WSGDGNN+  S    A  F++ 
Sbjct: 121 ASVPVINGLTNRTHPCQIMADIMTFEEHSGPIKGKKVVWSGDGNNVFASFAHAAKAFDFE 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L    P   +        A N   +     +            T   +   Q  + R  +
Sbjct: 181 LVFTGPQTLD-----PEAALNGLYTTERDPNKAVEGADLVVTDTWVSMHDPQSARERRHN 235

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             + +QVN +LM+ A PDALFMHCLPAHR +EV + V+DGP SV+FDEAENRLH QK+++
Sbjct: 236 QLRGYQVNDALMAKAKPDALFMHCLPAHRDDEVTSSVMDGPSSVIFDEAENRLHAQKSVM 295

Query: 300 LWCFGI 305
            WC G 
Sbjct: 296 RWCLGK 301


>gi|323703500|ref|ZP_08115146.1| ornithine carbamoyltransferase [Desulfotomaculum nigrificans DSM
           574]
 gi|323531491|gb|EGB21384.1| ornithine carbamoyltransferase [Desulfotomaculum nigrificans DSM
           574]
          Length = 313

 Score =  217 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 129/305 (42%), Positives = 186/305 (60%), Gaps = 5/305 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             + F  L + +   ++ I++ A ++K   +    +  L GK LAMIF+K STRTRVSFE
Sbjct: 9   KGRDFLSLRDFTGREINFILDEAARLKAMQKAGIPHPYLQGKTLAMIFQKSSTRTRVSFE 68

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VAM HLGG  +FLS  ++Q+GR E++ DTA+VLSRYVD I++RT + S + EL EYATVP
Sbjct: 69  VAMLHLGGHALFLSPRDIQMGRGESVPDTARVLSRYVDGIMIRTFSQSEVEELAEYATVP 128

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD THP QI+AD++T +EH+G + G   ++ GDGNNI HSL+ G  +    +++A
Sbjct: 129 VINGLTDLTHPGQILADLLTVKEHKGQLAGLKLAYIGDGNNIAHSLLLGCPKVGMHISVA 188

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN-----QEFKAREE 238
           +P G  P  + +  A+       +  + +     A          +      ++ +   E
Sbjct: 189 SPEGYRPNPDIVTLAKQAAEETGVKVEVISNPVQAITDADVVVTDVWASMGQEQEQKERE 248

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F  +QVN +L + A PD +F+HCLPAHRGEEV  +++DGP S  +DEAENRLH  KA+
Sbjct: 249 QAFAGYQVNQALCAHAKPDYIFLHCLPAHRGEEVTADIIDGPHSAAWDEAENRLHIHKAL 308

Query: 299 LLWCF 303
           L    
Sbjct: 309 LALLL 313


>gi|313497445|gb|ADR58811.1| Ornithine carbamoyltransferase [Pseudomonas putida BIRD-1]
          Length = 306

 Score =  217 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 147/302 (48%), Positives = 196/302 (64%), Gaps = 5/302 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M+  +HF  L + ++  L  +I    ++K+  +     +PL  +VL MIFEK STRTRVS
Sbjct: 1   MSA-RHFLSLLDFTTDELLGVIRRGIELKDLRKRGVLFEPLKNRVLGMIFEKSSTRTRVS 59

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  IFLS  + QLGR E IGD+A VLS  VDA+++RT  HS L E    + 
Sbjct: 60  FEAGMIQLGGQAIFLSPRDTQLGRGEPIGDSAIVLSSMVDAVMIRTHAHSTLTEFAAKSR 119

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN L+D +HPCQ++AD+ TF EHRGS++GK  +W GDG N+ +S IE A +F++ L 
Sbjct: 120 VPVINGLSDESHPCQLLADMQTFVEHRGSIQGKTVTWIGDGFNMCNSYIEAARQFDFQLR 179

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHV 240
           IA P G EP   ++    ++   +    DA +AV+ AH V TD W SM QE + AR    
Sbjct: 180 IACPEGYEPDQRFMALGGDRVQIIR---DAREAVRDAHLVVTDVWTSMGQEEETARRLAH 236

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F P+QV   L+ +A PD LFMHCLPAHRGEE+  ++LD P+SV +DEAENRLH QKA+L 
Sbjct: 237 FAPYQVTRELLDLAAPDVLFMHCLPAHRGEEISQDLLDDPRSVAWDEAENRLHAQKALLE 296

Query: 301 WC 302
           + 
Sbjct: 297 FL 298


>gi|104780409|ref|YP_606907.1| ornithine carbamoyltransferase [Pseudomonas entomophila L48]
 gi|95109396|emb|CAK14096.1| ornithine carbamoyltransferase [Pseudomonas entomophila L48]
          Length = 306

 Score =  217 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 147/302 (48%), Positives = 195/302 (64%), Gaps = 5/302 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M+  +HF  L + ++  L  +I    ++K+  +     +PL  +VL MIFEK STRTRVS
Sbjct: 1   MSA-RHFLSLMDFTADELLGVIRRGIELKDLRKRGVLFEPLKSRVLGMIFEKSSTRTRVS 59

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  IFLS  + QLGR E I D+A VLS  VDA+++RT  HS L E   ++ 
Sbjct: 60  FEAGMIQLGGQAIFLSPRDTQLGRGEPIADSAIVLSSMVDAVMIRTHAHSTLTEFAAHSK 119

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN L+D +HPCQ++AD+ TF EHRGS++GK  +W GDG N+ +S IE A +F++ L 
Sbjct: 120 VPVINGLSDESHPCQLLADMQTFMEHRGSIQGKTVTWVGDGFNMCNSYIEAAVQFDFQLR 179

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHV 240
           I  P G EP   +L     +   +    D  +AV+GAH V TD W SM QE + AR    
Sbjct: 180 ITCPGGYEPDPRFLQLGGERVQIIR---DPKEAVRGAHLVTTDVWTSMGQEEETARRLAH 236

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F P+QV   L+ +A PDALFMHCLPAHRGEE+  ++LD P+SV +DEAENRLH QKA+L 
Sbjct: 237 FAPYQVTRELLDLAAPDALFMHCLPAHRGEEISQDLLDDPRSVAWDEAENRLHAQKALLE 296

Query: 301 WC 302
           + 
Sbjct: 297 FL 298


>gi|289523157|ref|ZP_06440011.1| ornithine carbamoyltransferase [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289503700|gb|EFD24864.1| ornithine carbamoyltransferase [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 314

 Score =  217 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 127/305 (41%), Positives = 177/305 (58%), Gaps = 6/305 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +H   L +     +  ++++A  +K       +   L+GK +A+IFEKPSTRTR +F VA
Sbjct: 8   RHLLWLKDYQPEEIRFLLDLAVSLKEKKRAGVKGNLLAGKNVALIFEKPSTRTRCAFTVA 67

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
               GG   +L  +++QLG  E + DTA+VL R  D I  R    S + EL  +A VPV 
Sbjct: 68  CLDEGGHAEYLGKNDIQLGHKEDVRDTARVLGRMFDGIQFRGFKQSTVEELARFAGVPVW 127

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGD-GNNILHSLIEGAARFNYLLNIAT 184
           N LTD+ HP Q +AD+MT +E+ G VKG    + GD  NN+ +SL+  +++      IA 
Sbjct: 128 NGLTDSYHPTQALADVMTIQENFGDVKGLKLVYVGDGRNNVANSLMIISSKLGMHFVIAA 187

Query: 185 PIGSEPR----NEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEH 239
           P    P      E  +     GA + +F D  +AVKGAH V+TD W SM +E K A    
Sbjct: 188 PKELYPDEALLKECRSEGEKHGAVIEVFEDPREAVKGAHAVYTDVWASMGEEEKLAERIK 247

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           + +P+QVN  LMS+A  DA+F+HCLPA +G EV  EV +  QS VFDEAENRLHT KA++
Sbjct: 248 LLRPYQVNSDLMSLADKDAIFLHCLPAVKGNEVTEEVFESAQSKVFDEAENRLHTIKAVI 307

Query: 300 LWCFG 304
           +   G
Sbjct: 308 VATIG 312


>gi|33594409|ref|NP_882053.1| ornithine carbamoyltransferase [Bordetella pertussis Tohama I]
 gi|33597128|ref|NP_884771.1| ornithine carbamoyltransferase [Bordetella parapertussis 12822]
 gi|33600972|ref|NP_888532.1| ornithine carbamoyltransferase [Bordetella bronchiseptica RB50]
 gi|56404403|sp|Q7VTJ8|OTC_BORPE RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|56404404|sp|Q7W7H7|OTC_BORPA RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|56404405|sp|Q7WKW6|OTC_BORBR RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|33564484|emb|CAE43797.1| ornithine carbamoyltransferase [Bordetella pertussis Tohama I]
 gi|33566579|emb|CAE37836.1| ornithine carbamoyltransferase [Bordetella parapertussis]
 gi|33575407|emb|CAE32484.1| ornithine carbamoyltransferase [Bordetella bronchiseptica RB50]
 gi|332383820|gb|AEE68667.1| ornithine carbamoyltransferase [Bordetella pertussis CS]
          Length = 313

 Score =  217 bits (551), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 119/298 (39%), Positives = 173/298 (58%), Gaps = 1/298 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF    + S + ++ ++E  + IK+  +    + PL  + LAM+FEK STRTRVSFE  
Sbjct: 12  RHFLQFKDFSPAEIAYVLERTRIIKDKFKRYEPHMPLHDRTLAMVFEKASTRTRVSFEAG 71

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  +GG  I L+ ++ QLGR+E I DTA+V+SR VD +++RT   +R+     ++ VPVI
Sbjct: 72  MYQMGGSVINLTSNDSQLGRSEPIEDTARVISRMVDIVMIRTFEQTRIERFASHSRVPVI 131

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI T+ EHRG + GK  +W GD NN+ ++ ++ A    + L+++TP
Sbjct: 132 NGLTNEYHPCQILADIFTYIEHRGPIAGKTVAWIGDANNMSYTWLQAAEMLGFTLHVSTP 191

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G E     +                             T +    E + R    F  + 
Sbjct: 192 AGYELDPARIGAPAAGVLKQFKDPMQACQGAHLVTTDVWTSMGYEAENEERRAA-FADWC 250

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           V+  +M+ A P A+FMHCLPAHRGEEV  EV+DG QSVV+DEAENRLH QKA++ +  
Sbjct: 251 VDAEMMAAADPQAVFMHCLPAHRGEEVTGEVIDGAQSVVWDEAENRLHVQKALMEFLL 308


>gi|330957755|gb|EGH58015.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. maculicola
           str. ES4326]
          Length = 306

 Score =  217 bits (551), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 149/299 (49%), Positives = 197/299 (65%), Gaps = 4/299 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           P+HF  + + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+SFE 
Sbjct: 3   PRHFLSMMDYTPDELLGLIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRLSFEA 62

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M HLGG  IFLS  + QLGR E + D+AKV+SR +DA+++RT  HS L E    + VPV
Sbjct: 63  GMIHLGGQAIFLSHRDTQLGRGEPVADSAKVMSRMLDAVMIRTYAHSNLTEFAANSRVPV 122

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN L+D+ HPCQ++AD+ TF EHRGS+KGK  +W GDGNN+ +S IE A RF++ L +A 
Sbjct: 123 INGLSDDLHPCQLLADMQTFLEHRGSIKGKTVAWIGDGNNMCNSYIEAAIRFDFQLRVAC 182

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQP 243
           P G EP  E++  A   G  V +  D   AV GAH V TD W SM QE + AR + +F P
Sbjct: 183 PAGYEPNPEFMALA---GDRVTVVRDPQAAVSGAHLVSTDVWTSMGQEEETARRKALFAP 239

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           FQV  +L+ +A  D LFMHCLPAHRGEE+  +VLD  +SV +D+AENRLH QKA+L + 
Sbjct: 240 FQVTRALLDLADKDVLFMHCLPAHRGEEISVDVLDDARSVAWDQAENRLHAQKALLEFL 298


>gi|229917792|ref|YP_002886438.1| ornithine carbamoyltransferase [Exiguobacterium sp. AT1b]
 gi|229469221|gb|ACQ70993.1| ornithine carbamoyltransferase [Exiguobacterium sp. AT1b]
          Length = 308

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 124/302 (41%), Positives = 183/302 (60%), Gaps = 7/302 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAM 66
           HF  +  ++   L  ++++A ++K S ++      L+GK +A++FEK STRTR+SFEV +
Sbjct: 8   HFLTMEELTPDTLDSLMQLAHEVKRSPQSYAT--ALTGKKVALLFEKASTRTRMSFEVGV 65

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
             LGG  +FLSG ++Q+GR E + DT +V+SRYVDA+++RT  H  +  L ++ ++P+IN
Sbjct: 66  VELGGYPLFLSGQDLQIGRGEPLTDTIQVMSRYVDALMIRTYAHETVETLAQHGSIPIIN 125

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI 186
            LTD  HPCQ++AD++T EE  GS  GK+ ++ GDGNN+ HSL+ G A     + IA+P 
Sbjct: 126 GLTDLHHPCQVLADLLTIEEQFGSRAGKVLAYIGDGNNMAHSLMIGGALSGMHIRIASPN 185

Query: 187 GSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWI-----SMNQEFKAREEHVF 241
           G    +     A+    S        +    A       +         +         F
Sbjct: 186 GYTVDHAIYEKAQKLATSTGGSIALFENPSLAANEADIVYTDVFASMGQEGEAEERLMKF 245

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
             FQVN  LM++A+PDA+F+HCLPAHRGEEV  +V+DGPQS VFD+AENRLH QKA++L 
Sbjct: 246 NGFQVNKELMALANPDAIFLHCLPAHRGEEVTADVIDGPQSWVFDQAENRLHAQKALMLT 305

Query: 302 CF 303
             
Sbjct: 306 LL 307


>gi|313113040|ref|ZP_07798677.1| ornithine carbamoyltransferase [Faecalibacterium cf. prausnitzii
           KLE1255]
 gi|310624632|gb|EFQ07950.1| ornithine carbamoyltransferase [Faecalibacterium cf. prausnitzii
           KLE1255]
          Length = 304

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 114/301 (37%), Positives = 165/301 (54%), Gaps = 2/301 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            K+   +S +S + L+ I++VA ++K   +       L+GK +A++F K STRTR SFEV
Sbjct: 1   MKNLLKMSGLSPAELTHILDVADQLKAQQKLGGTAPLLAGKTVALMFSKASTRTRTSFEV 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG   +++ +E+Q GR E + DTA+VL RY D +V RT   S L E  E A VPV
Sbjct: 61  GVYQLGGLGNYMNTAELQAGRGEPLKDTARVLGRYYDCVVWRTYRQSDLEEFAELAGVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD  HPCQ++AD+MT  E RGS+ G+   + GDG+++ +SLI G       +    
Sbjct: 121 INGLTDYAHPCQVLADLMTIRERRGSLAGRKLCFVGDGSSMANSLIVGGLLAGMQVTCVC 180

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHC--VFTDTWISMNQEFKAREEHVFQ 242
           P    P  + L +A   G++  L  D  + V+ A                   +    F 
Sbjct: 181 PQSYRPAADVLMFAHKYGSAFHLTADPAEGVQDADVVATAVWNTAKPGTPESEQRLRDFV 240

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            +Q+   L+  A PD + +HCLPAHRGEE+ + V +     +FDEAENRLH QKA+L   
Sbjct: 241 GYQLTNKLLESAKPDVMVLHCLPAHRGEEISSAVFEQHAPEIFDEAENRLHVQKAVLAIL 300

Query: 303 F 303
            
Sbjct: 301 L 301


>gi|320102202|ref|YP_004177793.1| ornithine carbamoyltransferase [Isosphaera pallida ATCC 43644]
 gi|319749484|gb|ADV61244.1| ornithine carbamoyltransferase [Isosphaera pallida ATCC 43644]
          Length = 304

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 113/303 (37%), Positives = 163/303 (53%), Gaps = 3/303 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
            P+H  DL  ++  + + I++ A+ +K           L G+ L +IFEKPS RTRVSFE
Sbjct: 1   MPRHLLDLFELTPDDFTAILDRAEDLKREWSQGQRPARLPGRTLGLIFEKPSLRTRVSFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
            AM HLGG  ++L+  ++ +G  E I D A+VLS Y+DA+ +R   H  +  +  YA VP
Sbjct: 61  TAMVHLGGKGLYLNAEDVGMGSREPIEDCARVLSEYLDALAIRAYRHELIETVARYARVP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINAL+D  HPCQ +AD+MT  E  G + G    + GDGNN+  SL    A     L +A
Sbjct: 121 VINALSDLAHPCQALADMMTLREEFGRLDGLHIVFVGDGNNVARSLAVACALGGARLTLA 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA---REEHV 240
            P      +++    R+ G      H    ++  A      T + ++   +    R    
Sbjct: 181 APPAYAFPDDFAARVRSVGRPDTYDHQPDPSLAVARADAIYTDVWISMGQEEEATRRLSH 240

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           FQ +QV+ +LM+ A   A+F+HCLPA RGEEV   V+DG  S V  +A NR+H QK +L 
Sbjct: 241 FQRYQVDEALMAKAPAHAVFLHCLPARRGEEVTASVIDGSASRVIAQAGNRMHVQKGLLS 300

Query: 301 WCF 303
           W  
Sbjct: 301 WLL 303


>gi|83943962|ref|ZP_00956419.1| ornithine carbamoyltransferase [Sulfitobacter sp. EE-36]
 gi|83845209|gb|EAP83089.1| ornithine carbamoyltransferase [Sulfitobacter sp. EE-36]
          Length = 301

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 143/306 (46%), Positives = 190/306 (62%), Gaps = 10/306 (3%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSS-----ENIFENKPLSGKVLAMIFEKPSTRTR 59
            KHF D+     ++L  II+ A  +K+S          + +PL   ++A+IFEKPSTRTR
Sbjct: 1   MKHFLDIHQTDPADLRSIIDNAATMKSSRLGRPRGAPDDEQPLKDHMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V ++ +GG T+ LSG++MQLG  ETI DTA+VLSRYVD I++RT   + LLE+ EY
Sbjct: 61  VSFDVGVRQMGGQTMVLSGADMQLGHGETIADTARVLSRYVDLIMIRTFEEATLLEMAEY 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           A+VPVIN LT+ THPCQI+ADIMTFEEH G +KGK   WSGDGNN+  S    A  F++ 
Sbjct: 121 ASVPVINGLTNRTHPCQIMADIMTFEEHSGPIKGKKVVWSGDGNNVFASFAHAAKAFDFE 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L    P   +        A N   +     +            T   +   Q  + R  +
Sbjct: 181 LVFTGPQTLD-----PEAALNGLYTTVRDPNKAVEGADLVVTDTWVSMHDPQSARERRHN 235

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             + +QVN +LM+ A PDALFMHCLPAHR +EV + V+DGP SV+FDEAENRLH QK+++
Sbjct: 236 QLRGYQVNDALMAKAKPDALFMHCLPAHRDDEVTSSVMDGPSSVIFDEAENRLHAQKSVM 295

Query: 300 LWCFGI 305
            WC G 
Sbjct: 296 RWCLGK 301


>gi|83721357|ref|YP_441288.1| ornithine carbamoyltransferase [Burkholderia thailandensis E264]
 gi|167580066|ref|ZP_02372940.1| ornithine carbamoyltransferase [Burkholderia thailandensis TXDOH]
 gi|167618132|ref|ZP_02386763.1| ornithine carbamoyltransferase [Burkholderia thailandensis Bt4]
 gi|257140043|ref|ZP_05588305.1| ornithine carbamoyltransferase [Burkholderia thailandensis E264]
 gi|83655182|gb|ABC39245.1| ornithine carbamoyltransferase [Burkholderia thailandensis E264]
          Length = 309

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 122/304 (40%), Positives = 175/304 (57%), Gaps = 3/304 (0%)

Query: 2   MTYP--KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    +H+    + S  +   ++E    +K   +N     PL  + LAMIFEK STRTR
Sbjct: 1   MTAKTIRHYLQFKDFSLEDYEYVLERTGILKRKFKNYETYHPLHDRTLAMIFEKSSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +F+S  + QLGR E + D+A+V+SR VD I++RT     +    E 
Sbjct: 61  LSFEAGIFQLGGHAVFMSTRDTQLGRGEPVEDSAQVISRMVDIIMIRTFEQDIIQRFAEN 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT+  HPCQ++ADI T+ EHRG ++GK  +W GD NN+L++ I+ A   ++ 
Sbjct: 121 SRVPVINGLTNEYHPCQVLADIFTYYEHRGPIRGKTVAWVGDANNMLYTWIQAARILDFK 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L ++TP G     + ++        V    +              T +    E +A  + 
Sbjct: 181 LQLSTPPGYALDAKLVDAESAPFYQVFDDPNEACKGADLVTTDVWTSMGFEAENEA-RKR 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  + V+  +MS A+ DALFMHCLPAHRGEEV   V+DGPQSVV+DEAENRLH QKA++
Sbjct: 240 AFADWCVDEEMMSHANSDALFMHCLPAHRGEEVTAGVIDGPQSVVWDEAENRLHVQKALM 299

Query: 300 LWCF 303
            +  
Sbjct: 300 EFLL 303


>gi|257453403|ref|ZP_05618698.1| ornithine carbamoyltransferase [Enhydrobacter aerosaccus SK60]
 gi|257449155|gb|EEV24103.1| ornithine carbamoyltransferase [Enhydrobacter aerosaccus SK60]
          Length = 306

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 139/303 (45%), Positives = 189/303 (62%), Gaps = 5/303 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M+  +HF  L + S   L  +I+   +++         +P  G+ L MIFEK STRTR+S
Sbjct: 1   MST-RHFLTLLDFSKEELMQVIKRGSELRLMQHEGVIYQPFVGRTLGMIFEKSSTRTRIS 59

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M   GG  IFLS  + QLGR E I D+A+V+SR VD +++RT  HS + +  +Y+ 
Sbjct: 60  FETGMGQFGGHAIFLSPRDTQLGRGEPIEDSARVISRMVDIVMIRTFEHSIVEKFAQYSQ 119

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVINALTD  HPCQ++ADI TF EHRGS++GK  +W GDGNN+  S I  A +F + L 
Sbjct: 120 VPVINALTDEQHPCQLLADIQTFMEHRGSIEGKTVTWIGDGNNMCASFIHAAHQFGFQLR 179

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHV 240
           ++ P G EP  + +   +     V L  D  +AVKG+H V TD W SM QE +       
Sbjct: 180 VSAPYGFEPNADLI---KQYSHCVELVEDVNEAVKGSHLVATDVWASMGQESEQNTRARR 236

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F  + V  SL+  A PD LFMHCLPAHRGEE+  ++L+ P++VV+DEAENRLH QKA++ 
Sbjct: 237 FAQYMVTRSLLDKADPDVLFMHCLPAHRGEEISYDLLEDPRAVVWDEAENRLHAQKALME 296

Query: 301 WCF 303
           +  
Sbjct: 297 FLL 299


>gi|307596126|ref|YP_003902443.1| ornithine carbamoyltransferase [Vulcanisaeta distributa DSM 14429]
 gi|307551327|gb|ADN51392.1| ornithine carbamoyltransferase [Vulcanisaeta distributa DSM 14429]
          Length = 313

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 131/303 (43%), Positives = 189/303 (62%), Gaps = 5/303 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFE-NKPLSGKVLAMIFEKPSTRTRVSFEV 64
           + F  L + ++  +  ++ +++ +K+        +  L GK L MIFEKPSTRTRVS +V
Sbjct: 10  RDFITLMDYTTDEIKYLLGLSRDLKSRYYQGERYSDVLRGKTLLMIFEKPSTRTRVSLDV 69

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           A   LG   I+ +  E+QLGR ETI DTA+V+ R+VDAI  R   H  L+E+ +YA VPV
Sbjct: 70  AATQLGMHVIYSNPQELQLGRGETIADTARVVDRFVDAIAARVYKHESLIEMAKYAVVPV 129

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGD-GNNILHSLIEGAARFNYLLNIA 183
           INAL+D  HP Q++AD +T  E +G + G   ++ GD  NN+ HSL+   A+  + + I 
Sbjct: 130 INALSDREHPLQVLADALTLWEVKGRLDGIKLAFVGDGDNNVAHSLMIIGAKLGWEVRII 189

Query: 184 TPIGSEP--RNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHV 240
           +P    P    E L     +  +  +  D ++ V+G   V+TD W+SM  E +A   + V
Sbjct: 190 SPKKYWPSKFAELLTEDSRRTGANIVISDNIEDVRGVDAVYTDVWVSMGMEAEAEERKKV 249

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+P+QVN  +M  A P A+FMHCLPAHRGEEV ++V+DGPQSVV+D+AENRLHT KA+L+
Sbjct: 250 FRPYQVNAEVMKKAGPQAVFMHCLPAHRGEEVTDDVIDGPQSVVWDQAENRLHTAKAVLI 309

Query: 301 WCF 303
              
Sbjct: 310 SLL 312


>gi|168045637|ref|XP_001775283.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162673364|gb|EDQ59888.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 307

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 138/306 (45%), Positives = 189/306 (61%), Gaps = 3/306 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFEN-KPLSGKVLAMIFEKPSTRTRV 60
           M  P HF  L +     L  I++ A ++K   ++  ++ +PL G  +AMIF KPS RTRV
Sbjct: 1   MKGPTHFLHLDDFDKDTLLHILDRAVEVKARLKSGDKSYQPLKGMSMAMIFTKPSMRTRV 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFE     LGG  I+L  +++QLG+ E   D A+VLS Y D I+ R   H  LL+L EY+
Sbjct: 61  SFETGFYQLGGHAIYLGPNDIQLGKREETRDIARVLSGYNDVIMARLFGHKDLLDLAEYS 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
            +PVIN LTD  HPCQI+AD++T  E  G+++G    + GDGNN++HS +  AA   +  
Sbjct: 121 KIPVINGLTDYNHPCQIMADVLTINEFIGNIEGLKIVYVGDGNNMVHSWLRLAAVLPFHF 180

Query: 181 NIATPIGSEPRNEYLNWARNQ-GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REE 238
             A P G EP    +  AR    + + + HD V+AVKGA+ V+ D W SM Q+  A   +
Sbjct: 181 ICACPRGYEPDAATVERARRAGVSKIEIRHDPVEAVKGANVVYADVWASMGQKEDADNRK 240

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
            VFQ FQVN +LM  A P A FMHCLPA RG E+ + V++GP+S+VF +AENR+H Q AI
Sbjct: 241 SVFQGFQVNEALMKAAGPQAYFMHCLPAERGVEITDGVIEGPKSIVFPQAENRMHAQNAI 300

Query: 299 LLWCFG 304
           +L C G
Sbjct: 301 MLHCLG 306


>gi|326389105|ref|ZP_08210686.1| ornithine carbamoyltransferase [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326206411|gb|EGD57247.1| ornithine carbamoyltransferase [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 308

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 153/310 (49%), Positives = 204/310 (65%), Gaps = 7/310 (2%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSE-----NIFENKPLSGKVLAMIFEKPST 56
           MT  +HF +LS+  +  L  I+  A   K + +         + PL+G VLAM+FEK ST
Sbjct: 1   MT--RHFLNLSDAGADALKAILGDAVARKAARQGLPKGRPDADAPLAGHVLAMVFEKNST 58

Query: 57  RTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLEL 116
           RTRVSF+VAM+ LGG  + L     QLGR ETI DTA+VLSR  DAI++RT +H+++ EL
Sbjct: 59  RTRVSFDVAMRQLGGSAVILEAGSTQLGRGETIADTARVLSRMADAIMLRTDDHAKVEEL 118

Query: 117 TEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARF 176
             YATVPVIN LTD +HPCQI+AD+ T  E    + G  ++W GDGNN+L+S++E A   
Sbjct: 119 AHYATVPVINGLTDLSHPCQIVADLQTVIERGKPLAGLEWAWLGDGNNVLNSIVEAAGLA 178

Query: 177 NYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR 236
            + L I  P G +    ++  A+  G+++ +  DA +AV GA  V TDTW+SM Q     
Sbjct: 179 GFNLRIGVPEGYDSDPGFIARAQAAGSTIRVTRDAAEAVAGADVVVTDTWVSMGQAHAEE 238

Query: 237 EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
           +    +PFQVN +LM+ A  DA+F+HCLPAHRGEEV +EV+DG QS V+DEAENR+H QK
Sbjct: 239 KLAAMEPFQVNGALMAKAASDAVFLHCLPAHRGEEVTDEVIDGAQSAVWDEAENRIHAQK 298

Query: 297 AILLWCFGII 306
           AIL W FG I
Sbjct: 299 AILRWAFGQI 308


>gi|253996738|ref|YP_003048802.1| ornithine carbamoyltransferase [Methylotenera mobilis JLW8]
 gi|253983417|gb|ACT48275.1| ornithine carbamoyltransferase [Methylotenera mobilis JLW8]
          Length = 305

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 127/307 (41%), Positives = 176/307 (57%), Gaps = 3/307 (0%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           MM   KHF   ++++   L  + E  + IK+  ++  +  PL  + L MIFEK STRTR+
Sbjct: 1   MMAI-KHFLQFNDLNRDELEYVFERTRWIKSQFKDYQQYWPLQDRTLVMIFEKASTRTRL 59

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFE  M+ LGG  I+L+  + QLGR E + D A+V+SR  D +++RT     +      +
Sbjct: 60  SFEAGMQQLGGSAIYLNTRDSQLGRGEPVEDAAQVISRMSDLVMIRTFEQEIIERFAANS 119

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
            VPVIN LT+  HPCQI+ADI T+ EHRGS+KGK  +W GD NN+ H+ ++ A   ++ +
Sbjct: 120 RVPVINGLTNEYHPCQILADIFTYIEHRGSIKGKTVAWIGDSNNMCHTWLQAAELLDFNV 179

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
           +++TP G E   E  N        V                   T +    E +      
Sbjct: 180 HVSTPPGYEVEPERANLYGTDHFEVFADPMDAARGADLVTTDVWTSMGFEAENEE-RMRD 238

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL- 299
           F  +QV+  +M +A  DALFMHCLPAHRGEEV  EV+DG QSVV+DEAENRLHTQKA++ 
Sbjct: 239 FADWQVDSDMMRVAAKDALFMHCLPAHRGEEVSAEVIDGMQSVVWDEAENRLHTQKALME 298

Query: 300 LWCFGII 306
               G I
Sbjct: 299 YLLLGKI 305


>gi|194014774|ref|ZP_03053391.1| ornithine carbamoyltransferase [Bacillus pumilus ATCC 7061]
 gi|194013800|gb|EDW23365.1| ornithine carbamoyltransferase [Bacillus pumilus ATCC 7061]
          Length = 316

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 140/305 (45%), Positives = 201/305 (65%), Gaps = 9/305 (2%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
           Y K F  L + S ++++ +IE A+++K +           GK LAMIFEK STRTRVSFE
Sbjct: 11  YGKDFLSLKDFSINDIAYLIEKAEEMKQNPYQ----DLFKGKTLAMIFEKSSTRTRVSFE 66

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
             M  LGG  +FLS +++Q+GR ETI DTA+VLS YVD I++RT  H ++ EL +YA++P
Sbjct: 67  AGMTQLGGHALFLSSNDLQIGRGETISDTAQVLSGYVDGIMIRTFEHEKVEELAQYASIP 126

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD +HPCQ +AD++T +E +G++KG   ++ GDGNN+ HSL+ G A+    + +A
Sbjct: 127 VINGLTDYSHPCQALADLLTIKEAKGTLKGIKVAYIGDGNNVAHSLMVGCAQLGCDIAVA 186

Query: 184 TPIGSEPRNEYLN----WARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREE 238
           +P G EP  E  +    +A+  GA V +  D V AV+ A  +++D + SM QE +  +  
Sbjct: 187 SPKGYEPLQEVTDTAREFAKQSGAEVIVTTDPVAAVQNADVIYSDVFTSMGQEAETEKRL 246

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F+ +QVN +LM  A  D +F+HCLPAHRGEEV  +++DGP S VF +AENRLH QKA+
Sbjct: 247 AEFKEYQVNDALMRHAAKDYIFLHCLPAHRGEEVTADIIDGPHSKVFQQAENRLHVQKAL 306

Query: 299 LLWCF 303
           +    
Sbjct: 307 IKELM 311


>gi|262279368|ref|ZP_06057153.1| ornithine carbamoyltransferase [Acinetobacter calcoaceticus
           RUH2202]
 gi|262259719|gb|EEY78452.1| ornithine carbamoyltransferase [Acinetobacter calcoaceticus
           RUH2202]
          Length = 304

 Score =  216 bits (549), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 133/298 (44%), Positives = 180/298 (60%), Gaps = 2/298 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++S+  L+ I+E A ++K    +    +P  GKVL MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLRDLSTLELNRILERASELKKMQHDNKVFQPFVGKVLGMIFEKSSTRTRISFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +   GG  IFLS  + QLGR E I D+A+V+S  +D +++RT  H  +     Y+ VPVI
Sbjct: 64  INQFGGSAIFLSPRDTQLGRGEPIEDSARVISSMLDIVMIRTFGHDIVERFASYSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ++AD+ T+ EHRGS+KGK  +W GDGNN+ +S IE A    + L IA+P
Sbjct: 124 NGLTDDHHPCQLLADLQTYNEHRGSIKGKTVAWIGDGNNMCNSYIEAAHMMGFKLKIASP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G EP+ E+L    +         DA             +     +E +   E  F  FQ
Sbjct: 184 KGYEPKPEFLAEFGHCVEVFDNAEDAAVNADLIVTDVWASM--GQEEEQKLRERAFAAFQ 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN  LM +AHPD LFMHCLPAHRGEE+   +LD   +VV+DEAENRLH QKA++ +  
Sbjct: 242 VNEKLMGLAHPDCLFMHCLPAHRGEEISETMLDHKNAVVWDEAENRLHAQKALMEFLL 299


>gi|295102554|emb|CBL00099.1| ornithine carbamoyltransferase [Faecalibacterium prausnitzii L2-6]
          Length = 305

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 115/302 (38%), Positives = 164/302 (54%), Gaps = 3/302 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH   + +++   ++ I++VA ++K   +       L GK +A++F K STRTR SFEV
Sbjct: 1   MKHLLKMGDLTPDEVAHILDVADELKAQQKAGGTGPLLKGKSVALMFSKNSTRTRTSFEV 60

Query: 65  AMKHLGGDTIFLSGSEM-QLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
            +  LGG   +++ +   Q GR E + DTA+VL RY D +V RT   S L E  E+A VP
Sbjct: 61  GVYQLGGLGNYMNAATELQSGRGEPLKDTARVLGRYYDCVVWRTYRQSDLEEFAEFAGVP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQ++AD+MT  E RG++ G+   + GDG+N+ +SLI G       ++  
Sbjct: 121 VINGLTDYAHPCQVLADLMTIRERRGALAGQKLCFVGDGSNMANSLIVGGLLSGMKVDCV 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFT--DTWISMNQEFKAREEHVF 241
            P G  P  + L +A   G++  L  D  + VK A  V T      +            F
Sbjct: 181 CPHGYRPAADVLMFAHKYGSAFRLLEDPSEGVKDADVVVTAVWNTAAPGTSESESRLRDF 240

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
             FQ+   L+  A PD + +HCLPAHRGEE+   V +     +F EAENRLH QKA+L  
Sbjct: 241 AGFQLTSGLLKAAKPDCMVLHCLPAHRGEEISTAVFEAHADEIFTEAENRLHVQKAVLAV 300

Query: 302 CF 303
             
Sbjct: 301 LL 302


>gi|262372672|ref|ZP_06065951.1| ornithine carbamoyltransferase [Acinetobacter junii SH205]
 gi|262312697|gb|EEY93782.1| ornithine carbamoyltransferase [Acinetobacter junii SH205]
          Length = 306

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 134/298 (44%), Positives = 181/298 (60%), Gaps = 2/298 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++SS  L  I++ A ++K    +    +P  GKVL MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLRDLSSLELQRILDRAHELKRMQHSNTVFQPFVGKVLGMIFEKSSTRTRISFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +   GG+ IFLS  + QLGR E I D+A+V+S  +D +++RT  H  +     Y+TVPVI
Sbjct: 64  ICQFGGNAIFLSPRDTQLGRGEPIEDSARVISSMLDIVMIRTFGHDIVERFASYSTVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ++AD+ T+EEHRGS+KG+  +W GDGNN+ +S IE A    + L IA+P
Sbjct: 124 NGLTDDHHPCQLLADLQTYEEHRGSIKGRTVAWIGDGNNMCNSYIEAAHMMGFKLKIASP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G EP+ E+L    +         DA             +     +E +   E  F  FQ
Sbjct: 184 EGYEPKPEFLAEFADCVEVFNKAEDAAVNADLIVTDVWASM--GQEEEQKLREKAFADFQ 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN  LM +AHPD LFMHCLPAHRGEE+   +LD   SVV+ EAENRLH QKA++ +  
Sbjct: 242 VNEKLMDLAHPDCLFMHCLPAHRGEEISENMLDHKNSVVWSEAENRLHAQKALMEFLL 299


>gi|218439604|ref|YP_002377933.1| ornithine carbamoyltransferase [Cyanothece sp. PCC 7424]
 gi|218172332|gb|ACK71065.1| ornithine carbamoyltransferase [Cyanothece sp. PCC 7424]
          Length = 309

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 124/305 (40%), Positives = 189/305 (61%), Gaps = 10/305 (3%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    ++++S S +  ++++A ++K   +      P+  K+L ++F K STRTRVSF  A
Sbjct: 9   KDILSIADLSPSQILDLLQLATELKKGDKK-----PVCNKILGLLFYKASTRTRVSFTTA 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  I L+ S  Q+GR E I DTA+VL RY+D + +RT     L    +YA +P+I
Sbjct: 64  MYQLGGQVIDLNPSVTQVGRGEPISDTARVLDRYLDLLAIRTFKQEDLQTFADYADIPII 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NAL+D  HPCQI+AD++T +E+ G++ G   S+ GDGNN+ HSL+ G A     + IATP
Sbjct: 124 NALSDLEHPCQILADLLTIQENFGTLSGITLSYLGDGNNVAHSLLLGGALMGMKIRIATP 183

Query: 186 IGSEPRNEYLNWARNQGASVA----LFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHV 240
              +P ++ +  A+   +S         D ++A      ++TD W SM QE  A     V
Sbjct: 184 NHYKPNSDMIEKAKEFASSNGGDVLWTEDPIEATAQTQVLYTDVWASMGQEDSADSRIPV 243

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           FQP+Q+N +L++ AH +A+ +HCLPAHRGEE+   V++G QS V+D+AENR+H QKA+++
Sbjct: 244 FQPYQLNEALLTHAHKEAIVLHCLPAHRGEEITQGVIEGKQSRVWDQAENRMHAQKALMV 303

Query: 301 WCFGI 305
              G+
Sbjct: 304 SVLGL 308


>gi|119384771|ref|YP_915827.1| ornithine carbamoyltransferase [Paracoccus denitrificans PD1222]
 gi|254772729|sp|A1B3N7|OTC_PARDP RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|119374538|gb|ABL70131.1| ornithine carbamoyltransferase [Paracoccus denitrificans PD1222]
          Length = 308

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 160/308 (51%), Positives = 212/308 (68%), Gaps = 7/308 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFE-----NKPLSGKVLAMIFEKPSTRTR 59
              F D+ N   S+L  +I+ A+++K++     +     + PL  +++A+IFEKPSTRTR
Sbjct: 1   MNSFLDIHNTDRSDLRGMIDSARRMKDARSGQPKGTPDADLPLKNRMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF++ ++ +GG T+ LSG EMQLG  ETI DTA+VLSRYVD I++RT   + LLE+ EY
Sbjct: 61  VSFDLGVRQMGGQTMVLSGKEMQLGHGETIADTARVLSRYVDLIMIRTFEEATLLEMAEY 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           A+VPVIN LT+ THPCQ++AD+MTFEEHRG + GK   WSGDGNN+  S+I  A +F Y 
Sbjct: 121 ASVPVINGLTNRTHPCQVMADVMTFEEHRGPIAGKKVVWSGDGNNVCCSMIHAAGQFGYD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
                P   +P  E L++AR QG    +  D  +AV+GA  V TDTW+SM+    ARE  
Sbjct: 181 FTFTGPPTLDPEREALDFARAQGVQAVIERDPAKAVEGADLVVTDTWVSMHDPQSARERR 240

Query: 240 VFQ--PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
             Q  P+QVN +LM+ A PDALFMHCLPAHR +E  + V+DGP SV+FDEAENRLH QKA
Sbjct: 241 HNQLRPYQVNEALMAHAKPDALFMHCLPAHRDDEATSAVMDGPNSVIFDEAENRLHAQKA 300

Query: 298 ILLWCFGI 305
           I+ WC G+
Sbjct: 301 IMRWCLGL 308


>gi|225850183|ref|YP_002730417.1| ornithine carbamoyltransferase [Persephonella marina EX-H1]
 gi|225645847|gb|ACO04033.1| ornithine carbamoyltransferase [Persephonella marina EX-H1]
          Length = 302

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 125/304 (41%), Positives = 189/304 (62%), Gaps = 7/304 (2%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             + F ++S+++   +  IIE A K+K       +++ L GK + +IF KPSTRTR+SFE
Sbjct: 1   MKRDFLNISDLNRDEIFQIIEYAVKLKKG---EIKDQTLKGKSIGLIFMKPSTRTRLSFE 57

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V +  +GG  I++ GS  Q+ R E I DT +V+SRY+D IV+RT +HS + EL+ Y   P
Sbjct: 58  VGVYQMGGQPIYIQGSSTQMSRGEDIKDTGRVMSRYLDGIVIRTYSHSEVEELSRYFDKP 117

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINALTD  HPCQI+AD+ T  E  G ++G   ++ GDGNN+ ++ +       + +++A
Sbjct: 118 VINALTDYLHPCQILADLQTIYERLGKIEGIKVAFVGDGNNVANTWLIAGGLVGFNVSVA 177

Query: 184 TPIGSEPRNEYLNWARNQGAS----VALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           TP G EP  + +  A          + + +D V+AVK A  V+TD W+SM QE +  ++ 
Sbjct: 178 TPEGYEPSGKAVYEAFKLSEKSGAEIQITNDPVEAVKEADVVYTDVWVSMGQEGEKEKKE 237

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           +F+ F VN  L+S A  + + MHCLPAH+GEE+  ++ +    V+FDEAENRLH QKA++
Sbjct: 238 LFKGFTVNSDLLSHASKNVIVMHCLPAHKGEEITEDIFEKYSDVIFDEAENRLHAQKALM 297

Query: 300 LWCF 303
              F
Sbjct: 298 SLLF 301


>gi|89900904|ref|YP_523375.1| ornithine carbamoyltransferase [Rhodoferax ferrireducens T118]
 gi|89345641|gb|ABD69844.1| ornithine carbamoyltransferase [Rhodoferax ferrireducens T118]
          Length = 302

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 123/299 (41%), Positives = 181/299 (60%), Gaps = 1/299 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH+   S++++ + + + E A  IK   +   ++ PL+ + LAMIFEK STRTRVSFE 
Sbjct: 1   MKHYLQFSDLTALDYAYLFERAALIKKKFKAYEKHHPLADRTLAMIFEKASTRTRVSFEA 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  +GG  + L+  + QLGRAE I D+AKV+SR VD +++RT   +++    +++ VPV
Sbjct: 61  GMYQMGGSVVHLTTGDSQLGRAEPIEDSAKVISRMVDLVMIRTFEQTKIERFAQHSRVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LT+  HPCQI+ADI T+ EHRGS+ GK  +W GDGNN+ ++ ++ +    + ++++T
Sbjct: 121 INGLTNEFHPCQILADIFTYIEHRGSIAGKTVAWVGDGNNMANTWLQASEILGFKVHVST 180

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P G E          +    V        A          T +    E +A  +  F  +
Sbjct: 181 PGGYEVDQSIAGLRSSDSYRVFQDPMQACAGADLVTTDVWTSMGFEAENEA-RKVAFADW 239

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
            V+L +M  A PDALFMHCLPAHRGEEV  EV+DG QSVV++EAENR+H QKA++ +  
Sbjct: 240 CVDLDMMHAAKPDALFMHCLPAHRGEEVQAEVIDGAQSVVWEEAENRMHVQKALMEYLL 298


>gi|197301327|ref|ZP_03166412.1| hypothetical protein RUMLAC_00058 [Ruminococcus lactaris ATCC
           29176]
 gi|197299645|gb|EDY34160.1| hypothetical protein RUMLAC_00058 [Ruminococcus lactaris ATCC
           29176]
          Length = 697

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 108/328 (32%), Positives = 167/328 (50%), Gaps = 24/328 (7%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M    ++F  L + +   ++ +I++A  +K   +         GK +A+IFEK STRTR 
Sbjct: 368 MNLKGRNFLTLKDFTPEEITYLIDLAADLKEKKKKGIPVDHYRGKNVALIFEKTSTRTRC 427

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           +FEVA   +G  T +L  S  Q+G+ E+I DTA+VL R  D I  R      + +L +YA
Sbjct: 428 AFEVAAHDMGMGTTYLDPSGSQIGKKESIEDTARVLGRMFDGIEYRGYGQEIVEDLAKYA 487

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
            VPV N LT+  HP Q++AD++T  EH G +KG    + GD    + + +  A     + 
Sbjct: 488 GVPVWNGLTNEYHPTQMLADMLTIREHFGELKGLKLVYMGDARYNMGNSLMIACSKLGMD 547

Query: 181 NIATPIGSEPRNE-----YLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA 235
            +A        NE        +A+  GA + L  D  +  K A  ++TD W+SM +  + 
Sbjct: 548 FVACTTKEYFPNEELVATCRGYAKESGARITLTEDVKEGTKDADIIYTDVWVSMGEPDEV 607

Query: 236 REEHVFQ--PFQVNLSLMSMAHPDALFMHCLPAHR-----------------GEEVINEV 276
            E+ + +  P++V   +M+ A   A+F+HCLPA                     EV +EV
Sbjct: 608 WEKRIKELSPYKVTKEVMANAKESAIFLHCLPAFHDLKTKIGAAMYEKFGVKDMEVTDEV 667

Query: 277 LDGPQSVVFDEAENRLHTQKAILLWCFG 304
            +  QS VFDEAENR+HT KA+++   G
Sbjct: 668 FESAQSKVFDEAENRMHTIKAVMVATLG 695


>gi|113869017|ref|YP_727506.1| ornithine carbamoyltransferase [Ralstonia eutropha H16]
 gi|113527793|emb|CAJ94138.1| ornithine carbamoyltransferase [Ralstonia eutropha H16]
          Length = 307

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 118/304 (38%), Positives = 171/304 (56%), Gaps = 2/304 (0%)

Query: 1   MMTYP-KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           M + P KH+   S+ +      +++ A+ +K   +N     PL  + LAMIFEK STRTR
Sbjct: 1   MSSTPIKHYLQFSDFTPDEYEYLLDRARILKAKFKNYETWHPLHDRTLAMIFEKNSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +FL+  + QLGR E I D A+V+SR VD I++RT     +     +
Sbjct: 61  LSFEAGIHQLGGHAVFLNTRDSQLGRGEPIEDAAQVISRMVDIIMIRTFGQDIIERFAAH 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT+  HPCQ++AD+ T+ E RGS++GK  +W GD NN+ ++ I+ A R  + 
Sbjct: 121 SRVPVINGLTNEYHPCQVLADVFTYIEQRGSIRGKTVAWIGDANNMAYTWIQAAERLGFT 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
            + + P G +     +  +      V                   T +    E  A  + 
Sbjct: 181 FHFSAPPGYQLDPAMVPASAAGLVKVFDDPLTACQGASLVTTDVWTSMGFEAENDA-RKR 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ + V   +M  A PDALFMHCLPAHRGEEV   V+DGP+SVV++EAENRLH QKA++
Sbjct: 240 AFKDWMVTTPMMDRAAPDALFMHCLPAHRGEEVEAAVIDGPKSVVWEEAENRLHVQKALM 299

Query: 300 LWCF 303
            +  
Sbjct: 300 EYLL 303


>gi|242310578|ref|ZP_04809733.1| ornithine carbamoyltransferase [Helicobacter pullorum MIT 98-5489]
 gi|239522976|gb|EEQ62842.1| ornithine carbamoyltransferase [Helicobacter pullorum MIT 98-5489]
          Length = 306

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 125/303 (41%), Positives = 181/303 (59%), Gaps = 6/303 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            +HF  L++ S   +  I+++A  +K   +    +  L  K L MIFEK STRTRVSFE 
Sbjct: 1   MRHFLTLADFSKEEILEILQIAATLKKDLKAGKTSNLLEKKTLGMIFEKNSTRTRVSFET 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG  IFLS ++ QLGR E I DTA+VLS  VD I+MRT  HSRL E   Y+ +PV
Sbjct: 61  GIYQLGGQGIFLSSNDTQLGRGEPIKDTARVLSSMVDLIMMRTHEHSRLEEFAHYSKIPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN L+D+ HP Q++AD +T +      +  + ++ GDGNN+ HS +  AA+  + L IA+
Sbjct: 121 INGLSDSFHPMQLLADYLTMQ-ECQKDQNPIVAYIGDGNNMAHSWLMLAAKLGFELRIAS 179

Query: 185 PIGSEPRNEYLNWARNQGASV----ALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREEH 239
           P G E   +    A+           L  +  +AV  A  + TDTW SM  +  K   + 
Sbjct: 180 PKGYEVCQKIFQKAQEFAKISGAKLILTQNPQEAVLNADVITTDTWASMGQEREKETRKK 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ + V+ +LM+++  D++F+HCLPA+RG+EV  EVL+  QS +F EAENRLH QK ++
Sbjct: 240 AFEGYCVDKNLMNLSKKDSIFLHCLPAYRGQEVSEEVLESTQSKIFLEAENRLHAQKGVM 299

Query: 300 LWC 302
           +W 
Sbjct: 300 VWL 302


>gi|124028062|ref|YP_001013382.1| ornithine carbamoyltransferase [Hyperthermus butylicus DSM 5456]
 gi|189036326|sp|A2BM26|OTC_HYPBU RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|123978756|gb|ABM81037.1| Ornithine carbamoyltransferase [Hyperthermus butylicus DSM 5456]
          Length = 314

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 138/307 (44%), Positives = 185/307 (60%), Gaps = 7/307 (2%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKP-LSGKVLAMIFEKPSTRTRVSF 62
           Y +    + ++SS  +  +IE A+++K          P L GK +A+IFEKPSTRTRVS 
Sbjct: 6   YGRDLLSIRDLSSEEVWLVIETARQMKLRYYAGERIIPMLKGKTIALIFEKPSTRTRVSM 65

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           EVA   LG   +     E+QL R E I DTA+VLSRYVDAI  R   H  L E+  YA+V
Sbjct: 66  EVAALQLGATPLTFRRDELQLARGEPIKDTARVLSRYVDAIAARVFKHESLEEMAAYASV 125

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGD-GNNILHSLIEGAARFNYLLN 181
           PVIN L+D  HP Q +AD +T  E +G +KG    + GD  NN+ HSL+   A+    + 
Sbjct: 126 PVINMLSDLEHPLQALADALTIYEKKGHIKGIKVVYVGDGRNNVAHSLLLVIAKLGGHIV 185

Query: 182 IATPIGSEPRNEYLNWAR----NQGASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAR 236
           I++P    PR + L  A+      GA++ L  D  +AV+GA  V+TD W+SM  +     
Sbjct: 186 ISSPKELTPRKDILEAAQLAAKETGATIELIEDPAEAVRGADVVYTDVWVSMGEESLAEE 245

Query: 237 EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
              + Q +QVN  LMS+A  +A+FMHCLPAHRGEEV  EV++GP SVV+D+AENRLH QK
Sbjct: 246 RRRLLQRYQVNEKLMSLASNNAIFMHCLPAHRGEEVTEEVIEGPWSVVWDQAENRLHAQK 305

Query: 297 AILLWCF 303
           A+L    
Sbjct: 306 AVLALIL 312


>gi|253827617|ref|ZP_04870502.1| Ornithine carbamoyltransferase [Helicobacter canadensis MIT
           98-5491]
 gi|253511023|gb|EES89682.1| Ornithine carbamoyltransferase [Helicobacter canadensis MIT
           98-5491]
          Length = 306

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 125/303 (41%), Positives = 179/303 (59%), Gaps = 6/303 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            +HF  L++ S   +  I+++AK +K   +    +  L  K L MIFEK STRTRVSFE 
Sbjct: 1   MRHFLTLADFSKQEILEILDIAKSLKKDLKAGKYSNLLERKTLGMIFEKNSTRTRVSFET 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG  IFLS +E QLGR E I DT++VLS  VD I+MRT  H+RL E   Y+++PV
Sbjct: 61  GIYQLGGQGIFLSSNETQLGRGEPIKDTSRVLSSMVDLIMMRTHEHARLEEFAHYSSIPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN L+D+ HP Q++AD +T +      K  + ++ GDGNN+ HS +  AA+  + L IA+
Sbjct: 121 INGLSDSFHPMQLLADYLTMQ-ECQKDKNPIVTYVGDGNNMAHSWLMLAAKMGFELRIAS 179

Query: 185 PIGSEPRNEYLNWARNQGASV----ALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEH 239
           P   E   +    AR           + ++  +A+  A  V TDTW SM QE +    + 
Sbjct: 180 PKNYEVSPDIYQKAREFAKISGAKLIVTNNPQEALANADVVTTDTWASMGQENEKEARKK 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ + +    M +A PD +F+HCLPA+R +EV  EVL+  QS +F EAENRLH QK ++
Sbjct: 240 AFKGYCITKDSMQLAKPDCIFLHCLPAYREQEVSEEVLESSQSKIFLEAENRLHAQKGVM 299

Query: 300 LWC 302
           +W 
Sbjct: 300 VWL 302


>gi|254451074|ref|ZP_05064511.1| ornithine carbamoyltransferase [Octadecabacter antarcticus 238]
 gi|198265480|gb|EDY89750.1| ornithine carbamoyltransferase [Octadecabacter antarcticus 238]
          Length = 301

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 140/305 (45%), Positives = 193/305 (63%), Gaps = 10/305 (3%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFE-----NKPLSGKVLAMIFEKPSTRTR 59
             HF D+   S ++L  II++A  +K +   + +     ++PL+  ++A+IFEKPSTRTR
Sbjct: 1   MTHFLDIHTTSPADLRGIIDMAASMKTARAGLPKGTPDADQPLANHMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SF+V ++ +GG+T+ LSG +MQLG  ETI DTA+VLSRYVD I++RT     LLE+ EY
Sbjct: 61  ISFDVGVRQMGGETMVLSGKDMQLGHGETIADTARVLSRYVDLIMIRTFEEQTLLEMAEY 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           A+VPVIN LTD THPCQI+ADI+TFEEH G +KGK   WSGDGNN+  S    A +F++ 
Sbjct: 121 ASVPVINGLTDRTHPCQIMADILTFEEHSGPIKGKKVVWSGDGNNVFASFAHAAKQFDFD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L    P   +        A +   +     D            T   +   Q  + R  +
Sbjct: 181 LVFTGPETLQ-----PEAALDGLYTTERNPDIAVQGADLVVTDTWVSMHDPQSARERRHN 235

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             + +QVN  LM+ A PDALFMHCLPAHR +E  +EV+DGP+SV++DEAENR+H QKA+L
Sbjct: 236 QLRGYQVNAGLMAKAKPDALFMHCLPAHRDDEATSEVMDGPRSVIWDEAENRMHAQKAVL 295

Query: 300 LWCFG 304
            +C G
Sbjct: 296 RYCLG 300


>gi|148244567|ref|YP_001219261.1| ornithine carbamoyltransferase [Candidatus Vesicomyosocius okutanii
           HA]
 gi|146326394|dbj|BAF61537.1| ornithine carbamoyltransferase [Candidatus Vesicomyosocius okutanii
           HA]
          Length = 299

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 133/300 (44%), Positives = 191/300 (63%), Gaps = 2/300 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             KHF +L+++S+ +L+ II+ A K+K   ++   NK L  K LAMIF+K STRTRVSFE
Sbjct: 1   MIKHFINLNDLSNYDLTQIIKQAIKLKEQYKSGKINKALENKTLAMIFDKSSTRTRVSFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
             M  LGG  +FLS  ++QLGR E I D+A V+S  VDAI++R ++H  +   +E+++VP
Sbjct: 61  AGMTQLGGRALFLSDKDIQLGRGEPIIDSAIVISSMVDAIMIRVSSHEDIQTFSEHSSVP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           +INAL+D +HPCQ++AD+MT++E+ GS+  K  +W GDGNN+ H+ I+ A  FN+ LNIA
Sbjct: 121 IINALSDESHPCQLLADMMTYQEYNGSIANKTVAWIGDGNNMCHTYIQAAKSFNFKLNIA 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQP 243
            P   +P   ++    N          A + V         +     +  + + E  F+ 
Sbjct: 181 APKNYQPNQSFIEKYANHIHLFTDIKTACKEVDLIVTDVWASM--GQETEQIKREIAFKD 238

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           FQV+  LMS A P A+FMHCLPAHRG+EV   V+D  QS+V+ EAENRLH QKA+LL+  
Sbjct: 239 FQVDTVLMSKAKPTAVFMHCLPAHRGKEVSANVIDSNQSLVWSEAENRLHVQKALLLYLL 298


>gi|78067354|ref|YP_370123.1| ornithine carbamoyltransferase [Burkholderia sp. 383]
 gi|123567786|sp|Q39DI7|OTC_BURS3 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|77968099|gb|ABB09479.1| ornithine carbamoyltransferase [Burkholderia sp. 383]
          Length = 309

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 122/304 (40%), Positives = 173/304 (56%), Gaps = 3/304 (0%)

Query: 2   MTYP--KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    +H+   ++ S  +   ++E    +K   +N     PL  + LAMIFEK STRTR
Sbjct: 1   MTAKTIRHYLQFTDFSLEDYEYVLERTGILKRKFKNYETYHPLHDRTLAMIFEKSSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +F+S  + QLGR E + D+A+V+SR VD I++RT     +    + 
Sbjct: 61  LSFEAGIFQLGGHAVFMSTRDTQLGRGEPVEDSAQVISRMVDIIMIRTFEQEVIKRFADN 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT+  HPCQ++ADI T+ EHRG + GK  +W GD NN+L++ IE A    + 
Sbjct: 121 SRVPVINGLTNEYHPCQVLADIFTYYEHRGPIAGKTVAWVGDANNMLYTWIEAAQILGFK 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L ++TP G     + ++        V    +              T +    E +A    
Sbjct: 181 LRLSTPPGYALDMKLVSPDSAPFYEVFEDPNEACKGADLVTTDVWTSMGFEAENEA-RMQ 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  + V+  +M  A+PDALFMHCLPAHRGEEV   V+DGPQSVV+DEAENRLH QKA++
Sbjct: 240 AFADWCVDEEMMGHANPDALFMHCLPAHRGEEVTAGVIDGPQSVVWDEAENRLHVQKALM 299

Query: 300 LWCF 303
            +  
Sbjct: 300 EFLL 303


>gi|317152964|ref|YP_004121012.1| ornithine carbamoyltransferase [Desulfovibrio aespoeensis Aspo-2]
 gi|316943215|gb|ADU62266.1| ornithine carbamoyltransferase [Desulfovibrio aespoeensis Aspo-2]
          Length = 300

 Score =  215 bits (548), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 141/300 (47%), Positives = 191/300 (63%), Gaps = 4/300 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
            PK+F  + ++       ++  AK++K+          L+GK L +IFEK STRTRVSFE
Sbjct: 1   MPKNFLTILDMPRDEARQVLLRAKEMKDGK---VRTDLLAGKTLLLIFEKASTRTRVSFE 57

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V ++ LGGD +F++  + QLGR+E + DTA+VLSRY D +++RT    +L  L +Y T+P
Sbjct: 58  VGVRQLGGDPVFITSRDSQLGRSEPLKDTARVLSRYADGLIVRTFGQEKLETLVKYGTIP 117

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINALTD  HPCQI++D++T  E   S+     +W GDGNN+ HS I  AA F + L++A
Sbjct: 118 VINALTDEYHPCQIMSDVLTMYERTPSLDEIKVAWIGDGNNMAHSFINAAATFGFALSLA 177

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQ 242
            P G  P    L+ AR+ GA + L  D  +AV GAH V TD W SM QE +  + E  F 
Sbjct: 178 CPAGYLPDQGILDKARSLGADITLTDDPARAVAGAHYVNTDVWASMGQEEEQKKREAAFA 237

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            + V+  LM+ A P A FMHCLPAHRGEEV   V +GP S+V+D+AENRLH QKAI+ W 
Sbjct: 238 GYAVDDVLMAKAAPGACFMHCLPAHRGEEVSEAVFEGPASIVWDQAENRLHMQKAIIEWI 297


>gi|288553455|ref|YP_003425390.1| ornithine carbamoyltransferase [Bacillus pseudofirmus OF4]
 gi|288544615|gb|ADC48498.1| ornithine carbamoyltransferase [Bacillus pseudofirmus OF4]
          Length = 318

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 141/305 (46%), Positives = 188/305 (61%), Gaps = 5/305 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             + F  L + +   ++ +++ A  +K  ++       L+GK L MIFE  STRTRVSFE
Sbjct: 13  KGRDFLTLLDYTPEEVNQLLKTAMLLKAEAKEKSIQPLLNGKSLGMIFENSSTRTRVSFE 72

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M  LGG  +FLS  ++Q+GR E I DTAKVLSRYVDAI++RT +H  + EL  +A VP
Sbjct: 73  VGMTQLGGHALFLSPKDLQIGRGEPIMDTAKVLSRYVDAIMIRTNSHEMVEELAAHADVP 132

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINALTD  HPCQ +AD++T +EH+ +      ++ GDGNN+ HSL+   A+    + IA
Sbjct: 133 VINALTDAFHPCQALADLLTIKEHKPNQGKIKMAYVGDGNNVAHSLLAAGAKAGMDVAIA 192

Query: 184 TPIGSEPRNEYLNWARNQGASV----ALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREE 238
           TP G E   +  N A           +  +D   AV  A  ++TD W SM  E + A   
Sbjct: 193 TPEGYEVNQDIFNQAVEAAKETGAILSQSNDPAYAVNDADVIYTDVWASMGYEAEQAARM 252

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
            VF PFQVN +L + A PD LF+HCLPAHRGEEV +EV+DG  SV++D+AENRLH QKAI
Sbjct: 253 EVFTPFQVNEALAAYAKPDYLFLHCLPAHRGEEVTSEVIDGGNSVIYDQAENRLHAQKAI 312

Query: 299 LLWCF 303
           L    
Sbjct: 313 LASLL 317


>gi|288923777|ref|ZP_06417868.1| ornithine carbamoyltransferase [Frankia sp. EUN1f]
 gi|288344877|gb|EFC79315.1| ornithine carbamoyltransferase [Frankia sp. EUN1f]
          Length = 317

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 138/301 (45%), Positives = 197/301 (65%), Gaps = 7/301 (2%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKN-SSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           MT  +HF   ++++SS  + ++++A ++K    E     +PL G+ +A+IFEKPSTRTR+
Sbjct: 1   MTA-RHFLLDTDLTSSEQAALLDLADRLKATRRERGAAPRPLEGRSVALIFEKPSTRTRL 59

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF+VA+  LGG  I +  +  QLGR ETI DTA VLSRYVDAIV+RT    R+  +   A
Sbjct: 60  SFDVAVAELGGHPIVIDSATTQLGRGETIEDTAAVLSRYVDAIVIRTFAQERVERMAAAA 119

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVINAL+D+ HPCQ +AD+ T  E RG + G   ++ GDGNN+ HSL+   A     +
Sbjct: 120 TVPVINALSDHAHPCQALADLQTIRELRGRLAGLTLTYLGDGNNVAHSLMLAGAMAGMRV 179

Query: 181 NIATPIGSEPRNEYLNWARNQGASVA----LFHDAVQAVKGAHCVFTDTWISMNQEFKAR 236
           ++A+P G EP ++ +  A   GA       + HDA++A   A  ++TD W SM Q+ ++ 
Sbjct: 180 HVASPPGYEPFDQVVRQANEIGAVTGGEALVMHDALEAATDADVLYTDVWASMGQDDESD 239

Query: 237 -EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
               VFQP++++  ++ +A PDA+ MHCLPAHR  E+   VLDGP+SVVFD+AENRLH Q
Sbjct: 240 TRALVFQPYRLDEKVVEVARPDAIVMHCLPAHRDVEISAAVLDGPRSVVFDQAENRLHAQ 299

Query: 296 K 296
           K
Sbjct: 300 K 300


>gi|163734103|ref|ZP_02141544.1| ornithine carbamoyltransferase [Roseobacter litoralis Och 149]
 gi|161392639|gb|EDQ16967.1| ornithine carbamoyltransferase [Roseobacter litoralis Och 149]
          Length = 308

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 161/308 (52%), Positives = 215/308 (69%), Gaps = 7/308 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSS-----ENIFENKPLSGKVLAMIFEKPSTRTR 59
             HF D+     ++L  II+ A  +KN+          + +PL   ++A+IFEKPSTRTR
Sbjct: 1   MNHFLDIHLTDPADLRGIIDQAATMKNARLGRPRGAPDDTQPLKDHMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V ++ +GG T+ LSGS+MQLG  ETI DTA+VLSRYVD I++RT + + L E+ E+
Sbjct: 61  VSFDVGVRQMGGQTMVLSGSDMQLGHGETIADTARVLSRYVDLIMIRTFDEAVLTEMAEF 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ATVPVIN LTD THPCQI+ADI+TFEEHRG + GK   WSGDGNN+  S +  A +F + 
Sbjct: 121 ATVPVINGLTDRTHPCQIMADILTFEEHRGPIAGKKVVWSGDGNNVCSSFLHAAGQFGFD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L    P   +P  E+++ AR++G +VA+  D  +AV+GA  V TDTW+SM+    ARE  
Sbjct: 181 LTFTGPPTLDPEPEFIDLARSKGVNVAVERDPAKAVEGADLVVTDTWVSMHDAQSARERR 240

Query: 240 VFQ--PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
             Q  P++V+ +LMS A P+ALFMHCLPAHR +E  +EV+DGPQSV+FDEAENRLH QKA
Sbjct: 241 HNQLRPYRVDAALMSHAKPEALFMHCLPAHRDDEATSEVMDGPQSVIFDEAENRLHAQKA 300

Query: 298 ILLWCFGI 305
           I+ WC  +
Sbjct: 301 IMRWCLAV 308


>gi|161527905|ref|YP_001581731.1| ornithine carbamoyltransferase [Nitrosopumilus maritimus SCM1]
 gi|160339206|gb|ABX12293.1| ornithine carbamoyltransferase [Nitrosopumilus maritimus SCM1]
          Length = 304

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 138/302 (45%), Positives = 187/302 (61%), Gaps = 1/302 (0%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M    K+   L+ +S      +I+ A K+K   +       L  K L MIF+KPSTRTRV
Sbjct: 1   MKLKTKNLLTLAELSPKEFVGLIDDALKLKKELKKGGNKPILKNKTLTMIFQKPSTRTRV 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFE+ M  LGG  + LS ++MQL R E++ DTAK LSRY D I+ R  +H  L +L+E A
Sbjct: 61  SFEIGMSQLGGYAVNLSSNDMQLSRGESVEDTAKTLSRYTDCIMARVYDHKLLEQLSENA 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVP+IN L+D  HPCQI+AD MT +E +  +KG   +W GDGNN+ +S+I G A     +
Sbjct: 121 TVPIINGLSDTFHPCQILADFMTIKEKKKKIKGIKIAWIGDGNNVCNSMIYGTALAGATM 180

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
           +IATP G EP  + +  A  +   + L  D ++AVK A  + TDT+ S++     R +  
Sbjct: 181 SIATPKGFEPDKKTVKEA-QKSTIIELTTDPLKAVKNADVIVTDTYSSIHNNDPKRIKKF 239

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
              +QVN  LM  A  DA+FMHCLPA R +EV + V+DGPQSVV+DEAENRLH+QKA+L 
Sbjct: 240 LPKYQVNPKLMKSAKKDAIFMHCLPAKRDQEVTSSVIDGPQSVVWDEAENRLHSQKALLA 299

Query: 301 WC 302
             
Sbjct: 300 SL 301


>gi|167745539|ref|ZP_02417666.1| hypothetical protein ANACAC_00230 [Anaerostipes caccae DSM 14662]
 gi|317472897|ref|ZP_07932203.1| ornithine carbamoyltransferase [Anaerostipes sp. 3_2_56FAA]
 gi|167655260|gb|EDR99389.1| hypothetical protein ANACAC_00230 [Anaerostipes caccae DSM 14662]
 gi|316899617|gb|EFV21625.1| ornithine carbamoyltransferase [Anaerostipes sp. 3_2_56FAA]
          Length = 312

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 102/310 (32%), Positives = 153/310 (49%), Gaps = 6/310 (1%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M    ++F  L + +   +S ++++A ++K   +       L GK +A+IFEKPSTRTR 
Sbjct: 1   MNLKGRNFLTLKDFTPEEISYLLDLAAQLKEDKKKGITGDSLKGKNIALIFEKPSTRTRC 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           +F +     GG   +L   ++QLG  E++ DTA+VL R  D I  R   H  + +L +Y+
Sbjct: 61  AFTIGCIDEGGHPEYLGKDDIQLGYKESVEDTARVLGRMFDGIEFRGFLHENVEKLAKYS 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNIL-HSLIEGAARFNYL 179
            VPV N LTD+ HP QI+AD +T  E  G +KG  F ++GDG N + +SL+ G A+    
Sbjct: 121 GVPVWNGLTDDYHPTQILADFLTLREQFGELKGLNFVFAGDGRNNMGNSLMIGCAKMGIN 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
                P    P+ E +   R             +                    +  +  
Sbjct: 181 FTCLAPKSLWPKEELIEQCRTYAKESGAKLTFTEDTDAVKGADCIYTDVWCSMGEEDKAA 240

Query: 240 VF----QPFQVNLSLMSMAHPD-ALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHT 294
                 +PFQVN  LM     D  + MHCLPA +G EV  +V +    V+FDEAENR+HT
Sbjct: 241 ERVALLKPFQVNDELMKKTEKDTTVVMHCLPAVKGNEVTEDVFEKHAEVIFDEAENRMHT 300

Query: 295 QKAILLWCFG 304
            KA+++   G
Sbjct: 301 IKAVMVATLG 310


>gi|330818118|ref|YP_004361823.1| ornithine carbamoyltransferase [Burkholderia gladioli BSR3]
 gi|327370511|gb|AEA61867.1| ornithine carbamoyltransferase [Burkholderia gladioli BSR3]
          Length = 317

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 121/308 (39%), Positives = 174/308 (56%), Gaps = 4/308 (1%)

Query: 2   MTYP--KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    +H+    + S  +   ++E    +K   +N     PL  + LAMIFEK STRTR
Sbjct: 9   MTAKTIRHYLQFKDFSLEDYEYVLERTGILKRKFKNYETYHPLHDRTLAMIFEKNSTRTR 68

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +F+S  + QLGR E + D+A+V+SR VD I++RT     +    + 
Sbjct: 69  LSFEAGIFQLGGHAVFMSTRDTQLGRGEPVEDSAQVISRMVDIIMIRTFEQDIIQRFADN 128

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT+  HPCQ++ADI T+ EHRG ++GK  +W GD NN+L++ IE A    + 
Sbjct: 129 SRVPVINGLTNEYHPCQVLADIFTYYEHRGPIRGKTVAWVGDANNMLYTWIEAAKILGFK 188

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L ++TP G     + ++        +    +              T +    E +   + 
Sbjct: 189 LRLSTPPGYALDMKLVDADSASAYEICADPNEACRGADLVTTDVWTSMGFEAENEV-RKQ 247

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  + V+  +M  A+PDALFMHCLPAHRGEEV   V+DGPQSVV+DEAENRLH QKA++
Sbjct: 248 AFADWCVDEEMMGFANPDALFMHCLPAHRGEEVTAGVIDGPQSVVWDEAENRLHVQKALM 307

Query: 300 L-WCFGII 306
                G +
Sbjct: 308 EFLLLGKL 315


>gi|237752343|ref|ZP_04582823.1| ornithine carbamoyltransferase [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229375832|gb|EEO25923.1| ornithine carbamoyltransferase [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 306

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 126/303 (41%), Positives = 182/303 (60%), Gaps = 6/303 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            +HF  L++ S   +  I+++AK +K   ++   +  L+ + L MIFEK STRTRVSFE 
Sbjct: 1   MRHFLTLADFSKIEILEILKIAKALKEEVKSKKYSTALANQTLGMIFEKNSTRTRVSFET 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG  IFLS ++ QLGR E I DTA+VLS  VD I+MRT  H RL E   Y++VPV
Sbjct: 61  GIYQLGGQGIFLSSNDTQLGRGEPIKDTARVLSSMVDLIMMRTHGHDRLEEFAHYSSVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN L+D+ HP Q++AD +T +   G  K  + ++ GDGNN+ HS +  A++  + L IA+
Sbjct: 121 INGLSDDFHPMQLLADYLTMQ-ECGKDKNPIVAYIGDGNNMAHSWLMLASKLGFELRIAS 179

Query: 185 PIGSEPRNEYLNWARNQGA----SVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEH 239
           P      ++ L  A          + +  D       A  + TDTW SM QE +    + 
Sbjct: 180 PKDYTISSKILEKAHEFAKVSGAKIIISEDPKAVAINADVITTDTWASMGQEDEKEARKK 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ + V+ +LM +A  DA+F+HCLPA+RG+EV  EVL+  QS +F EAENRLH QK ++
Sbjct: 240 AFKDYCVDNTLMRLAKDDAIFLHCLPAYRGQEVSEEVLESHQSKIFQEAENRLHAQKGVM 299

Query: 300 LWC 302
           +W 
Sbjct: 300 VWL 302


>gi|149194232|ref|ZP_01871329.1| Ornithine carbamoyltransferase [Caminibacter mediatlanticus TB-2]
 gi|149135407|gb|EDM23886.1| Ornithine carbamoyltransferase [Caminibacter mediatlanticus TB-2]
          Length = 313

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 134/308 (43%), Positives = 191/308 (62%), Gaps = 9/308 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            +HF  L + +   +  II++A +IK  ++N      L    LAMIFEK STRTRVSFEV
Sbjct: 1   MRHFLSLIDYTKEEIKEIIDLAFQIKKETKNRIFKPYLKNYQLAMIFEKSSTRTRVSFEV 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG+ IFLS  ++QLGR E I DTA+V+SR VD I++RT    RL E  +Y+ VPV
Sbjct: 61  GINQLGGNGIFLSSRDIQLGRGEPIKDTARVISRMVDMIMIRTFGQERLEEFAKYSKVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEH----RGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           IN LTD  HP Q++AD+MT  E+      + +  +  + GDGNN+ +S +  A++  + L
Sbjct: 121 INGLTDKCHPVQLLADLMTMIEYKKFDFDNPQKTVVVYIGDGNNMANSWVILASKLGFNL 180

Query: 181 NIATPIGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-A 235
            +ATP G E   +     L +A+  GA +   +D  +A+K A  V TDTW+SM QE +  
Sbjct: 181 RVATPKGYEIDEDIKQKALEFAKQSGAKIEFLYDVKEAIKNADVVTTDTWVSMGQEDEKE 240

Query: 236 REEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
           +    F+ F+VN  LM++A  DA+F+HCLPA+RG EV  EV +   + +FDEAENRLH Q
Sbjct: 241 KRISDFKGFEVNSELMNLAKKDAIFLHCLPAYRGYEVSEEVFEKHSNEIFDEAENRLHAQ 300

Query: 296 KAILLWCF 303
           K +++W  
Sbjct: 301 KGLMVWLM 308


>gi|118464590|ref|YP_882298.1| ornithine carbamoyltransferase [Mycobacterium avium 104]
 gi|166926152|sp|A0QHB0|OTC_MYCA1 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|118165877|gb|ABK66774.1| ornithine carbamoyltransferase [Mycobacterium avium 104]
          Length = 309

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 142/309 (45%), Positives = 195/309 (63%), Gaps = 11/309 (3%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRV 60
           MT P+HF    ++S +  + ++ +A ++K   ++ F  +PL G + +A++F+K STRTR 
Sbjct: 1   MT-PRHFLRDDDLSPAEQAEVLALAAELK---KDPFSARPLEGPRGVAVLFDKNSTRTRF 56

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFEV +  LGG  + +     QLGR ET+ DTA+VLSRYV+AIV RT    RL  +   A
Sbjct: 57  SFEVGIAQLGGHAVVVDARSTQLGRDETLEDTARVLSRYVEAIVWRTFEQHRLEAMAGAA 116

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYL 179
           TVPVINAL+D  HPCQ++AD+    EH+GS+ G    + GDG NN+ HSL+ G       
Sbjct: 117 TVPVINALSDEFHPCQVLADLQAIAEHKGSLSGLRMCYLGDGANNMAHSLMLGGVTAGIH 176

Query: 180 LNIATPIGSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA 235
           + IA P G  P  E++      A + GA+V L  DA  A +G   + TDTW SM QE   
Sbjct: 177 VTIAAPDGFTPAPEFVAAARRRAESTGATVTLTTDARTAARGVDVLVTDTWTSMGQEDDG 236

Query: 236 -REEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHT 294
                 F P+Q+N  L+S+A P+A+ +HCLPAHRGEE+ +EV+DGP SVV+DEAENRLH 
Sbjct: 237 LDRRTPFWPYQLNADLVSLADPEAIVLHCLPAHRGEEITDEVMDGPSSVVWDEAENRLHA 296

Query: 295 QKAILLWCF 303
           QKA+L W  
Sbjct: 297 QKALLTWLL 305


>gi|304313809|ref|YP_003848956.1| ornithine carbamoyltransferase [Methanothermobacter marburgensis
           str. Marburg]
 gi|302587268|gb|ADL57643.1| ornithine carbamoyltransferase [Methanothermobacter marburgensis
           str. Marburg]
          Length = 299

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 141/305 (46%), Positives = 188/305 (61%), Gaps = 11/305 (3%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            +H   + ++   ++  ++++A   K         K L GK LAMIFEK STRTRVSFEV
Sbjct: 1   MRHLLSVCDM--DDVVALLDLADDYKAG---EIPGKVLEGKTLAMIFEKSSTRTRVSFEV 55

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
               LG   ++LS S++QLGR E I DTA+ LSRYVD I++R   HS ++EL   ++VPV
Sbjct: 56  GASQLGAQPLYLSASDLQLGRGEPIADTARTLSRYVDGIMIRAIRHSDVVELASESSVPV 115

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD  HPCQ +AD+ T  E  G   G+L  + GDGNN+ +SL+   A     +++A 
Sbjct: 116 INGLTDLEHPCQALADMQTVREKLGDFSGRL-VFVGDGNNVCNSLLLITAMLGMDMDVAC 174

Query: 185 PIGSEPRNEYLNWARNQGAS----VALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEH 239
           P G EP  E    A          + + HD  +AV GA  V+TD W+SM  E +      
Sbjct: 175 PPGYEPDTEITGMAEKIARKSGSEIRVLHDPREAVDGADVVYTDVWVSMGYEEETEERLK 234

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           VF+P+QVN  LM +A PDA+FMHCLPA RG+E  +EV+DGPQSVV+D+AENRLH QKAI+
Sbjct: 235 VFRPYQVNSELMKLASPDAIFMHCLPAVRGQETTSEVIDGPQSVVWDQAENRLHAQKAIM 294

Query: 300 LWCFG 304
            W  G
Sbjct: 295 HWLMG 299


>gi|297570151|ref|YP_003691495.1| ornithine carbamoyltransferase [Desulfurivibrio alkaliphilus AHT2]
 gi|296926066|gb|ADH86876.1| ornithine carbamoyltransferase [Desulfurivibrio alkaliphilus AHT2]
          Length = 305

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 132/299 (44%), Positives = 189/299 (63%), Gaps = 2/299 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             +H   L++ S + L+ +I+ A  +K        ++ L+G+ +A++FEKPSTRTRVSFE
Sbjct: 1   MARHLLSLADFSGAELAALIDRALVLKKERREGVRHRDLAGRTIALVFEKPSTRTRVSFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
            AM  LGG  I+LS  + QL R E + D A+V++RYVD +V+RT     + EL  Y+ VP
Sbjct: 61  AAMYGLGGQVIYLSSRDTQLARNEPLKDMARVMARYVDGLVVRTFGQQIVDELARYSEVP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINALTD  HPCQ+++D+MT  EH+G +K    +W GDGNN+ +S I+ AAR  + L +A
Sbjct: 121 VINALTDLHHPCQVLSDLMTVIEHKGELKQLKIAWVGDGNNMANSWIQAAARLGFALTLA 180

Query: 184 TPIGSEPRNEYLNWARNQGASVAL-FHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHVF 241
            P G EP  + L  AR +         D ++AV  A  + TD W SM QE +  +   VF
Sbjct: 181 CPEGYEPDLDILKAARAEAERPINLVRDPIEAVAEADVINTDVWASMGQEDEQLQRLQVF 240

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           +P+Q+N  L++ A   A+ +HCLPAHR EE+   VL+GPQSVV+D+AEN++H   AIL 
Sbjct: 241 RPYQINERLLAQADGRAVVLHCLPAHRDEEITEAVLEGPQSVVWDQAENKMHIHAAILA 299


>gi|134296738|ref|YP_001120473.1| ornithine carbamoyltransferase [Burkholderia vietnamiensis G4]
 gi|134139895|gb|ABO55638.1| ornithine carbamoyltransferase [Burkholderia vietnamiensis G4]
          Length = 309

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 121/304 (39%), Positives = 172/304 (56%), Gaps = 3/304 (0%)

Query: 2   MTYP--KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    +H+    + S  +   ++E    +K   +N     PL  + LAMIFEK STRTR
Sbjct: 1   MTAKTIRHYLQFKDFSLEDYEYVLERTGILKRKFKNYETYHPLHDRTLAMIFEKSSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +F+S  + QLGR E + D+A+V+SR VD I++RT     +    + 
Sbjct: 61  LSFEAGIFQLGGHAVFMSTRDTQLGRGEPVEDSAQVISRMVDIIMIRTFEQDVITRFAQN 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT+  HPCQ++ADI T+ EHRG + GK  +W GD NN+L++ IE A    + 
Sbjct: 121 SRVPVINGLTNEYHPCQVLADIFTYYEHRGPIAGKTVAWVGDANNMLYTWIEAAQILGFK 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L ++TP G     + ++        V    +              T +    E +A  + 
Sbjct: 181 LRLSTPPGYALDMKLVSPDSAPFYEVFDDPNEACKGADLVTTDVWTSMGFEAENEA-RKQ 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  + V+  +M  A+ DALFMHCLPAHRGEEV   V+DGPQSVV+DEAENRLH QKA++
Sbjct: 240 AFADWCVDEEMMGYANADALFMHCLPAHRGEEVTAGVIDGPQSVVWDEAENRLHVQKALM 299

Query: 300 LWCF 303
            +  
Sbjct: 300 EFLL 303


>gi|41407463|ref|NP_960299.1| ornithine carbamoyltransferase [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|56404385|sp|Q740I5|OTC_MYCPA RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|41395815|gb|AAS03682.1| ArgF [Mycobacterium avium subsp. paratuberculosis K-10]
          Length = 309

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 142/309 (45%), Positives = 195/309 (63%), Gaps = 11/309 (3%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRV 60
           MT P+HF    ++S +  + ++ +A ++K   ++ F  +PL G + +A++F+K STRTR 
Sbjct: 1   MT-PRHFLRDDDLSPAEQAEVLALAAELK---KDPFSARPLEGPRGVAVLFDKNSTRTRF 56

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFEV +  LGG  + +     QLGR ET+ DTA+VLSRYV+AIV RT    RL  +   A
Sbjct: 57  SFEVGIAQLGGHAVVVDARSTQLGRDETLEDTARVLSRYVEAIVWRTFEQQRLEAMAGAA 116

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYL 179
           TVPVINAL+D  HPCQ++AD+    EH+GS+ G    + GDG NN+ HSL+ G       
Sbjct: 117 TVPVINALSDEFHPCQMLADLQAIAEHKGSLSGLRMCYLGDGANNMAHSLMLGGVTAGIH 176

Query: 180 LNIATPIGSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA 235
           + IA P G  P  E++      A + GA+V L  DA  A +G   + TDTW SM QE   
Sbjct: 177 VTIAAPDGFTPAPEFVAAARRRAESTGATVTLTTDARAAARGVDVLVTDTWTSMGQEDDG 236

Query: 236 -REEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHT 294
                 F P+Q+N  L+S+A P+A+ +HCLPAHRGEE+ +EV+DGP SVV+DEAENRLH 
Sbjct: 237 LDRRTPFWPYQLNADLVSLADPEAIVLHCLPAHRGEEITDEVMDGPSSVVWDEAENRLHA 296

Query: 295 QKAILLWCF 303
           QKA+L W  
Sbjct: 297 QKALLTWLL 305


>gi|254775565|ref|ZP_05217081.1| ornithine carbamoyltransferase [Mycobacterium avium subsp. avium
           ATCC 25291]
          Length = 309

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 142/309 (45%), Positives = 195/309 (63%), Gaps = 11/309 (3%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRV 60
           MT P+HF    ++S +  + ++ +A ++K   ++ F  +PL G + +A++F+K STRTR 
Sbjct: 1   MT-PRHFLRDDDLSPAEQAEVLALAAELK---KDPFSARPLEGPRGVAVLFDKNSTRTRF 56

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFEV +  LGG  + +     QLGR ET+ DTA+VLSRYV+AIV RT    RL  +   A
Sbjct: 57  SFEVGIAQLGGHAVVVDARSTQLGRDETLEDTARVLSRYVEAIVWRTFEQQRLEAMAGAA 116

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYL 179
           TVPVINAL+D  HPCQ++AD+    EH+GS+ G    + GDG NN+ HSL+ G       
Sbjct: 117 TVPVINALSDEFHPCQVLADLQAIAEHKGSLSGLRMCYLGDGANNMAHSLMLGGVTAGIH 176

Query: 180 LNIATPIGSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA 235
           + IA P G  P  E++      A + GA+V L  DA  A +G   + TDTW SM QE   
Sbjct: 177 VTIAAPDGFTPAPEFVAAARRRAESTGATVTLTTDARAAARGVDVLVTDTWTSMGQEDDG 236

Query: 236 -REEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHT 294
                 F P+Q+N  L+S+A P+A+ +HCLPAHRGEE+ +EV+DGP SVV+DEAENRLH 
Sbjct: 237 LDRRTPFWPYQLNADLVSLADPEAIVLHCLPAHRGEEITDEVMDGPSSVVWDEAENRLHA 296

Query: 295 QKAILLWCF 303
           QKA+L W  
Sbjct: 297 QKALLTWLL 305


>gi|218885154|ref|YP_002434475.1| ornithine carbamoyltransferase [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218756108|gb|ACL07007.1| ornithine carbamoyltransferase [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 300

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 145/301 (48%), Positives = 203/301 (67%), Gaps = 4/301 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
            P+HF  + ++       +++ AK++K+++      K + GK   +IFEK STRTRVSFE
Sbjct: 1   MPRHFTRIRDLGYEGAWKLLQRAKEMKDTAHRG---KIMEGKTAILIFEKASTRTRVSFE 57

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           +A++HLGG TIF++ +E QLGR+E + DTA+VLSRY D +V+RT   S++ EL EY ++P
Sbjct: 58  MAVRHLGGSTIFMTPAESQLGRSEPLRDTARVLSRYADCMVVRTFGQSKITELAEYGSIP 117

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINALTD  HPCQ++ D++T  E    +     +W GDGNN+ +S IE A  F + L +A
Sbjct: 118 VINALTDEGHPCQVMGDVLTMYERTPDLSTVRVAWVGDGNNMANSWIEAAVYFPFELFMA 177

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQ 242
            P G EP  + L +A N GA + L HD   AV+GAH V TD W SM QE +  + E  F+
Sbjct: 178 FPEGYEPDRDLLGYALNAGAKIFLTHDPRMAVEGAHYVNTDVWASMGQEEEQKKREAAFK 237

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            + ++  +M++A PDA FMHCLPAHRGEEV +EV++ P S++FD+AENRLH QKAIL W 
Sbjct: 238 GYCIDTEMMALAAPDAKFMHCLPAHRGEEVTDEVMESPASIIFDQAENRLHIQKAILEWA 297

Query: 303 F 303
           F
Sbjct: 298 F 298


>gi|94499421|ref|ZP_01305958.1| ornithine carbamoyltransferase [Oceanobacter sp. RED65]
 gi|94428175|gb|EAT13148.1| ornithine carbamoyltransferase [Oceanobacter sp. RED65]
          Length = 307

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 133/300 (44%), Positives = 186/300 (62%), Gaps = 2/300 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
            P+H   L +++ + L  I   A ++K         +PL  KVL MIFEK STRTRVSFE
Sbjct: 8   TPRHLLTLLDLTPAELQHITSRATELKRMHRAGEIYEPLKNKVLGMIFEKSSTRTRVSFE 67

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
             +  LGG  IFLS  + QLGR E I D+AKVLSR  D I++RT  H  +   +  + VP
Sbjct: 68  AGIAQLGGSAIFLSPRDTQLGRGEPIEDSAKVLSRMCDIIMIRTFGHDIVENFSANSRVP 127

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINALTD+ HPCQ++AD+ T++EHRGS+KGK   W GDGNN+ HS I  A +F++ L + 
Sbjct: 128 VINALTDDFHPCQLLADMQTYQEHRGSIKGKTVVWVGDGNNMCHSYINAAKQFDFNLVVN 187

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQP 243
            P G EP  E +   +++   +    +A +           +     +E +   E VF+ 
Sbjct: 188 CPEGFEPMAELMEANKDRVKIIRDTKEAAKGAHLLVTDVWASM--GQEEEQKEREKVFKS 245

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +QV+ ++M +A  DALFMHCLPAHRGEE+ +++LD P+SVV+DEAENRLH QKA++ +  
Sbjct: 246 YQVSPAVMDLADKDALFMHCLPAHRGEEISHDMLDDPRSVVWDEAENRLHAQKALMEFLL 305


>gi|56751601|ref|YP_172302.1| ornithine carbamoyltransferase [Synechococcus elongatus PCC 6301]
 gi|81301323|ref|YP_401531.1| ornithine carbamoyltransferase [Synechococcus elongatus PCC 7942]
 gi|81561873|sp|Q5N1N8|OTC_SYNP6 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|93141293|sp|Q935Y4|OTC_SYNE7 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|56686560|dbj|BAD79782.1| ornithine carbamoyltransferase [Synechococcus elongatus PCC 6301]
 gi|81170204|gb|ABB58544.1| ornithine carbamoyltransferase [Synechococcus elongatus PCC 7942]
          Length = 305

 Score =  215 bits (548), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 131/305 (42%), Positives = 188/305 (61%), Gaps = 9/305 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +    L+++SS+ +  I+E+A  +K+    +        K L +IF K STRTRVSF  A
Sbjct: 6   RDLLTLADLSSAEVLEILELAATLKSGQTTVHCP-----KTLGLIFSKSSTRTRVSFSAA 60

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  +GG  + L+ +  Q+GR E I DTA+VLSRY+DA+ +RT     L E   YA +PVI
Sbjct: 61  IMQMGGQVLDLNPNVTQVGRGEPIADTARVLSRYLDALAIRTFAQQDLEEYAHYADIPVI 120

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+ HPCQI+AD+ T +E+ G  +    ++ GDGNN+ HSL+ G A+    + IA P
Sbjct: 121 NALTDDYHPCQILADLQTIQENFGQWQDLTLTYLGDGNNVAHSLLLGCAQVGMNVRIACP 180

Query: 186 IGSEPRNEYLNWARN---QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVF 241
              +P+   +  A+      A V + HD + A +GAH ++TD W SM QE +A+     F
Sbjct: 181 PDYQPQERIVAKAQQIAGDRAKVEILHDPIAASQGAHVLYTDVWASMGQEEEAQARVKAF 240

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
            P+Q+N +L+  A P A+ +HCLPAHR EE+  EVL+G QS V+D+AENRLH QKA+L  
Sbjct: 241 TPYQLNQALLEKADPAAIVLHCLPAHREEEITAEVLEGSQSRVWDQAENRLHAQKAVLAL 300

Query: 302 CFGII 306
             G I
Sbjct: 301 LLGAI 305


>gi|88812675|ref|ZP_01127922.1| ornithine carbamoyltransferase [Nitrococcus mobilis Nb-231]
 gi|88790091|gb|EAR21211.1| ornithine carbamoyltransferase [Nitrococcus mobilis Nb-231]
          Length = 303

 Score =  215 bits (548), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 136/300 (45%), Positives = 187/300 (62%), Gaps = 6/300 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           P+HF  L++ ++  L  +I    ++K    +   ++PL  +VL+MIFEK STRTRVSFE 
Sbjct: 3   PRHFLTLTDCTAEELHALIRRGIELKRMRRDGLVHEPLKNRVLSMIFEKASTRTRVSFEA 62

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG  +FLS  + QLGR ETI DTA+V+S  VDAI++RT  H  L    EY+ VP+
Sbjct: 63  GMVQLGGHAMFLSPRDTQLGRGETIEDTARVISSMVDAIMIRTFGHETLTRFAEYSRVPI 122

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN L+D  HPCQ++AD+ T+ EHR  ++G+   W GDGNN+  S +  A   ++ L +  
Sbjct: 123 INGLSDEFHPCQLLADMQTYWEHRDDIRGRTVVWVGDGNNMCRSYVNAARMLDFQLRVCC 182

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQP 243
           P G  P  ++L         +    +  +A++GAH V TD W SM QE +  +      P
Sbjct: 183 PPGYAPGPQWL-----ADPRIEFIPEPSEALRGAHLVVTDVWASMGQEREREQRLRDLAP 237

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +++   LM +A P ALFMHCLPAHRGEEV  EV+DG QSVV+DEAENRLH QKA+L +  
Sbjct: 238 YRITDGLMELADPQALFMHCLPAHRGEEVEAEVIDGAQSVVWDEAENRLHAQKALLEFLL 297


>gi|167035326|ref|YP_001670557.1| ornithine carbamoyltransferase [Pseudomonas putida GB-1]
 gi|166861814|gb|ABZ00222.1| ornithine carbamoyltransferase [Pseudomonas putida GB-1]
          Length = 306

 Score =  215 bits (548), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 145/302 (48%), Positives = 194/302 (64%), Gaps = 5/302 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M+  +HF  L + ++  L  +I    ++K+  +     +PL  +VL MIFEK STRTRVS
Sbjct: 1   MSA-RHFLSLLDFTTDELLGVIRRGIELKDLRKRGVLFEPLKNRVLGMIFEKSSTRTRVS 59

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  IFLS  + QLGR E IGD+A VLS  +D +++RT  HS L E    + 
Sbjct: 60  FEAGMIQLGGQAIFLSPRDTQLGRGEPIGDSAIVLSSMLDVVMIRTHAHSTLTEFAAKSR 119

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN L+D +HPCQ++AD+ TF EHRGS++GK  +W GDG N+ +S IE A +F++ L 
Sbjct: 120 VPVINGLSDESHPCQLLADMQTFLEHRGSIQGKTVTWIGDGFNMCNSYIEAARQFDFQLR 179

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHV 240
           IA P G EP   ++    ++   +    D  QAV+ AH V TD W SM QE + AR    
Sbjct: 180 IACPEGYEPDQRFMALGGDRVQIIR---DVKQAVRDAHLVVTDVWTSMGQEEETARRLAH 236

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F P+QV   L+ +A PD LFMHCLPAHRGEE+  ++LD P+SV +DEAENRLH QKA+L 
Sbjct: 237 FAPYQVTRELLDLAAPDVLFMHCLPAHRGEEISQDLLDDPRSVAWDEAENRLHAQKALLE 296

Query: 301 WC 302
           + 
Sbjct: 297 FL 298


>gi|94311834|ref|YP_585044.1| ornithine carbamoyltransferase [Cupriavidus metallidurans CH34]
 gi|166973836|sp|Q1LJA1|OTC_RALME RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|93355686|gb|ABF09775.1| ornithine carbamoyltransferase [Cupriavidus metallidurans CH34]
          Length = 307

 Score =  215 bits (547), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 124/299 (41%), Positives = 184/299 (61%), Gaps = 3/299 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KH+   S++S+     +++ A+ +K   +N     PL  + LAMIFEK STRTR+SFE  
Sbjct: 7   KHYLQFSDLSADEYEYLLDRARILKAKFKNYETWHPLHDRTLAMIFEKNSTRTRLSFEAG 66

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG  +FL+  + QLGR E I D A+V+SR VD I++RT     +    +++ VPVI
Sbjct: 67  IHQLGGHAVFLNTRDSQLGRGEPIEDAAQVISRMVDIIMIRTFGQEIIDRFAKHSRVPVI 126

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQ++AD+ T+ E RG++ GK  +W GD NN+ ++ I+ A R ++  + + P
Sbjct: 127 NGLTNEYHPCQVLADVFTYIEQRGTIAGKTVAWIGDANNMAYTWIQAAERLDFTFHFSAP 186

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQPF 244
            G +     +       + V +F + + A +GAH V TD W SM  E +    +  F+ +
Sbjct: 187 PGYQLDPAMVP--DWAASRVKVFDNPLDACQGAHLVTTDVWTSMGFEAENDARKRAFKDW 244

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
            V  ++M  A  DALFMHCLPAHRGEEV   V+DGP+SVV++EAENRLH QKA++ +  
Sbjct: 245 MVTTAMMDRAADDALFMHCLPAHRGEEVEAAVIDGPRSVVWEEAENRLHVQKALMEYLL 303


>gi|121997523|ref|YP_001002310.1| ornithine carbamoyltransferase [Halorhodospira halophila SL1]
 gi|254772727|sp|A1WUZ6|OTC_HALHL RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|121588928|gb|ABM61508.1| ornithine carbamoyltransferase [Halorhodospira halophila SL1]
          Length = 300

 Score =  215 bits (547), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 129/299 (43%), Positives = 175/299 (58%), Gaps = 2/299 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            +HF  L + S   +  ++  A ++++       ++PL G+VL M+FEK STRTRVSFE 
Sbjct: 1   MRHFLTLRDCSVDEIHQLLRRATELRDMHRAGHLHQPLQGRVLGMVFEKSSTRTRVSFEA 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG  +FLS  + QLGR E + DTA+V+SR VDA+++RT  H  L     ++  PV
Sbjct: 61  GMAQLGGHALFLSPRDTQLGRGEPVEDTARVVSRMVDAVMIRTFGHDMLERFAGHSAAPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN L+D  HPCQ++AD+ TF EHRG +  +  +W GDGNN+ HS IE A    + L+IA 
Sbjct: 121 INGLSDLCHPCQLLADLQTFTEHRGPITDRRVAWIGDGNNMCHSWIEAAGLLGFDLHIAA 180

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P G  P  + L    ++       + A +           +     +  +A  E  F+ F
Sbjct: 181 PPGYRPEADILALGGDRVQVFDDAYAAAEGADLVTTDVWASM--GQESEQAAREEAFRGF 238

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
            V  SLM  A   ALFMHCLPAHRGEEV   VL+GPQSVV+DEAENRLH QKA+L +  
Sbjct: 239 CVTESLMECAGEQALFMHCLPAHRGEEVEAAVLEGPQSVVWDEAENRLHAQKALLEFLM 297


>gi|325680874|ref|ZP_08160412.1| ornithine carbamoyltransferase [Ruminococcus albus 8]
 gi|324107654|gb|EGC01932.1| ornithine carbamoyltransferase [Ruminococcus albus 8]
          Length = 305

 Score =  215 bits (547), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 124/301 (41%), Positives = 187/301 (62%), Gaps = 1/301 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
             H   + ++S   +  I+ +A ++K  ++N  E+K L GK L MIF+K STRTRVSFE 
Sbjct: 1   MNHLLKMLDLSKEEIIDILNLADQLKYENKNGIEHKVLKGKTLGMIFQKSSTRTRVSFET 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG  +FLS  ++Q+GR E + DTA+VLSRY+D I++RT     + +L EY ++P+
Sbjct: 61  GMYQLGGQALFLSNRDLQIGRGEPVQDTARVLSRYLDGIMIRTFEQKEVEDLAEYGSIPI 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD  HPCQ++AD+MT  E +G  +G    + GDGNN+ +SLI G  +    ++IA 
Sbjct: 121 INGLTDFCHPCQVLADLMTIREFKGQFEGLKMCYIGDGNNMANSLIVGGLKVGMSVSIAC 180

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQP 243
           P G  P  + L +A+  G    +     +A K A  +FTD W SM +E +  + +  F  
Sbjct: 181 PEGYRPDPKVLEFAKQYGDKFFMTDKPAEAAKDADVLFTDVWTSMGEEAETEKRKVAFAG 240

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +Q+N  ++++A PDA+  HCLPAHR EE+  +V +   + +F+EAENRLH QKA+++   
Sbjct: 241 YQINDDIIAVAKPDAMVQHCLPAHREEEITEKVFEAHANEIFEEAENRLHAQKAVMVKVM 300

Query: 304 G 304
           G
Sbjct: 301 G 301


>gi|300703183|ref|YP_003744785.1| ornithine carbamoyltransferase [Ralstonia solanacearum CFBP2957]
 gi|299070846|emb|CBJ42147.1| ornithine carbamoyltransferase [Ralstonia solanacearum CFBP2957]
          Length = 308

 Score =  215 bits (547), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 117/301 (38%), Positives = 166/301 (55%), Gaps = 1/301 (0%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           +  KH+    + S      +++ ++ +K   +N     PL  + LAMIFEK STRTR+SF
Sbjct: 5   SKIKHYLQFKDFSLEEYEYLLDRSRILKAKFKNYETWHPLHDRTLAMIFEKNSTRTRLSF 64

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E  +  LGG  +FL+  + QLGR E I D A+V+SR  D I++RT     +     ++ V
Sbjct: 65  EAGIHQLGGHAVFLNTRDSQLGRGEPIEDAAQVISRMTDIIMIRTFGQEIIERFAAHSRV 124

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVIN LT+  HPCQ++ADI TF E RGS+KGK  +W GD NN+ ++ I+ A    +  + 
Sbjct: 125 PVINGLTNEYHPCQVLADIFTFIEQRGSIKGKTVTWVGDANNMAYTWIQAAEILGFRFHF 184

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQ 242
           + P G +     +  +      V                   T +    E +A  +  F 
Sbjct: 185 SAPKGYQLDPAMVAESSRPFVHVFENPLQACDGAHLVTTDVWTSMGYEAENEA-RKKAFG 243

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            + V  ++M  A PDALFMHCLPAHRGEEV   V+DG QSVV+DEAENRLH QKA++ + 
Sbjct: 244 DWMVTEAMMQRAQPDALFMHCLPAHRGEEVEAAVIDGKQSVVWDEAENRLHVQKALMEYL 303

Query: 303 F 303
            
Sbjct: 304 L 304


>gi|255320452|ref|ZP_05361633.1| ornithine carbamoyltransferase [Acinetobacter radioresistens SK82]
 gi|262378348|ref|ZP_06071505.1| ornithine carbamoyltransferase [Acinetobacter radioresistens SH164]
 gi|255302424|gb|EET81660.1| ornithine carbamoyltransferase [Acinetobacter radioresistens SK82]
 gi|262299633|gb|EEY87545.1| ornithine carbamoyltransferase [Acinetobacter radioresistens SH164]
          Length = 306

 Score =  215 bits (547), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 138/302 (45%), Positives = 183/302 (60%), Gaps = 3/302 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT  +HF  L ++SS  L+ I+E A ++K    N    +P  GKVL MIFEK STRTR+S
Sbjct: 1   MTL-RHFLTLRDLSSLELNRILERASELKRMQHNNEVYQPFVGKVLGMIFEKSSTRTRIS 59

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M   GGD IFLS  + QLGR E I D+A+V+S  +D +++RT  H  +     Y+ 
Sbjct: 60  FEAGMSQFGGDAIFLSSRDTQLGRGEPIEDSARVISSMLDIVMIRTFGHDIVERFASYSK 119

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD+ HPCQ++AD+ T+ EHRGS++GK  +W GDGNN+ +S IE A    + L 
Sbjct: 120 VPVINGLTDDHHPCQLLADLQTYIEHRGSIEGKTVAWIGDGNNMCNSYIEAAHMMGFKLK 179

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           IA+P G EP+ E+L    +         DA             +     +E +   E  F
Sbjct: 180 IASPAGYEPKEEFLTEFAHCVEVFNNAEDAAVNADLIVTDVWASM--GQEEEQKHREQAF 237

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
             FQVN  LM +AHPD LFMHCLPAHRGEE+   +LD   +VV+DEAENRLH QKA++ +
Sbjct: 238 AQFQVNEKLMGLAHPDCLFMHCLPAHRGEEISENMLDHKNAVVWDEAENRLHAQKALVEF 297

Query: 302 CF 303
             
Sbjct: 298 LL 299


>gi|237756611|ref|ZP_04585127.1| ornithine carbamoyltransferase [Sulfurihydrogenibium yellowstonense
           SS-5]
 gi|237691225|gb|EEP60317.1| ornithine carbamoyltransferase [Sulfurihydrogenibium yellowstonense
           SS-5]
          Length = 307

 Score =  215 bits (547), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 131/304 (43%), Positives = 201/304 (66%), Gaps = 7/304 (2%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             + F   +++S   +  II+ AKK+K   ++ F ++ L GK + +IF K STRTR+SFE
Sbjct: 1   MKRDFVSFTDLSREEVLSIIDYAKKLK---KDKFADRTLEGKSIGLIFMKQSTRTRLSFE 57

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V +  +GG  I++SGS  QL R E I DTA+V+SRY+D IV+RT +H  + EL +Y+++P
Sbjct: 58  VGVYQMGGQPIYISGSTTQLSRGEDIKDTARVMSRYLDGIVIRTFSHQEVEELAKYSSIP 117

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINALTD  HPCQ++AD+MT +E  GS++ K  ++ GDGNN+ ++L+   A     +++A
Sbjct: 118 VINALTDYQHPCQVLADLMTIDEEFGSLENKKVAYVGDGNNMANTLLLACALMGMDMSVA 177

Query: 184 TPIGSEPR----NEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           TP   EP      E L  A+  G+ + + +D  +AV  A  ++TD W+SM QE +  ++ 
Sbjct: 178 TPPNYEPNGKAVYESLEIAKKSGSKITITNDPKEAVLEADVIYTDVWVSMGQENEKGKKD 237

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           VF+PF VN  L+ +A PDA+ MHCLPAH+GEE+  +V +    V+F++AENRLH QK+++
Sbjct: 238 VFKPFTVNKDLVLLAKPDAIVMHCLPAHKGEEITEDVFEQYSDVIFNQAENRLHVQKSLM 297

Query: 300 LWCF 303
            + F
Sbjct: 298 SFLF 301


>gi|157737487|ref|YP_001490170.1| ornithine carbamoyltransferase [Arcobacter butzleri RM4018]
 gi|315637213|ref|ZP_07892433.1| ornithine carbamoyltransferase [Arcobacter butzleri JV22]
 gi|157699341|gb|ABV67501.1| ornithine carbamoyltransferase [Arcobacter butzleri RM4018]
 gi|315478485|gb|EFU69198.1| ornithine carbamoyltransferase [Arcobacter butzleri JV22]
          Length = 309

 Score =  215 bits (547), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 123/303 (40%), Positives = 184/303 (60%), Gaps = 6/303 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            +HF  L++ +   +  I+ +AK+IK  ++       +  KVLAMIFEK STRTRVSFE 
Sbjct: 1   MRHFLTLTDFTKDEILEILTLAKQIKEETKRREFKDYMPKKVLAMIFEKSSTRTRVSFET 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG  +FLS +++QLGR E + DT++V+SR  D +++RT   S++ E  +Y+ VPV
Sbjct: 61  GIYQLGGIGLFLSSNDIQLGRGEPMSDTSRVISRMADMVMIRTFEQSKIEEFAKYSKVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LT+  HP Q++AD     +  G  K  + ++ GDGNN+ HS +  AA+  + L IAT
Sbjct: 121 INGLTNEYHPVQLMADY-MTIQEAGLEKDLVVAYVGDGNNMAHSWLNLAAKLGFELRIAT 179

Query: 185 PIGSEPRNEYLNWARNQGAS----VALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEH 239
           P G E     LN A          + + +D   A+K +  V TDTW+SM QE +  +   
Sbjct: 180 PKGYEVDKNILNNALEMAKISGAKIIIGNDPKTAIKDSTVVTTDTWVSMGQEDEKEKRVK 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  + V+  +M +A   A+F+HCLPA+RG EV  EV++  QS++F+EAENRLH QK ++
Sbjct: 240 DFAGYMVDADMMKLAQDKAIFLHCLPAYRGYEVSEEVIESSQSLIFEEAENRLHAQKGVM 299

Query: 300 LWC 302
           +W 
Sbjct: 300 VWL 302


>gi|83748946|ref|ZP_00945955.1| Ornithine carbamoyltransferase [Ralstonia solanacearum UW551]
 gi|207744173|ref|YP_002260565.1| ornithine carbamoyltransferase (otcase) protein [Ralstonia
           solanacearum IPO1609]
 gi|83724369|gb|EAP71538.1| Ornithine carbamoyltransferase [Ralstonia solanacearum UW551]
 gi|206595578|emb|CAQ62505.1| ornithine carbamoyltransferase (otcase) protein [Ralstonia
           solanacearum IPO1609]
          Length = 308

 Score =  215 bits (547), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 127/302 (42%), Positives = 179/302 (59%), Gaps = 3/302 (0%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           +  KH+    + S      +++ ++ +K   +N     PL  + LAMIFEK STRTR+SF
Sbjct: 5   SKIKHYLQFKDFSLEEYEYLLDRSRILKAKFKNYETWHPLHDRTLAMIFEKNSTRTRLSF 64

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E  +  LGG  +FL+  + QLGR E I D A+V+SR  D I++RT     +     ++ V
Sbjct: 65  EAGIHQLGGHAVFLNTRDSQLGRGEPIEDAAQVISRMTDIIMIRTFGQEIIERFAAHSRV 124

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVIN LT+  HPCQ++ADI TF E RGS+KGK  +W GD NN+ ++ I+ A    +  + 
Sbjct: 125 PVINGLTNEYHPCQVLADIFTFIEQRGSIKGKTVTWVGDANNMAYTWIQAAEILGFRFHF 184

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVF 241
           + P G +     +  A +    V +F + ++A  GAH V TD W SM  E +    +  F
Sbjct: 185 SAPKGYQLDPAMV--ADSSRPFVHVFENPLEACDGAHLVTTDVWTSMGYEAENEARKKAF 242

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
             + V  ++M  A PDALFMHCLPAHRGEEV   V+DG QSVV+DEAENRLH QKA++ +
Sbjct: 243 GDWMVTEAMMQRAQPDALFMHCLPAHRGEEVEAAVIDGKQSVVWDEAENRLHVQKALMEY 302

Query: 302 CF 303
             
Sbjct: 303 LL 304


>gi|187929898|ref|YP_001900385.1| ornithine carbamoyltransferase [Ralstonia pickettii 12J]
 gi|226739203|sp|B2UBA4|OTC_RALPJ RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|187726788|gb|ACD27953.1| ornithine carbamoyltransferase [Ralstonia pickettii 12J]
          Length = 308

 Score =  215 bits (546), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 127/306 (41%), Positives = 178/306 (58%), Gaps = 6/306 (1%)

Query: 2   MTYP---KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRT 58
           M  P   KH+    + S      +++ +  +K   +N     PL  + LAMIFEK STRT
Sbjct: 1   MNPPSSIKHYLQFKDFSLEEYEYLLDRSAILKAKFKNYETWHPLHDRTLAMIFEKNSTRT 60

Query: 59  RVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTE 118
           R+SFE  +  LGG  +FL+  + QLGR E I D A+V+SR  D I++RT     +     
Sbjct: 61  RLSFEAGIHQLGGHAVFLNTRDSQLGRGEPIEDAAQVISRMTDIIMIRTFGQEIIERFAA 120

Query: 119 YATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNY 178
           ++ VPVIN LT+  HPCQ++ADI TF E RG +KGK  +W GD NN+ ++ ++ A    +
Sbjct: 121 HSRVPVINGLTNEYHPCQVLADIFTFIEQRGPIKGKTVTWVGDANNMAYTWVQAAEILGF 180

Query: 179 LLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-E 237
             + + P G +     +  A +    V +F + ++A  GAH V TD W SM  E +    
Sbjct: 181 RFHFSAPKGYQLDPAMV--ADSALPFVHVFENPLEACDGAHLVTTDVWTSMGYEAENEAR 238

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
           +  F  + V  ++M  A PDALFMHCLPAHRGEEV   V+DG QSVV+DEAENRLH QKA
Sbjct: 239 KKAFGDWMVTEAMMQRAQPDALFMHCLPAHRGEEVEAAVIDGKQSVVWDEAENRLHVQKA 298

Query: 298 ILLWCF 303
           ++ +  
Sbjct: 299 LMEYLL 304


>gi|299535491|ref|ZP_07048812.1| ornithine carbamoyltransferase [Lysinibacillus fusiformis ZC1]
 gi|298728691|gb|EFI69245.1| ornithine carbamoyltransferase [Lysinibacillus fusiformis ZC1]
          Length = 321

 Score =  215 bits (546), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 131/305 (42%), Positives = 191/305 (62%), Gaps = 5/305 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K    L + +S  +  +IE+A ++K  ++     + L GK L MIFEK STRTR+SFE
Sbjct: 16  KGKDLLTLLDYTSQEVQDLIELATQLKMITKEGKCPRLLEGKTLGMIFEKHSTRTRISFE 75

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M  LGG ++F+   ++Q+GR E+I DTA VLS Y+D I++R  +H+ + EL E+A +P
Sbjct: 76  VGMNQLGGKSMFMHARDLQIGRGESIYDTAHVLSGYLDGIMIRANSHAMVKELAEHAVIP 135

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQ +AD+ T  E++G +KG   ++ GDGNN+ HSL+  +A     + +A
Sbjct: 136 VINGLTDIYHPCQALADLETIAENKGMLKGLKIAYVGDGNNVAHSLVVASAHVGMNVAVA 195

Query: 184 TPIGSEPRNEYLNWARNQGASV----ALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREE 238
           TP+G E   E +  A+   A+      + +D V+AV  A  V+ D W SM QE + A+  
Sbjct: 196 TPVGYECDGEVIAKAQAIAAANGSTIMITNDPVEAVLNADVVYADVWTSMGQEEEAAKRL 255

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F  +Q+N  L++ A P+ +F+HCLPAHR EEV   V+DGP S +F++AENRLH QKA+
Sbjct: 256 QDFAGYQINDELVAYAKPNYMFLHCLPAHREEEVATSVIDGPNSYIFEQAENRLHAQKAV 315

Query: 299 LLWCF 303
           L    
Sbjct: 316 LASIL 320


>gi|260427506|ref|ZP_05781485.1| ornithine carbamoyltransferase [Citreicella sp. SE45]
 gi|260421998|gb|EEX15249.1| ornithine carbamoyltransferase [Citreicella sp. SE45]
          Length = 329

 Score =  215 bits (546), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 161/307 (52%), Positives = 209/307 (68%), Gaps = 7/307 (2%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFE-----NKPLSGKVLAMIFEKPSTR 57
               HF D+     + L  II+ AK IKN+           + PL   ++A+IFEKPSTR
Sbjct: 20  NRMNHFLDIHKTDKAALRSIIDSAKDIKNARSGRRRAALDDDLPLKDHMVALIFEKPSTR 79

Query: 58  TRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELT 117
           TR SF+V ++ +GG T+ LSGS+MQLG  ETI DTA+V+SR+VD I++RT + S L+E+ 
Sbjct: 80  TRTSFDVGVRQMGGQTMVLSGSDMQLGHGETIADTARVMSRFVDMIMIRTFDESVLIEMA 139

Query: 118 EYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFN 177
           EYA+VPVIN LTD THPCQI+AD+MTFEEHRG ++GK   W GDGNN+  S +  A +F 
Sbjct: 140 EYASVPVINGLTDRTHPCQIMADVMTFEEHRGPIEGKKVVWCGDGNNVCASFLHAAGQFG 199

Query: 178 YLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE 237
           + L    P+  +P  E++  AR  GA+V +  D  +AV+GA  V  DTW+SM+    ARE
Sbjct: 200 FDLTFTGPVQLDPEMEFVGLARQAGAAVTIERDPFKAVEGADLVVADTWVSMHDAQSARE 259

Query: 238 EHVFQ--PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
                  P+QVN +LM  A  DALFMHCLPAHRGEEV +EV+DGPQSV++DEAENRLH Q
Sbjct: 260 RRHNMLRPYQVNEALMEAAGKDALFMHCLPAHRGEEVTSEVMDGPQSVIWDEAENRLHAQ 319

Query: 296 KAILLWC 302
           KAI+ WC
Sbjct: 320 KAIMRWC 326


>gi|332188918|ref|ZP_08390621.1| ornithine carbamoyltransferase [Sphingomonas sp. S17]
 gi|332011058|gb|EGI53160.1| ornithine carbamoyltransferase [Sphingomonas sp. S17]
          Length = 307

 Score =  215 bits (546), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 146/310 (47%), Positives = 197/310 (63%), Gaps = 9/310 (2%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-----PLSGKVLAMIFEKPST 56
           MT  +HF +L++     ++ I+  A+  K +     + +     PLSG VLAM+FEK ST
Sbjct: 1   MTI-RHFLNLADAGPEGVTAILTDARVRKAARAGFTKGRVDADAPLSGHVLAMVFEKNST 59

Query: 57  RTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLEL 116
           RTRVSF++A++ LGG +I L    MQLGR ETI DTA++LS Y DAI++RT +H+++ E+
Sbjct: 60  RTRVSFDMAIRQLGGTSIVLDAGTMQLGRGETIADTARILSGYTDAIMIRTDDHAKVEEM 119

Query: 117 TEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARF 176
             YA+VPVIN LTD +HPCQI+AD++T  E    + G   +W GDGNN+LHS++E     
Sbjct: 120 AHYASVPVINGLTDLSHPCQIMADLLTVIEAGKPLSGMKVAWLGDGNNVLHSIVEAGGLL 179

Query: 177 NYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR 236
            + +  A P G  P    L              D   AV+GA  V TDTWISM Q     
Sbjct: 180 GFDVVAACPNGYHPEPGTLEL---GRGRATCTTDPRVAVEGADIVVTDTWISMGQAHVEE 236

Query: 237 EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
           +     PFQVN  LM++A PDA F+HCLPAHR EEV ++V+DGPQS+++ EAENRLH QK
Sbjct: 237 KLAAMMPFQVNSELMALAKPDAKFLHCLPAHREEEVTSDVIDGPQSLIWPEAENRLHAQK 296

Query: 297 AILLWCFGII 306
           ++L WCFG I
Sbjct: 297 SVLRWCFGQI 306


>gi|257094645|ref|YP_003168286.1| ornithine carbamoyltransferase [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257047169|gb|ACV36357.1| ornithine carbamoyltransferase [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 324

 Score =  215 bits (546), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 117/302 (38%), Positives = 167/302 (55%), Gaps = 1/302 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M   KHF    + + +  + + E A+ IK   +   +  PL  + L MIFEK STRTR+S
Sbjct: 1   MDSVKHFLQFRDCTRAEYAHLFERARWIKAEFKAYRKYWPLCDRTLVMIFEKASTRTRLS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M+ LGG  I+L+  + QL R E++ D A+V+SR  D +++RT   + +      + 
Sbjct: 61  FEAGMQQLGGSAIYLNSRDSQLQRGESVEDAAQVISRMSDVVMIRTFEQAMIERFAANSR 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LT+  HPCQI+ADI TF EHRGS++GK  +W GD NN+ ++ ++ A   ++ ++
Sbjct: 121 VPVINGLTNEYHPCQILADIFTFMEHRGSIQGKTVAWIGDSNNVCNTWLQAAEVLDFRVH 180

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           ++TP G E                                   T     +         F
Sbjct: 181 VSTPPGYEVEPARAGLHGTAHFEQFADPMDAARAADLVTTDVWTS-MGFEAENDERRRDF 239

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
             +QV++ +M  A P ALFMHCLP HRGEEV   V+DGPQSVV+DEAENR+HTQKA+L +
Sbjct: 240 ADWQVDVEMMRAARPQALFMHCLPVHRGEEVAAAVIDGPQSVVWDEAENRMHTQKALLEY 299

Query: 302 CF 303
             
Sbjct: 300 LL 301


>gi|89070724|ref|ZP_01157986.1| ornithine carbamoyltransferase [Oceanicola granulosus HTCC2516]
 gi|89043682|gb|EAR49887.1| ornithine carbamoyltransferase [Oceanicola granulosus HTCC2516]
          Length = 308

 Score =  215 bits (546), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 162/307 (52%), Positives = 206/307 (67%), Gaps = 7/307 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFE-----NKPLSGKVLAMIFEKPSTRTR 59
             HF D+     + L  II+ A+ +K++     +       PL+G+++A+IFEKPSTRTR
Sbjct: 1   MTHFLDIHCTDPAQLRGIIDAARAMKDARAGRPKGTPDDETPLAGRMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V ++ +GG+T+ LSGSEMQLG  ETI DTA+VLSRYVD I++RT     LLE+ EY
Sbjct: 61  VSFDVGVRQMGGETMVLSGSEMQLGHGETIADTARVLSRYVDLIMIRTFEEQTLLEMAEY 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           A VPVIN LT+ +HPCQI+ADIMTFEEHRG ++G+   WSGDGNN+  S    A +F + 
Sbjct: 121 ADVPVINGLTNRSHPCQIMADIMTFEEHRGPIRGRKVVWSGDGNNVFTSFAHAAGQFGFD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L    P   EP  E L   R  G  V +  D  +AV GA  V TDTW+SM+    ARE  
Sbjct: 181 LTFTGPPPLEPERELLEEVRAAGGKVEVVRDPAEAVAGADLVVTDTWVSMHDPQSARERR 240

Query: 240 VFQ--PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
             Q   +QVN +LM+ A PDALFMHCLPAHR +E  +EV+DGP SV+FDEAENRLH QKA
Sbjct: 241 HNQLRGYQVNAALMARAKPDALFMHCLPAHRDDEATSEVMDGPHSVIFDEAENRLHAQKA 300

Query: 298 ILLWCFG 304
           I+ WC G
Sbjct: 301 IMRWCLG 307


>gi|302184727|ref|ZP_07261400.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. syringae
           642]
          Length = 306

 Score =  215 bits (546), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 148/298 (49%), Positives = 195/298 (65%), Gaps = 4/298 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  + + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSMMDYTPDELLGLIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I D+AKV+SR +DA+V+RT  HS L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSHRDTQLGRGEPIADSAKVMSRMLDAVVIRTYAHSNLTEFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS+KGK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFLEHRGSIKGKTVAWIGDGNNMCNSYIEAAIQFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP  E+L  A   G  V +  D   AV GAH V TD W SM QE + AR + +F PF
Sbjct: 184 AGYEPNAEFLALA---GERVTVVRDPKAAVAGAHLVSTDVWTSMGQEEETARRKKLFAPF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           QV  +L+ +A  D LFMHCLPAHRGEE+  ++LD  +SV +D+AENRLH QKA+L + 
Sbjct: 241 QVTRALLDLADKDVLFMHCLPAHRGEEISVDLLDDSRSVAWDQAENRLHAQKALLEFL 298


>gi|218191426|gb|EEC73853.1| hypothetical protein OsI_08616 [Oryza sativa Indica Group]
          Length = 364

 Score =  215 bits (546), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 131/302 (43%), Positives = 182/302 (60%), Gaps = 2/302 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFEN-KPLSGKVLAMIFEKPSTRTRVSFE 63
           PK F  + +     +  I+  A ++K   ++   + +P  GK +AMIF KPS RTRVSFE
Sbjct: 62  PKDFLHIDDFDKDTIMKILNRAIEVKAMIKSGDRSFQPFKGKSMAMIFAKPSMRTRVSFE 121

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
                LGG  I+L   ++Q+G+ E   D A+VLS Y D I+ R   H  +L+L +YA VP
Sbjct: 122 TGFFLLGGHAIYLGPDDIQMGKREETRDVARVLSGYNDIIMARVFAHQDILDLAKYAAVP 181

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQI+AD +T  EH G ++     + GDGNNI+HS +  AA F      A
Sbjct: 182 VINGLTDYNHPCQIMADALTMLEHIGRIENTKVVYVGDGNNIVHSWLRLAALFPLHFVCA 241

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHVFQ 242
            P G EP  + +  AR+ G+ + +  D ++AVKGA  V+TD W SM Q+ +A   + VFQ
Sbjct: 242 CPKGFEPDAKTVEIARSAGSKIEITDDPMEAVKGADVVYTDVWASMGQKEEAEYRKKVFQ 301

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            F V+ ++M MA P+A  MHCLPA RG EV +  ++ P S+VF +AENR+H Q AI+L  
Sbjct: 302 GFTVDEAMMEMAGPNAFLMHCLPAERGIEVTDGAIEAPNSIVFPQAENRMHAQNAIMLHV 361

Query: 303 FG 304
            G
Sbjct: 362 LG 363


>gi|94968846|ref|YP_590894.1| ornithine carbamoyltransferase [Candidatus Koribacter versatilis
           Ellin345]
 gi|94550896|gb|ABF40820.1| ornithine carbamoyltransferase [Candidatus Koribacter versatilis
           Ellin345]
          Length = 323

 Score =  215 bits (546), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 129/302 (42%), Positives = 190/302 (62%), Gaps = 7/302 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAM 66
            F  + + +   +  ++++A  IK   +    ++ L GK +A+IFEKPS RTRVSF+V +
Sbjct: 5   DFLSIRDFTPQQIRHLLDLAMHIKAMPQAY--SRSLRGKTMALIFEKPSLRTRVSFDVGI 62

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
           + LGG +++LS +E+ LG+ E + D AK L R V  I++RT  H  + ++  +A++P+IN
Sbjct: 63  QQLGGFSVYLSPAEINLGKREGVYDVAKNLERMVQGIMIRTFAHRIVEDMAAFASIPIIN 122

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI 186
            LTD +HPCQ +AD MT  E +G + G   ++ GDGNN+ HSL+   A+    + +ATP 
Sbjct: 123 GLTDYSHPCQAMADYMTIFEAKGRLSGLKLAYVGDGNNVAHSLMFAGAQLGVHVWVATPD 182

Query: 187 GSEPRNEYLNWARNQGAS----VALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVF 241
           G EP +    WA  + A       + +D V AV+ A  ++TD W SM QE +A   + +F
Sbjct: 183 GYEPDHAAREWATRRAAETGGSCTITNDPVAAVEDADVIYTDVWASMGQESEAALRKKIF 242

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
            P+QVN  L + A PD +FMHCLPAHRG+EV +EV+D P+S VF EAENRLH QKAI+L 
Sbjct: 243 LPYQVNGKLFAQAKPDTIFMHCLPAHRGDEVTDEVIDSPRSFVFPEAENRLHAQKAIMLE 302

Query: 302 CF 303
             
Sbjct: 303 LM 304


>gi|313683290|ref|YP_004061028.1| ornithine carbamoyltransferase [Sulfuricurvum kujiense DSM 16994]
 gi|313156150|gb|ADR34828.1| ornithine carbamoyltransferase [Sulfuricurvum kujiense DSM 16994]
          Length = 306

 Score =  215 bits (546), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 129/303 (42%), Positives = 184/303 (60%), Gaps = 6/303 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            +HF  L + +   +  I+ +  +IK   +       ++G+ LAMIFEK STRTRVSFEV
Sbjct: 1   MRHFLTLKDYTKEEILEILTIGLEIKKEVKAKEFKPRMAGQTLAMIFEKSSTRTRVSFEV 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG  +FLS  ++ LGR E + DTA+V+S   D +++RT   + L E   Y+ VPV
Sbjct: 61  GMYQLGGHALFLSNRDIHLGRGEPVKDTARVISSMCDMVMIRTYEQAMLEEFALYSKVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN L+D+ HP Q++AD MT     G  K  + ++ GDGNN+ HS +  +A+  + L +AT
Sbjct: 121 INGLSDSYHPVQLLADYMTM-MECGKDKNPVVAYVGDGNNMTHSWLMLSAKLGFELRVAT 179

Query: 185 PIGSEPRNEYLNWARNQGAS----VALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEH 239
           P G E     +  A          +   +D  +AVKGA  V TDTWISM QE + A+   
Sbjct: 180 PKGYECDPAIIADALALAEQSGAKITFTNDPKEAVKGATVVTTDTWISMGQEEEKAQRIK 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ + V+ +LM++A  DA+F+HCLPA+RG EV   VLDG QSV+F+EAENRLH QK ++
Sbjct: 240 AFEGYIVDEALMALATDDAIFLHCLPAYRGVEVSEAVLDGAQSVIFEEAENRLHAQKGLM 299

Query: 300 LWC 302
           +W 
Sbjct: 300 VWL 302


>gi|241664008|ref|YP_002982368.1| ornithine carbamoyltransferase [Ralstonia pickettii 12D]
 gi|309781400|ref|ZP_07676136.1| ornithine carbamoyltransferase [Ralstonia sp. 5_7_47FAA]
 gi|240866035|gb|ACS63696.1| ornithine carbamoyltransferase [Ralstonia pickettii 12D]
 gi|308919813|gb|EFP65474.1| ornithine carbamoyltransferase [Ralstonia sp. 5_7_47FAA]
          Length = 308

 Score =  215 bits (546), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 128/306 (41%), Positives = 178/306 (58%), Gaps = 6/306 (1%)

Query: 2   MTYP---KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRT 58
           M  P   KH+    + S      +++ +  +K   +N     PL  + LAMIFEK STRT
Sbjct: 1   MNPPSSIKHYLQFKDFSLEEYEYLLDRSAILKAKFKNYETWHPLHDRTLAMIFEKNSTRT 60

Query: 59  RVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTE 118
           R+SFE  +  LGG  +FL+  + QLGR E I D A+V+SR  D I++RT     +     
Sbjct: 61  RLSFEAGIHQLGGHAVFLNTRDSQLGRGEPIEDAAQVISRMTDIIMIRTFGQEIIERFAA 120

Query: 119 YATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNY 178
           ++ VPVIN LT+  HPCQ++ADI TF E RG +KGK  +W GD NN+ ++ I+ A    +
Sbjct: 121 HSRVPVINGLTNEYHPCQVLADIFTFIEQRGPIKGKTVTWVGDANNMAYTWIQAAEILGF 180

Query: 179 LLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-E 237
             + + P G +     +  A +    V +F + ++A  GAH V TD W SM  E +    
Sbjct: 181 RFHFSAPKGYQLDPAMV--ADSALPFVHVFENPLEACDGAHLVTTDVWTSMGYEAENEAR 238

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
           +  F  + V  ++M  A PDALFMHCLPAHRGEEV   V+DG QSVV+DEAENRLH QKA
Sbjct: 239 KKAFGDWMVTEAMMQRAQPDALFMHCLPAHRGEEVEAAVIDGKQSVVWDEAENRLHVQKA 298

Query: 298 ILLWCF 303
           ++ +  
Sbjct: 299 LMEYLL 304


>gi|163747267|ref|ZP_02154622.1| ornithine carbamoyltransferase [Oceanibulbus indolifex HEL-45]
 gi|161379542|gb|EDQ03956.1| ornithine carbamoyltransferase [Oceanibulbus indolifex HEL-45]
          Length = 301

 Score =  215 bits (546), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 142/305 (46%), Positives = 192/305 (62%), Gaps = 10/305 (3%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENI-----FENKPLSGKVLAMIFEKPSTRTR 59
             HF D+     ++L  II+ A  +K + +        +++PL  +++A+IFEKPSTRTR
Sbjct: 1   MNHFLDIHQTDPADLRQIIDNAAAMKAARQGRPRGAADDDQPLKDQMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V ++ +GG T+ LSG++MQLG  ETI DTA+VLSRYVD I++RT     LLE+ EY
Sbjct: 61  VSFDVGVRQMGGQTMVLSGADMQLGHGETIADTARVLSRYVDMIMIRTFEEQTLLEMAEY 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ATVPVIN LT+ THPCQI+ADI TFEEHRG +KG+   WSGDGNN+  SL   A +F++ 
Sbjct: 121 ATVPVINGLTNRTHPCQIMADIQTFEEHRGPIKGRKVVWSGDGNNVFASLAHAAKQFDFD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L    P   +        A +   ++                 T   +   Q  + R  +
Sbjct: 181 LVFTGPQTLD-----PEAALDGLYTIERDPQKAVEGADLVVTDTWVSMHDPQSARERRHN 235

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             + +QVN +LMS+A PDALFMHCLPAHR +E  + V+DGP SV+FDEAENRLH QKA++
Sbjct: 236 QLRGYQVNDALMSLAKPDALFMHCLPAHRDDEATSSVMDGPHSVIFDEAENRLHAQKAVM 295

Query: 300 LWCFG 304
            WC G
Sbjct: 296 RWCLG 300


>gi|326497643|dbj|BAK05911.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 371

 Score =  215 bits (546), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 129/302 (42%), Positives = 182/302 (60%), Gaps = 2/302 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFEN-KPLSGKVLAMIFEKPSTRTRVSFE 63
           PK F  +++     +  I+  A ++K   ++   + +P  GK +AM+F KPS RTRVSFE
Sbjct: 69  PKDFLHINDFDKDTIMKILNRAIEVKAMIKSGDRSFQPFKGKSMAMVFAKPSMRTRVSFE 128

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
                LGG  ++L   ++Q+G+ E   D A+VLS Y D I+ R   H  +L+L +YA VP
Sbjct: 129 TGFFLLGGHAVYLGPDDIQMGKREETRDVARVLSGYNDIIMARVFAHQDILDLAKYAPVP 188

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQI+AD +T  EH G ++     + GDGNNI+HS +  AA   +    A
Sbjct: 189 VINGLTDYNHPCQIMADALTMIEHIGRIENTKVVYVGDGNNIVHSWLLLAAVIPFHFVCA 248

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHVFQ 242
            P G EP  + +  AR+ G+ + + +D  +AVKGA  V+TD W SM Q+ +A   + VFQ
Sbjct: 249 CPKGFEPDAKTVEIARSAGSKIEITNDPKEAVKGADVVYTDVWASMGQKEEAEYRKQVFQ 308

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            F V+ +LM MA P A  MHCLPA RG EV +  ++ P S+VF +AENR+H Q AI+L  
Sbjct: 309 GFMVDEALMEMAGPKAFLMHCLPAERGVEVTDGAIEAPNSIVFPQAENRMHAQNAIMLHV 368

Query: 303 FG 304
            G
Sbjct: 369 LG 370


>gi|207721724|ref|YP_002252163.1| ornithine carbamoyltransferase (otcase) protein [Ralstonia
           solanacearum MolK2]
 gi|206586886|emb|CAQ17471.1| ornithine carbamoyltransferase (otcase) protein [Ralstonia
           solanacearum MolK2]
          Length = 308

 Score =  215 bits (546), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 127/302 (42%), Positives = 179/302 (59%), Gaps = 3/302 (0%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           +  KH+    + S      +++ ++ +K   +N     PL  + LAMIFEK STRTR+SF
Sbjct: 5   SKIKHYLQFKDFSLEEYEYLLDRSRILKAKFKNYETWHPLHDRTLAMIFEKNSTRTRLSF 64

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E  +  LGG  +FL+  + QLGR E I D A+V+SR  D I++RT     +     ++ V
Sbjct: 65  EAGIHQLGGHAVFLNTRDSQLGRGEPIEDAAQVISRMTDIIMIRTFGQEIIERFAAHSRV 124

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVIN LT+  HPCQ++ADI TF E RGS+KGK  +W GD NN+ ++ I+ A    +  + 
Sbjct: 125 PVINGLTNEYHPCQVLADIFTFIEQRGSIKGKTITWVGDANNMAYTWIQAAEILGFRFHF 184

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVF 241
           + P G +     +  A +    V +F + ++A  GAH V TD W SM  E +    +  F
Sbjct: 185 SAPKGYQLDPAMV--ADSSRPFVHVFENPLEACDGAHLVTTDVWTSMGYEAENEARKKAF 242

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
             + V  ++M  A PDALFMHCLPAHRGEEV   V+DG QSVV+DEAENRLH QKA++ +
Sbjct: 243 GDWMVTEAMMQRAQPDALFMHCLPAHRGEEVEAAVIDGKQSVVWDEAENRLHVQKALMEY 302

Query: 302 CF 303
             
Sbjct: 303 LL 304


>gi|229588686|ref|YP_002870805.1| ornithine carbamoyltransferase [Pseudomonas fluorescens SBW25]
 gi|229360552|emb|CAY47409.1| ornithine carbamoyltransferase [Pseudomonas fluorescens SBW25]
          Length = 306

 Score =  215 bits (546), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 134/301 (44%), Positives = 188/301 (62%), Gaps = 3/301 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M+  +HF  L + +   L  +I    ++K+        +PL  +VL MIFEK STRTRVS
Sbjct: 1   MSA-RHFLSLMDCTPEELVSVIRRGIELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRVS 59

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  IFLS  + QLGR E I D+A+V+SR +DA+++RT  HS + E   ++ 
Sbjct: 60  FEAGMIQLGGQAIFLSSRDTQLGRGEPIADSARVMSRMLDAVMIRTFAHSTVTEFAAHSR 119

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN L+D+ HPCQ++AD+ TF EHRGS++GK  +W GDGNN+ +S IE A +F++ L 
Sbjct: 120 VPVINGLSDDLHPCQLLADMQTFLEHRGSIQGKTVAWIGDGNNMCNSYIEAAIQFDFHLR 179

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           +A P G EP  E+L  A  +   +    DAV            +     ++  A+   +F
Sbjct: 180 VACPEGFEPSAEFLAKADGRVQLLRDPKDAVVGAHLVSTDVWTSM--GQEDETAKRLALF 237

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
            P+QV   L+ +A PD LFMHCLPAHRGEE+  ++LD P+SV +D+AENRLH QKA+L +
Sbjct: 238 APYQVTRELLDLAAPDVLFMHCLPAHRGEEISLDLLDDPRSVAWDQAENRLHAQKALLEF 297

Query: 302 C 302
            
Sbjct: 298 L 298


>gi|170698611|ref|ZP_02889679.1| ornithine carbamoyltransferase [Burkholderia ambifaria IOP40-10]
 gi|172061514|ref|YP_001809166.1| ornithine carbamoyltransferase [Burkholderia ambifaria MC40-6]
 gi|170136464|gb|EDT04724.1| ornithine carbamoyltransferase [Burkholderia ambifaria IOP40-10]
 gi|171994031|gb|ACB64950.1| ornithine carbamoyltransferase [Burkholderia ambifaria MC40-6]
          Length = 309

 Score =  215 bits (546), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 121/304 (39%), Positives = 173/304 (56%), Gaps = 3/304 (0%)

Query: 2   MTYP--KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    +H+    + S  +   ++E    +K   +N     PL  + LAMIFEK STRTR
Sbjct: 1   MTAKTIRHYLQFKDFSLEDYEYVLERTGILKRKFKNYETYHPLHDRTLAMIFEKSSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +F+S  + QLGR E + D+A+V+SR VD I++RT     +    + 
Sbjct: 61  LSFEAGIFQLGGHAVFMSTRDTQLGRGEPVEDSAQVISRMVDIIMIRTFEQDVITRFAQN 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT++ HPCQ++ADI T+ EHRG + GK  +W GD NN+L++ IE A    + 
Sbjct: 121 SRVPVINGLTNDYHPCQVLADIFTYYEHRGPIAGKTVAWVGDANNMLYTWIEAAQILGFK 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L ++TP G     + ++        V    +              T +    E +A  + 
Sbjct: 181 LRLSTPPGYALDMKLVSPDSAPFYEVFDDPNEACKGADLVTTDVWTSMGFEAENEA-RKQ 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  + V+  +M  A+ DALFMHCLPAHRGEEV   V+DGPQSVV+DEAENRLH QKA++
Sbjct: 240 AFADWCVDEEMMGHANADALFMHCLPAHRGEEVTAGVIDGPQSVVWDEAENRLHVQKALM 299

Query: 300 LWCF 303
            +  
Sbjct: 300 EFLL 303


>gi|20094506|ref|NP_614353.1| ornithine carbamoyltransferase [Methanopyrus kandleri AV19]
 gi|32699459|sp|Q8TWG4|OTC_METKA RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|19887615|gb|AAM02283.1| Ornithine carbamoyltransferase [Methanopyrus kandleri AV19]
          Length = 312

 Score =  215 bits (546), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 125/304 (41%), Positives = 168/304 (55%), Gaps = 7/304 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKP-LSGKVLAMIFEKPSTRTRVSFEVA 65
           H   ++++   ++  ++ VA++ K          P L GK L +IFEKPSTRTRVSFEVA
Sbjct: 10  HLLSIADLDREDVETVLRVAERFKERYLAGERVIPILEGKTLGLIFEKPSTRTRVSFEVA 69

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG     +  E+QLGR E I DTA VLSRY+D +++R   H  + E   Y+ VPVI
Sbjct: 70  MHQLGGQAFTYTKQELQLGRGEAIKDTAAVLSRYLDGVMIRARRHEDIEEFARYSEVPVI 129

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D  HPCQ + D  T  E  G       ++ GDGNN+  SL    A   +    A P
Sbjct: 130 NGLSDLEHPCQALTDAFTIREKLGRGPH-TVAFVGDGNNVCSSLALVCATLGWDFVHAVP 188

Query: 186 IGSEP----RNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHV 240
            G E       E    A   G+   +  D  +AV+ A  V+TD W+SM  E +      V
Sbjct: 189 EGYECPDRVWREVERRAEESGSETRVVRDPKEAVREADVVYTDVWVSMGDEAEREERLRV 248

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+P+QVN  LMS A   A+ MHC+P  RG E+ ++V D  +SV++D+AENRLH QKAIL 
Sbjct: 249 FRPYQVNEELMSHAPEHAIVMHCMPIQRGYELTDDVADSERSVIYDQAENRLHVQKAILA 308

Query: 301 WCFG 304
              G
Sbjct: 309 LLMG 312


>gi|317131147|ref|YP_004090461.1| ornithine carbamoyltransferase [Ethanoligenens harbinense YUAN-3]
 gi|315469126|gb|ADU25730.1| ornithine carbamoyltransferase [Ethanoligenens harbinense YUAN-3]
          Length = 300

 Score =  215 bits (546), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 130/301 (43%), Positives = 187/301 (62%), Gaps = 2/301 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH   L ++S+  +  I+ +  ++K   ++   +  L+GK L MIFEK STRTRVSFE 
Sbjct: 1   MKHLLKLLDLSTQEILDILNLGDQLKYELKHGIPHPRLAGKSLGMIFEKASTRTRVSFET 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG  +FLS  E Q+GR E I DTA+VLSRY+  I++RT   + +  L ++A++P+
Sbjct: 61  GMYQLGGHALFLSSKESQIGRGEPIQDTARVLSRYLSGIMIRTFEQAEVQALADHASIPI 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD  HPCQ++AD+MT  EH+G ++G    + GDGNN+ +SLI G  +    + +AT
Sbjct: 121 INGLTDFAHPCQVLADLMTVREHKGRLEGLKLCFIGDGNNMANSLIVGGLKVGMQVAVAT 180

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQP 243
           P   EP    L++A  +    +L    ++A  GA  V TD W SM QE + A+    F  
Sbjct: 181 PENYEPDASVLDFA-QKQGGFSLVRSPLEAAAGADVVITDVWASMGQEEEAAKRRKAFAG 239

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +QVN  LM++A PDA+  HCLPAHRGEE+  +V +     +F+EAENRLH QKA+++   
Sbjct: 240 YQVNKELMAVAKPDAMVQHCLPAHRGEEITADVFEAHADEIFEEAENRLHAQKAVMVQLM 299

Query: 304 G 304
           G
Sbjct: 300 G 300


>gi|86741857|ref|YP_482257.1| ornithine carbamoyltransferase [Frankia sp. CcI3]
 gi|86568719|gb|ABD12528.1| ornithine carbamoyltransferase [Frankia sp. CcI3]
          Length = 340

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 135/308 (43%), Positives = 192/308 (62%), Gaps = 7/308 (2%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSE-NIFENKPLSGKVLAMIFEKPSTRTRV 60
           MT  +HF   ++++ +  + ++++A   K          +PL+G+ +A++FEKPSTRTR+
Sbjct: 1   MTV-RHFLLDTDLTPAEQTALLDLADGFKARRRVTRLTERPLAGRSVALLFEKPSTRTRL 59

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SF+V +  LGG  + +  +  QLGR ETI DTA VLSRYVDAIV+RT    RL  L   A
Sbjct: 60  SFDVGVAELGGHPVVIDAASAQLGRGETIEDTAAVLSRYVDAIVVRTFAQERLERLAAAA 119

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           TVPVINAL+D+ HPCQ +AD+ T  E RG + G   ++ GDGNN+ HSL+   A     +
Sbjct: 120 TVPVINALSDHAHPCQALADLQTIRERRGRLAGLTLTYLGDGNNVAHSLLLAGASAGMRV 179

Query: 181 NIATPIGSEPRNEYLNWARNQGASVA----LFHDAVQAVKGAHCVFTDTWISMNQEFKAR 236
           ++A+P G EP  + +  A   G        + HDA++A  GA  ++TD W SM QE ++ 
Sbjct: 180 HVASPPGYEPFEQVVRHANEIGMVTGGEALVMHDALEAAAGADVLYTDVWASMGQESESD 239

Query: 237 -EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
               VFQP++++   +  A PD + MHCLPAHR  E+   V+DGP+SVVFD+AENRLH Q
Sbjct: 240 SRALVFQPYRLDEKAVEAASPDVIVMHCLPAHRELEITTSVIDGPRSVVFDQAENRLHAQ 299

Query: 296 KAILLWCF 303
           KA+L    
Sbjct: 300 KALLSILL 307


>gi|227833172|ref|YP_002834879.1| Ornithine carbamoyltransferase [Corynebacterium aurimucosum ATCC
           700975]
 gi|262184157|ref|ZP_06043578.1| ornithine carbamoyltransferase [Corynebacterium aurimucosum ATCC
           700975]
 gi|227454188|gb|ACP32941.1| Ornithine carbamoyltransferase [Corynebacterium aurimucosum ATCC
           700975]
          Length = 305

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 135/301 (44%), Positives = 191/301 (63%), Gaps = 8/301 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRVSFEV 64
           +HF    +++    + ++++A K+K   +  F  +PL G K +A++F+K STRTR SFE 
Sbjct: 4   RHFLADDDLTPQEQAEVLDLALKLK---KEPFAERPLEGPKSVAVLFDKTSTRTRFSFEA 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            + HLGG  I       Q+G+ ET  DTA VLSR+V+AIV RT  H  LLE+ E ATVP+
Sbjct: 61  GIAHLGGHAIVTETKSTQMGKGETYQDTAAVLSRFVEAIVWRTYAHQNLLEMAETATVPI 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGD-GNNILHSLIEGAARFNYLLNIA 183
           +NAL+++ HPCQI+AD++T  E+ G + G+   + GD  NN+ +S + G A     + I 
Sbjct: 121 VNALSEDLHPCQILADLVTCRENFGDLAGRKAVYLGDGNNNMANSYMLGFATAGMEMTII 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQ 242
            P G +P+ E++  AR +G       D+++AV GA  V TDTW+SM QE         F 
Sbjct: 181 APEGFQPQPEFVERARKRGTVTVT--DSLEAVDGADVVITDTWVSMGQEDDGKDRRTPFL 238

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           P+QV   +MS A  +A+F+HCLPA+RG EV  EV+DGPQS VFDEAENRLH QKA+L+W 
Sbjct: 239 PYQVTPEVMSRAKEEAIFLHCLPAYRGNEVTAEVIDGPQSRVFDEAENRLHAQKALLVWL 298

Query: 303 F 303
            
Sbjct: 299 L 299


>gi|49084340|gb|AAT51193.1| PA3537 [synthetic construct]
          Length = 306

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 143/298 (47%), Positives = 196/298 (65%), Gaps = 4/298 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF    + S   L  +I    ++K+        +PL  +VL M+FEK STRTR+SFE  
Sbjct: 4   RHFLSFMDYSPEELIGLIRRGSELKDLRNRGVLYEPLKSRVLGMVFEKASTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E IGD+A+V+SR +D +++RT  H+ L E   ++ VPVI
Sbjct: 64  MIQLGGQAIFLSPRDTQLGRGEPIGDSARVMSRMLDGVMIRTFAHATLTEFAAHSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS++GK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFHEHRGSIQGKTVAWIGDGNNMCNSYIEAALKFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP+ E++  A   G  + +  D  +AV GAH V TD W SM QE + A    +F+P+
Sbjct: 184 EGYEPKAEFVALA---GDRLRVVRDPREAVAGAHLVSTDVWASMGQEDEAAARIALFRPY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           QVN +L+  A  D LFMHCLPAHRGEE+  E+LD P+SV +D+AENRLH QKA+L   
Sbjct: 241 QVNAALLDGAADDVLFMHCLPAHRGEEISEELLDDPRSVAWDQAENRLHAQKALLELL 298


>gi|226314883|ref|YP_002774779.1| ornithine carbamoyltransferase [Brevibacillus brevis NBRC 100599]
 gi|226097833|dbj|BAH46275.1| ornithine carbamoyltransferase [Brevibacillus brevis NBRC 100599]
          Length = 311

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 144/310 (46%), Positives = 195/310 (62%), Gaps = 9/310 (2%)

Query: 2   MTYPKH----FADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTR 57
           M   KH    F  +   +   L  ++ ++  +K   +     +PL GK L MIF+K STR
Sbjct: 1   MPLQKHKGKDFLRVDEFNGEELMELLHLSAHVKQLQKLGQPFQPLQGKTLGMIFDKASTR 60

Query: 58  TRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELT 117
           TRVSFEV M  LGG  +F+SG E+QLGR E I DTAKVLSRYVDAI++RT +HS + EL 
Sbjct: 61  TRVSFEVGMHQLGGLGMFMSGKELQLGRGEPISDTAKVLSRYVDAIMIRTFSHSYVEELA 120

Query: 118 EYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFN 177
            +A++P+IN LTD  HPCQ +AD++T  EH+G +KG   ++ GDGNN+ +SL+ GAA   
Sbjct: 121 LHASIPIINGLTDLYHPCQALADLLTIWEHKGKLKGIKLAYVGDGNNVANSLVLGAALLG 180

Query: 178 YLLNIATPIGSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF 233
             + +ATP+G E     +     +A+  G  + +  D ++AV GA  V+TD W SM  E 
Sbjct: 181 LDVRVATPVGYEMDTTIVAKATGYAKQSGGKMMVTTDPIEAVMGADAVYTDVWTSMGFEE 240

Query: 234 KAR-EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRL 292
           +       F  +QVN  L++ A  D LF+HCLPAHRGEEV   V+DG +SV+FD+AENRL
Sbjct: 241 ENEVRLKAFADYQVNEKLVAAADRDYLFLHCLPAHRGEEVTTGVIDGSRSVIFDQAENRL 300

Query: 293 HTQKAILLWC 302
           H QKAIL   
Sbjct: 301 HAQKAILAAL 310


>gi|168048963|ref|XP_001776934.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162671635|gb|EDQ58183.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 348

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 137/301 (45%), Positives = 185/301 (61%), Gaps = 3/301 (0%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFEN-KPLSGKVLAMIFEKPSTRTRVSFEVA 65
           HF  L +     L  I++ A ++K   ++   + +PL G  ++MIF KPS RTRVSFE  
Sbjct: 47  HFLHLDDFDKETLVHILDRAAEVKAKLKSGDRSYQPLKGMSMSMIFTKPSMRTRVSFETG 106

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
              LGG  I+L   ++QLG+ E   D A+VLS Y D I+ R   H  LL+L EY+ VPVI
Sbjct: 107 FYQLGGHAIYLGPDDIQLGKREETRDIARVLSGYNDVIMARLFAHKDLLDLAEYSKVPVI 166

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD  HPCQI+AD++T  E  GS++G    + GDGNN++HS +  AA F +    A P
Sbjct: 167 NGLTDYNHPCQIMADVLTINEFIGSIEGLKVVYVGDGNNMVHSWLRLAAVFPFHFVCACP 226

Query: 186 IGSEPRNEYLNWARNQ-GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHVFQP 243
            G EP    +  AR    + + + HD  +AVKGA+ ++ D W SM Q+  A   + VFQ 
Sbjct: 227 KGYEPDAATVERARRAGVSRIEISHDPTEAVKGANVIYADVWASMGQKEDAGNRKKVFQG 286

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           FQVN +LM  A P A FMHCLPA RG EV + V++GP+S+VF +AENR+H Q AI+L C 
Sbjct: 287 FQVNEALMKSAGPQAYFMHCLPAERGVEVTDGVIEGPKSIVFPQAENRMHAQNAIMLHCL 346

Query: 304 G 304
           G
Sbjct: 347 G 347


>gi|146279136|ref|YP_001169295.1| ornithine carbamoyltransferase [Rhodobacter sphaeroides ATCC 17025]
 gi|145557377|gb|ABP71990.1| ornithine carbamoyltransferase [Rhodobacter sphaeroides ATCC 17025]
          Length = 328

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 156/305 (51%), Positives = 213/305 (69%), Gaps = 7/305 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFE-----NKPLSGKVLAMIFEKPSTRTRVS 61
           HF D+    +  L  +++ A  +K + +   +     ++PL+G+++A+IFEKPSTRTRVS
Sbjct: 23  HFLDIHKTDTDALRQMMDSAHAMKAARQGRPKGQLDDDQPLAGRMVALIFEKPSTRTRVS 82

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           F+V ++ +GG T+ LSG EMQLG  ETI DTA+VLSRYVD I++RT   + LLE+ E+AT
Sbjct: 83  FDVGVRQMGGQTMVLSGKEMQLGHGETIADTARVLSRYVDLIMIRTFEEATLLEMAEHAT 142

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LT+ THPCQI+AD+MT+EEHRGS+ G+   W+GDGNN+  S +  A +F +   
Sbjct: 143 VPVINGLTNRTHPCQIMADVMTYEEHRGSISGRKVVWAGDGNNVCASFLHAAGQFGFDFT 202

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
              P   +P  E++ +AR +G  V++  D  +AV+GA  V TDTW+SM+    ARE    
Sbjct: 203 FTGPPTLDPEAEFVGYAREKGRRVSIERDPARAVEGADLVVTDTWVSMHDPQSARERRHN 262

Query: 242 Q--PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           Q  P+QVN +LM+ A PDALFMHCLPAHR +E  + V+DGP SV+FDEAENRLH QKAI+
Sbjct: 263 QLRPYQVNEALMAKARPDALFMHCLPAHRDDEATSAVMDGPHSVIFDEAENRLHAQKAIM 322

Query: 300 LWCFG 304
            WC G
Sbjct: 323 RWCLG 327


>gi|255538702|ref|XP_002510416.1| ornithine carbamoyltransferase, putative [Ricinus communis]
 gi|223551117|gb|EEF52603.1| ornithine carbamoyltransferase, putative [Ricinus communis]
          Length = 378

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 129/303 (42%), Positives = 184/303 (60%), Gaps = 3/303 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-PLSGKVLAMIFEKPSTRTRVSFEV 64
           K F  +S+   + +  I++ A ++K   ++   +  P  GK +AMIF KPS RTRVSFE 
Sbjct: 76  KDFVHISDFDKATIMKILDRAAEVKALLKSGDRSFLPFKGKTMAMIFAKPSMRTRVSFET 135

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
               LGG  I+L   ++Q+G+ E   D A+VLSRY D I+ R  +H  +L+L +YATVPV
Sbjct: 136 GFFLLGGHAIYLGPDDIQMGKREETCDVARVLSRYNDMIMARVFSHQDILDLAKYATVPV 195

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           +N LTD  HPCQI+AD +T  EH G ++G    + GDGNNI+HS +  A+   +      
Sbjct: 196 VNGLTDYNHPCQIMADALTIIEHIGQLEGTKVVYVGDGNNIVHSWLLLASVIPFHFICVC 255

Query: 185 PIGSEPRNEYLNWARNQ-GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHVFQ 242
           P G EP  E +  A+    + + + +D  +AV+GA  V++D W SM Q+ +A      FQ
Sbjct: 256 PKGFEPDAETVKKAQEAGISKIEITNDPKEAVRGADVVYSDVWASMGQKEEAAHRRKAFQ 315

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            FQV+  LM +A P A FMHCLPA RG EV + V++ P S+VF +AENR+H Q AI+L  
Sbjct: 316 GFQVDEDLMKLAGPKAYFMHCLPAERGVEVTDGVIEAPNSIVFPQAENRMHAQNAIMLHV 375

Query: 303 FGI 305
            G+
Sbjct: 376 LGL 378


>gi|118482555|gb|ABK93198.1| unknown [Populus trichocarpa]
          Length = 378

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 130/304 (42%), Positives = 185/304 (60%), Gaps = 3/304 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-PLSGKVLAMIFEKPSTRTRVSFE 63
            + F  +S+   + +  I++ A ++K   ++      P  GK +AMIF KPS RTRVSFE
Sbjct: 75  MEDFLHISDFDKATIMKILDRAAEVKAVIKSGDRTFLPFKGKTMAMIFAKPSMRTRVSFE 134

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
                LGG  I+L   ++Q+G+ E   D A+VLSRY D I+ R   H  +L+L ++ATVP
Sbjct: 135 TGFFLLGGHAIYLGPDDIQMGKREETRDVARVLSRYNDIIMARVFAHQDILDLAKHATVP 194

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQI+AD +T  EH G ++G    + GDGNNI+HS +  AA   +    A
Sbjct: 195 VINGLTDYNHPCQIMADALTIIEHVGRLEGTKVVYVGDGNNIVHSWLLLAAVIPFHFVCA 254

Query: 184 TPIGSEPRNEYLNWARN-QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHVF 241
            P G EP  + +  A+    + + + +D  +AV+GA  V++D W SM Q+ +A     VF
Sbjct: 255 CPKGFEPDAKTVQKAQQAGISKIEITNDPQEAVRGADVVYSDVWASMGQKEEAAHRRQVF 314

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           Q FQV+ +LM +A P A FMHCLPA RG EV + V++ P S+VF +AENR+H Q AI+L 
Sbjct: 315 QGFQVDENLMKLAGPKAYFMHCLPAERGVEVTDGVIEAPNSIVFPQAENRMHAQNAIMLH 374

Query: 302 CFGI 305
             G+
Sbjct: 375 ALGL 378


>gi|300690577|ref|YP_003751572.1| ornithine carbamoyltransferase [Ralstonia solanacearum PSI07]
 gi|299077637|emb|CBJ50273.1| ornithine carbamoyltransferase [Ralstonia solanacearum PSI07]
          Length = 308

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 126/302 (41%), Positives = 180/302 (59%), Gaps = 3/302 (0%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           +  KH+    + S      +++ ++ +K   +N     PL  + LAMIFEK STRTR+SF
Sbjct: 5   SKIKHYLQFKDFSLEEYEYLLDRSRILKAKFKNYETWHPLHDRTLAMIFEKNSTRTRLSF 64

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E  +  LGG  +FL+  + QLGR E I D A+V+SR  D I++RT     +     ++ V
Sbjct: 65  EAGIHQLGGHAVFLNTRDSQLGRGEPIEDAAQVISRMTDIIMIRTFGQEIIERFAAHSRV 124

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVIN LT+  HPCQ++ADI TF EHRG ++GK  +W GD NN+ ++ I+ A    +  + 
Sbjct: 125 PVINGLTNEYHPCQVLADIFTFIEHRGPIRGKTVTWVGDANNMAYTWIQAAEILGFRFHF 184

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVF 241
           + P G +     +  A +    V +F + ++A +GAH V TD W SM  E +    +  F
Sbjct: 185 SAPKGYQLDPAMV--ADSSSPFVHVFENPLEACEGAHLVTTDVWTSMGYEAENEARKKAF 242

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
             + V  ++M  A PDALFMHCLPAHRGEEV   V+DG QSVV+DEAENRLH QKA++ +
Sbjct: 243 GDWMVTEAMMQRAQPDALFMHCLPAHRGEEVEAAVIDGKQSVVWDEAENRLHVQKALMEY 302

Query: 302 CF 303
             
Sbjct: 303 LL 304


>gi|327398291|ref|YP_004339160.1| Ornithine carbamoyltransferase [Hippea maritima DSM 10411]
 gi|327180920|gb|AEA33101.1| Ornithine carbamoyltransferase [Hippea maritima DSM 10411]
          Length = 309

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 142/309 (45%), Positives = 203/309 (65%), Gaps = 6/309 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             +H   L +++   +  +++++++IKN  ++  + KPLSG +L MIFEKPSTRTR+SFE
Sbjct: 1   MIRHCLSLKDLTKQEILELLDLSQQIKNKIKSKQDYKPLSGVILGMIFEKPSTRTRLSFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
             MK LGGD IFLS  ++QLGR ETI DTA+V+SRYVD +++RT  HSR+    +Y+TVP
Sbjct: 61  AGMKRLGGDAIFLSPRDIQLGRGETIEDTARVISRYVDIVMIRTFEHSRIERFAQYSTVP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINALTD  HPCQ++AD++T +E  G ++    ++ GDGNN+ +S I  AA   + L +A
Sbjct: 121 VINALTDLLHPCQVLADLLTIKEKLGRIEDIKVAFFGDGNNMANSWIYAAAVLGFELRVA 180

Query: 184 TPIGSEPR----NEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREE 238
           TP+   P      E L  A   GA + L ++  +A K A  ++TD W SM QE  K ++ 
Sbjct: 181 TPVDFAPNGVVVKEALELATKSGARIILTNNPEEAAKDADVLYTDVWASMGQEDQKEKKH 240

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDG-PQSVVFDEAENRLHTQKA 297
            + +P+QVN  L+  A+ D +FMHCLPAHRGEEV  EV+D    SV+FDEAENR + Q A
Sbjct: 241 ALMRPYQVNRELVKYANKDYIFMHCLPAHRGEEVEAEVIDDEKHSVIFDEAENRTYAQLA 300

Query: 298 ILLWCFGII 306
            ++   G +
Sbjct: 301 TIMNLIGRV 309


>gi|315652176|ref|ZP_07905173.1| ornithine carbamoyltransferase [Eubacterium saburreum DSM 3986]
 gi|315485571|gb|EFU75956.1| ornithine carbamoyltransferase [Eubacterium saburreum DSM 3986]
          Length = 315

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 118/311 (37%), Positives = 176/311 (56%), Gaps = 6/311 (1%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M  + ++F  L + +   +  ++++A K+K   +       L GK +A++FEKPSTRTR 
Sbjct: 1   MNLFGRNFLTLKDYTREEIEYLLDLAVKLKVDKKRGITGNRLKGKNIALLFEKPSTRTRC 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           +F V  +  G    +L   ++QLG  E++ DTA+VL R  D I  R   HS + EL +YA
Sbjct: 61  AFVVGARDEGAFPEYLGKDDIQLGHKESVADTARVLGRMFDGIEFRGFKHSTVEELAKYA 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGD-GNNILHSLIEGAARFNYL 179
            VPV N LTD  HP QI+AD++T  E+ G ++G  F + GD  NN+ +SL+ G  +    
Sbjct: 121 GVPVWNGLTDEYHPTQILADLLTMREYFGKLEGLNFVYVGDGRNNMANSLMIGMTKLGVN 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGAS---VALFHDAVQAVKGAHCVFTDTWISMNQEFKAR 236
           + I  P    P +E +N  +             D + AV+GA  ++TD W SM +E KA+
Sbjct: 181 MTILAPKSLYPSDELVNLCKGYAKESGAKLNISDNLDAVEGADIIYTDVWASMGEEEKAK 240

Query: 237 EEHV-FQPFQVNLSLMSMA-HPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHT 294
           E     +P+QVN +LM        +FMHCLPA +G EV  +V +  +SVVFDEAENR+HT
Sbjct: 241 ERIELLKPYQVNKALMDKTGKESTIFMHCLPAVKGYEVTEDVFESDKSVVFDEAENRMHT 300

Query: 295 QKAILLWCFGI 305
            KA+++   G 
Sbjct: 301 IKAVMVATLGK 311


>gi|213970858|ref|ZP_03398981.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. tomato T1]
 gi|301384507|ref|ZP_07232925.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. tomato
           Max13]
 gi|302059901|ref|ZP_07251442.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. tomato
           K40]
 gi|302130500|ref|ZP_07256490.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|213924381|gb|EEB57953.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. tomato T1]
 gi|331015663|gb|EGH95719.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. lachrymans
           str. M302278PT]
          Length = 306

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 146/298 (48%), Positives = 194/298 (65%), Gaps = 4/298 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  + + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSMMDYTPDELLGLIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I D+AKV+SR +DA+++RT  H  L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSHRDTQLGRGEPIADSAKVISRMLDAVMIRTYAHDNLTEFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS+KGK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFLEHRGSIKGKTVAWIGDGNNMCNSYIEAAIQFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP  E+L  A   G  V +  D   AV GAH V TD W SM QE + AR + +F PF
Sbjct: 184 AGYEPNPEFLALA---GERVTVVRDPQAAVAGAHLVSTDVWTSMGQEEETARRKALFAPF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           QV  +L+ +A  D LFMHCLPAHRGEE+  ++LD  +SV +D+AENRLH QKA+L + 
Sbjct: 241 QVTRALLDLADKDVLFMHCLPAHRGEEISVDLLDDARSVAWDQAENRLHAQKALLEFL 298


>gi|297183468|gb|ADI19599.1| ornithine carbamoyltransferase [uncultured SAR11 cluster bacterium
           HF0770_37D02]
          Length = 304

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 135/304 (44%), Positives = 198/304 (65%), Gaps = 2/304 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            ++F +LS+I    L  II+ AK  K     I  + PL+GK L MIFEKPSTRTR+SFE+
Sbjct: 1   MRNFINLSDIDKQELRKIIDHAKSQKQKGSTIKTDVPLAGKTLIMIFEKPSTRTRLSFEL 60

Query: 65  AMKHLGGDTIF-LSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           AMK LGGD +             E+I DTAK+LS+Y D ++MRT  H   LE +++  +P
Sbjct: 61  AMKKLGGDVLVLNPKESHYGSGDESIHDTAKILSQYGDVVMMRTNKHEHFLEFSKHLEIP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           +IN LT+ +HP QI+A ++++EE RGS+  K  +W GDGNN+++SLIE A +F++ L IA
Sbjct: 121 IINGLTNLSHPVQIMATVLSYEELRGSIANKKIAWLGDGNNVVYSLIEAAVQFDFQLAIA 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQE-FKAREEHVFQ 242
            P   EP  + + WA+++ A++ +  +  +A K A  V TD WISM     K +++ + +
Sbjct: 181 CPKKLEPNKKIIKWAKDKKANILITKNPKEAAKDASAVITDKWISMGDSVNKKKKKKLLK 240

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           P+QVN  +M +A  DA+FMHCLPA R EEV + V+DG QS V+ EA NR+H QK+I+ +C
Sbjct: 241 PYQVNEKIMKLAKSDAIFMHCLPAKRNEEVTDSVMDGEQSAVWLEALNRMHVQKSIIQFC 300

Query: 303 FGII 306
             ++
Sbjct: 301 LNLL 304


>gi|260588918|ref|ZP_05854831.1| ornithine carbamoyltransferase [Blautia hansenii DSM 20583]
 gi|260540697|gb|EEX21266.1| ornithine carbamoyltransferase [Blautia hansenii DSM 20583]
          Length = 332

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 112/328 (34%), Positives = 171/328 (52%), Gaps = 24/328 (7%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M    +HF  L + +   +  +++++ ++K   +       L GK +A+IFEK STRTR 
Sbjct: 1   MDLKGRHFLTLKDFTKEEIEYLVDLSAELKRKKKQGIPVDTLKGKNVALIFEKTSTRTRS 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFEVA   LG  + +L     Q+G+ E+I DTA+VL R  D I  R     ++ EL +YA
Sbjct: 61  SFEVAAHDLGMGSTYLDPKSSQIGKKESIKDTARVLGRVYDGIEYRGFGQEKVEELAKYA 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNIL-HSLIEGAARFNYL 179
            VPV N LT+  HP Q++AD++T  EH G V+G    + GD    + +SL+   A+    
Sbjct: 121 GVPVWNGLTNEYHPTQMLADLLTIREHLGRVEGVKLVYMGDARYNMGNSLMILCAKMGMH 180

Query: 180 LNIATPIGSEPRN----EYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA 235
                P    P +    E   +A   G ++ L  + ++  KGA  ++TD W+SM +  + 
Sbjct: 181 FVACAPKKYFPNDALVEECKGFAEKSGGTITLTENVMEGTKGADVIYTDVWVSMGEPEEV 240

Query: 236 REEHVFQ--PFQVNLSLMSMAHPDALFMHCLPAHR-----------------GEEVINEV 276
            EE + +  P++V + +M  A   A+F+HCLPA                     EV +EV
Sbjct: 241 WEERIKELTPYKVTMDVMRNAGEQAIFLHCLPAFHDLQTDIGREMNEKFGIEDMEVTDEV 300

Query: 277 LDGPQSVVFDEAENRLHTQKAILLWCFG 304
            +  QSVVFDEAENR+HT KA++    G
Sbjct: 301 FESEQSVVFDEAENRMHTIKAVMAATLG 328


>gi|325967950|ref|YP_004244142.1| ornithine carbamoyltransferase [Vulcanisaeta moutnovskia 768-28]
 gi|323707153|gb|ADY00640.1| ornithine carbamoyltransferase [Vulcanisaeta moutnovskia 768-28]
          Length = 313

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 130/305 (42%), Positives = 185/305 (60%), Gaps = 5/305 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFE-NKPLSGKVLAMIFEKPSTRTRVSF 62
             + +  L + ++  +  ++ +++ +K+        N  L G+ L MIFEKPSTRTRVS 
Sbjct: 8   KGRDYITLMDYTTDEIKYLLNLSRDLKSRYYQGERYNDILRGRTLLMIFEKPSTRTRVSL 67

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           + A   LG   I+ +  E+QLGR ETI DTA+V+ R+VDAI  R   H  L+E+ +YA V
Sbjct: 68  DAAATQLGMHVIYSNPQELQLGRGETIADTARVVDRFVDAIAARVYKHESLIEMAKYAVV 127

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGD-GNNILHSLIEGAARFNYLLN 181
           PVINAL+D  HP Q +AD +T  E R  ++G   ++ GD  NNI HSL+   A+  + + 
Sbjct: 128 PVINALSDKEHPLQALADALTLWEVRSRLEGLRIAFVGDGDNNIAHSLMIIGAKLGWEVR 187

Query: 182 IATPIGSEP--RNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EE 238
           I +P    P    E L     +  +  +  D  + V+G   V+TD W+SM  E +A   +
Sbjct: 188 IISPRKYWPTKFAELLTEDTRRTGANIMISDNTEDVRGVDAVYTDVWVSMGMETEAEERK 247

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
            VF+ +QVN  LM  A P A+FMHCLPAHRGEEV ++V+DGPQSVV+D+AENRLHT KA+
Sbjct: 248 KVFRSYQVNAELMRKAGPQAVFMHCLPAHRGEEVTDDVIDGPQSVVWDQAENRLHTAKAV 307

Query: 299 LLWCF 303
           L+   
Sbjct: 308 LISLL 312


>gi|312795222|ref|YP_004028144.1| Ornithine carbamoyltransferase [Burkholderia rhizoxinica HKI 454]
 gi|312166997|emb|CBW74000.1| Ornithine carbamoyltransferase (EC 2.1.3.3) [Burkholderia
           rhizoxinica HKI 454]
          Length = 310

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 125/305 (40%), Positives = 176/305 (57%), Gaps = 3/305 (0%)

Query: 1   MMTYP--KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRT 58
           M +    +H+    + S+ +   ++E A+ +K   +N     PL  + LAMIFEK STRT
Sbjct: 1   MTSTKTIRHYLQFRDFSADDYDYVLERARILKQKFKNYETYHPLHDRTLAMIFEKNSTRT 60

Query: 59  RVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTE 118
           R+SFE  +  LGG  +F+S  + QLGR E I D A+V+SR VD I++RT     L    +
Sbjct: 61  RLSFEAGIFQLGGHAVFMSTRDTQLGRGEPIEDAAQVISRMVDIIMIRTFGQDILRRFAQ 120

Query: 119 YATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNY 178
            + VPVIN LT+  HPCQ++AD+ TF EHRG ++GK  +W GD NN+ ++ IE A    +
Sbjct: 121 NSRVPVINGLTNEYHPCQVLADVFTFHEHRGPIRGKTVAWVGDANNMAYTWIEAAHILGF 180

Query: 179 LLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE 238
            L ++TP G    +  ++ A            A             T +   QE  A  +
Sbjct: 181 KLRVSTPPGYRLDHASIDPAHLASVEETDDPRAACEGAHLVTTDVWTSMGFEQENDA-RK 239

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F  + V+  LM++A PDALFMHCLPAHRGEEV  +V+DG QSVV+DEAENRLH QKA+
Sbjct: 240 AAFADWCVDAELMALAQPDALFMHCLPAHRGEEVSADVIDGRQSVVWDEAENRLHVQKAL 299

Query: 299 LLWCF 303
           + +  
Sbjct: 300 MEFLM 304


>gi|206896477|ref|YP_002247399.1| ornithine carbamoyltransferase [Coprothermobacter proteolyticus DSM
           5265]
 gi|206739094|gb|ACI18172.1| ornithine carbamoyltransferase [Coprothermobacter proteolyticus DSM
           5265]
          Length = 312

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 144/306 (47%), Positives = 202/306 (66%), Gaps = 5/306 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             +    +++++      ++E AK +K  +     ++ L GK LAMIF+KPSTRTRV+FE
Sbjct: 6   KGRDLLSIADLTEEEFWELLEFAKLLKLETLAGKRHEYLKGKTLAMIFQKPSTRTRVAFE 65

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M  LGG  ++LS ++MQL R ETI DTA+VLSR+VD I+ R  +H  +++L +Y +VP
Sbjct: 66  VGMYQLGGYALYLSSNDMQLRRGETIADTARVLSRFVDGIMARVFDHQDVVDLAKYGSVP 125

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN L+D  HP Q++AD +T  E  G++KG   ++ GDGNN+ HSL+  A      + +A
Sbjct: 126 VINGLSDEEHPSQVLADFLTIWEKFGTLKGLKLAYVGDGNNVAHSLLLAAGLVGMDIAVA 185

Query: 184 TPIGSEPRNEYLNWAR----NQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE- 238
           TP G EP++ Y+  A+      G+SV +  D V+AV GA+ V+TD W SM QE +  E  
Sbjct: 186 TPQGYEPKSFYVEKAKELAARHGSSVQVLRDPVEAVTGANAVYTDVWASMGQEAEHEERL 245

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
            +F+P+QVN  LMS A  +A+F+HCLPAHRGEEV++EV D PQS +FDEAENRLH  KAI
Sbjct: 246 KIFKPYQVNPELMSHADKNAIFLHCLPAHRGEEVVDEVADSPQSAIFDEAENRLHAHKAI 305

Query: 299 LLWCFG 304
           L    G
Sbjct: 306 LALLMG 311


>gi|172056612|ref|YP_001813072.1| ornithine carbamoyltransferase [Exiguobacterium sibiricum 255-15]
 gi|171989133|gb|ACB60055.1| ornithine carbamoyltransferase [Exiguobacterium sibiricum 255-15]
          Length = 312

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 135/313 (43%), Positives = 202/313 (64%), Gaps = 9/313 (2%)

Query: 1   MMTYPK--HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRT 58
           M T  +  H   L  +++  L+ ++E+AK +K S       + L+GK +A++FEK STRT
Sbjct: 1   MTTTQRLKHLLTLEELTAEGLTDLLELAKDVKASPATYA--QTLAGKKVALLFEKASTRT 58

Query: 59  RVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTE 118
           R+SFEV +  LGG  + L+GS+MQ+GR E++ DT +V+SRYVDA+++RT  H  +  L  
Sbjct: 59  RISFEVGVVELGGYPVVLNGSDMQIGRGESLSDTIQVMSRYVDALMIRTFAHETVETLAA 118

Query: 119 YATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNY 178
           + T+P+IN LTD  HPCQ++AD++T EEH G  KGK+ ++ GDGNN+ HSL+ G A    
Sbjct: 119 HGTIPIINGLTDLHHPCQVLADLLTIEEHFGQRKGKILAYIGDGNNMTHSLLLGGALSGM 178

Query: 179 LLNIATPIGSEPRNEYLNWARNQGAS----VALFHDAVQAVKGAHCVFTDTWISMNQEFK 234
            + I +P    P    ++ A+         +  + D VQAV GA  +++D + SM QE +
Sbjct: 179 TVRICSPAAYAPDQTIIDQAKMLAQQSGGQIEQYTDPVQAVAGADVIYSDVFASMGQEEE 238

Query: 235 AR-EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLH 293
           +      F+ +QVN +L+S A  D +F+HCLPAHRGEEV  EV+DG  S+VFD+AENRLH
Sbjct: 239 SEARLKAFEGYQVNQTLLSSAATDVIFLHCLPAHRGEEVTAEVIDGSHSLVFDQAENRLH 298

Query: 294 TQKAILLWCFGII 306
            QKA+++   G++
Sbjct: 299 AQKALMIELIGVM 311


>gi|330877352|gb|EGH11501.1| ornithine carbamoyltransferase [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330966680|gb|EGH66940.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. actinidiae
           str. M302091]
          Length = 306

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 147/298 (49%), Positives = 195/298 (65%), Gaps = 4/298 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  + + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSMMDYTPDELLGLIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I D+AKV+SR +DA+++RT  HS L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSHRDTQLGRGEPIADSAKVISRMLDAVMIRTYAHSNLTEFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS+KGK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFLEHRGSIKGKTVAWIGDGNNMCNSYIEAAIQFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP  E+L  A   G  V +  D   AV GAH V TD W SM QE + AR + +F PF
Sbjct: 184 AGYEPNPEFLALA---GERVTVVRDPKAAVAGAHLVSTDVWTSMGQEEETARRKALFAPF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           QV  +L+ +A  D LFMHCLPAHRGEE+  ++LD  +SV +D+AENRLH QKA+L + 
Sbjct: 241 QVTRALLDLADKDVLFMHCLPAHRGEEISVDLLDDARSVAWDQAENRLHAQKALLEFL 298


>gi|118602466|ref|YP_903681.1| ornithine carbamoyltransferase [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
 gi|166973837|sp|A1AWA3|OTC_RUTMC RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|118567405|gb|ABL02210.1| ornithine carbamoyltransferase [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
          Length = 299

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 133/300 (44%), Positives = 188/300 (62%), Gaps = 2/300 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             KHF +L ++ + +L+ II+ A  +K   ++   NK L  K LAMIF+K STRTRVSFE
Sbjct: 1   MIKHFINLDDLPNHDLTQIIKQAIALKKQYKSGKINKILEHKTLAMIFDKSSTRTRVSFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
             M  LGG  +FLS  ++QLGR E I D+A V+S  VD I+MR ++H  +    E ++VP
Sbjct: 61  AGMTQLGGHALFLSDKDIQLGRGEPIIDSAIVISSMVDVIMMRISSHKDIHTFAENSSVP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           +INAL+D +HPCQ+++D+MT++EH GS+  K  +W GDGNN+ H+ ++ A  FN+ LNIA
Sbjct: 121 IINALSDESHPCQLLSDMMTYQEHNGSIANKTIAWIGDGNNMCHTYMQAAKSFNFKLNIA 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQP 243
           TP   +P  +++    N          A Q V         +     +  + + +  F+ 
Sbjct: 181 TPKNYQPDQDFIEKYANHIHLFTDAQKACQKVDLVVTDVWASM--GQEAEQTKRKITFKD 238

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           F VN +LMS A P A+FMHCLPAHRGEEV   V+DG QS+V+ EAENRLH QKA+LL+  
Sbjct: 239 FSVNAALMSKAKPSAVFMHCLPAHRGEEVSTNVIDGSQSLVWLEAENRLHVQKALLLYLL 298


>gi|86607419|ref|YP_476182.1| ornithine carbamoyltransferase [Synechococcus sp. JA-3-3Ab]
 gi|86555961|gb|ABD00919.1| ornithine carbamoyltransferase [Synechococcus sp. JA-3-3Ab]
          Length = 314

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 133/302 (44%), Positives = 187/302 (61%), Gaps = 7/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +    LS++S + L+ ++  A ++K     +     L G+VL ++F+K STRTRVSF  A
Sbjct: 15  RDLLKLSDLSPAELAALLVQAAQLKRDPYRVD----LRGRVLGLLFQKASTRTRVSFTAA 70

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M   GG T+ L  + MQ+ R E + DTA+VLSRY+DAI +RT N   L    EYA +PVI
Sbjct: 71  MAQCGGSTLDLVPTAMQMSRGEPLQDTARVLSRYLDAIAIRTYNQRELEIFAEYAEIPVI 130

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD  HPCQ++AD++T +E+ G + G   ++ GDGNN+ HSL+ G A     + +ATP
Sbjct: 131 NALTDQFHPCQVLADLLTIQENFGQLAGLTLAYCGDGNNVAHSLLLGCAMSGIHIRVATP 190

Query: 186 IGSEPRNEYLNWARNQGASVALF--HDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQ 242
            G EP    +  A+       ++   D  +AV GA  V+TD W SM QE +A   +  F 
Sbjct: 191 PGYEPDAAVVAEAQALAQGSQVWVLRDPYEAVAGAQVVYTDVWASMGQEDQAEARKADFL 250

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           P+QVN  L+  A  +A+ +HCLPAHR EE+  EVL+G QS V+D+AENRLH QKA+L+  
Sbjct: 251 PYQVNAKLLKQAAREAIVLHCLPAHREEEITAEVLEGSQSRVWDQAENRLHVQKALLIQL 310

Query: 303 FG 304
            G
Sbjct: 311 LG 312


>gi|299769696|ref|YP_003731722.1| ornithine carbamoyltransferase [Acinetobacter sp. DR1]
 gi|298699784|gb|ADI90349.1| ornithine carbamoyltransferase [Acinetobacter sp. DR1]
          Length = 305

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 132/298 (44%), Positives = 180/298 (60%), Gaps = 2/298 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++S+  L+ I+E A ++K    +    +P  GKVL MIFEK STRTR+SFE  
Sbjct: 4   RHFLTLRDLSTLELNRILERASELKKMQHDNKVYQPFVGKVLGMIFEKSSTRTRISFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +   GG  IFLS  + QLGR E I D+A+V+S  +D +++RT  H  +     Y+ VPVI
Sbjct: 64  INQFGGSAIFLSPRDTQLGRGEPIEDSARVISSMLDIVMIRTFGHDIVERFASYSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LTD+ HPCQ++AD+ T+ EHRGS+KGK  +W GDGNN+ +S IE A    + L IA+P
Sbjct: 124 NGLTDDHHPCQLLADLQTYNEHRGSIKGKTVAWIGDGNNMCNSYIEAAHMMGFKLKIASP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G EP+ E+L    +         DA             +     +E +   E  F  FQ
Sbjct: 184 KGYEPKPEFLAEFGHCVEVFDNAEDAAVNADLIVTDVWASM--GQEEEQKLRERAFAAFQ 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           VN  LM +AHP+ LFMHCLPAHRGEE+   +LD   +VV+DEAENRLH QKA++ +  
Sbjct: 242 VNEKLMGLAHPECLFMHCLPAHRGEEISETMLDHKNAVVWDEAENRLHAQKALVEFLL 299


>gi|28871306|ref|NP_793925.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|32699437|sp|Q87XL4|OTC_PSESM RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|28854557|gb|AAO57620.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. tomato
           str. DC3000]
          Length = 306

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 146/298 (48%), Positives = 194/298 (65%), Gaps = 4/298 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  + + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSMMDYTPDELLGLIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I D+AKV+SR +DA+++RT  H  L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSHRDTQLGRGEPIADSAKVISRMLDAVMIRTYAHDNLTEFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS+KGK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFLEHRGSIKGKTVAWIGDGNNMCNSYIEAAIQFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP  E+L  A   G  V +  D   AV GAH V TD W SM QE + AR + +F PF
Sbjct: 184 AGYEPNPEFLALA---GERVTVVRDPKAAVAGAHLVSTDVWTSMGQEEETARRKALFAPF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           QV  +L+ +A  D LFMHCLPAHRGEE+  ++LD  +SV +D+AENRLH QKA+L + 
Sbjct: 241 QVTRALLDLADKDVLFMHCLPAHRGEEISVDLLDDARSVAWDQAENRLHAQKALLEFL 298


>gi|330973087|gb|EGH73153.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 306

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 147/298 (49%), Positives = 195/298 (65%), Gaps = 4/298 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  + + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSMMDYTPDELLGLIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I D+AKV+SR +DA+++RT  HS L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSHRDTQLGRGEPIADSAKVMSRMLDAVMIRTYAHSNLTEFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS+KGK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFLEHRGSIKGKTVAWVGDGNNMCNSYIEAAIQFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP  E+L  A   G  V +  D   AV GAH V TD W SM QE + AR + +F PF
Sbjct: 184 AGYEPNAEFLALA---GERVTVVRDPKAAVAGAHLVSTDVWTSMGQEEETARRKKLFAPF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           QV  +L+ +A  D LFMHCLPAHRGEE+  ++LD  +SV +D+AENRLH QKA+L + 
Sbjct: 241 QVTRALLDLADKDVLFMHCLPAHRGEEISVDLLDDSRSVAWDQAENRLHAQKALLEFL 298


>gi|152986546|ref|YP_001346993.1| ornithine carbamoyltransferase [Pseudomonas aeruginosa PA7]
 gi|150961704|gb|ABR83729.1| ornithine carbamoyltransferase [Pseudomonas aeruginosa PA7]
          Length = 305

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 144/298 (48%), Positives = 196/298 (65%), Gaps = 4/298 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF    + S   L  +I    ++K+        +PL  +VL M+FEK STRTR+SFE  
Sbjct: 4   RHFLSFMDYSPEELIGLIRRGSELKDLRNRGVLYEPLKSRVLGMVFEKASTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E IGD+A+V+SR +D +++RT  HS L E   ++ VPVI
Sbjct: 64  MIQLGGQAIFLSPRDTQLGRGEPIGDSARVMSRMLDGVMIRTFAHSTLTEFAAHSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS++GK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFHEHRGSIQGKTVAWIGDGNNMCNSYIEAALKFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP+ E++  A   G  + +  D  +AV GAH V TD W SM QE + A    +F+P+
Sbjct: 184 EGYEPKAEFVALA---GERLRIVRDPREAVAGAHLVSTDVWASMGQEDEAAARIALFRPY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           QVN +L+  A  D LFMHCLPAHRGEE+  E+LD P+SV +D+AENRLH QKA+L   
Sbjct: 241 QVNAALLDGAADDVLFMHCLPAHRGEEISEELLDDPRSVAWDQAENRLHAQKALLELL 298


>gi|15598733|ref|NP_252227.1| ornithine carbamoyltransferase [Pseudomonas aeruginosa PAO1]
 gi|116051536|ref|YP_789628.1| ornithine carbamoyltransferase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218890236|ref|YP_002439100.1| ornithine carbamoyltransferase [Pseudomonas aeruginosa LESB58]
 gi|254236461|ref|ZP_04929784.1| ornithine carbamoyltransferase, anabolic [Pseudomonas aeruginosa
           C3719]
 gi|254242240|ref|ZP_04935562.1| ornithine carbamoyltransferase, anabolic [Pseudomonas aeruginosa
           2192]
 gi|296387960|ref|ZP_06877435.1| ornithine carbamoyltransferase [Pseudomonas aeruginosa PAb1]
 gi|313108882|ref|ZP_07794865.1| ornithine carbamoyltransferase, anabolic [Pseudomonas aeruginosa
           39016]
 gi|12230948|sp|P11724|OTC_PSEAE RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|9949687|gb|AAG06925.1|AE004774_3 ornithine carbamoyltransferase, anabolic [Pseudomonas aeruginosa
           PAO1]
 gi|115586757|gb|ABJ12772.1| ornithine carbamoyltransferase, anabolic [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126168392|gb|EAZ53903.1| ornithine carbamoyltransferase, anabolic [Pseudomonas aeruginosa
           C3719]
 gi|126195618|gb|EAZ59681.1| ornithine carbamoyltransferase, anabolic [Pseudomonas aeruginosa
           2192]
 gi|218770459|emb|CAW26224.1| ornithine carbamoyltransferase, anabolic [Pseudomonas aeruginosa
           LESB58]
 gi|310881367|gb|EFQ39961.1| ornithine carbamoyltransferase, anabolic [Pseudomonas aeruginosa
           39016]
          Length = 305

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 143/298 (47%), Positives = 196/298 (65%), Gaps = 4/298 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF    + S   L  +I    ++K+        +PL  +VL M+FEK STRTR+SFE  
Sbjct: 4   RHFLSFMDYSPEELIGLIRRGSELKDLRNRGVLYEPLKSRVLGMVFEKASTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E IGD+A+V+SR +D +++RT  H+ L E   ++ VPVI
Sbjct: 64  MIQLGGQAIFLSPRDTQLGRGEPIGDSARVMSRMLDGVMIRTFAHATLTEFAAHSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS++GK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFHEHRGSIQGKTVAWIGDGNNMCNSYIEAALKFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP+ E++  A   G  + +  D  +AV GAH V TD W SM QE + A    +F+P+
Sbjct: 184 EGYEPKAEFVALA---GDRLRVVRDPREAVAGAHLVSTDVWASMGQEDEAAARIALFRPY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           QVN +L+  A  D LFMHCLPAHRGEE+  E+LD P+SV +D+AENRLH QKA+L   
Sbjct: 241 QVNAALLDGAADDVLFMHCLPAHRGEEISEELLDDPRSVAWDQAENRLHAQKALLELL 298


>gi|66047128|ref|YP_236969.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. syringae
           B728a]
 gi|63257835|gb|AAY38931.1| Ornithine carbamoyltransferase [Pseudomonas syringae pv. syringae
           B728a]
          Length = 306

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 147/298 (49%), Positives = 195/298 (65%), Gaps = 4/298 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  + + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSMMDYTPDELLGLIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I D+AKV+SR +DA+++RT  HS L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSHRDTQLGRGEPIADSAKVMSRMLDAVMIRTYAHSNLTEFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS+KGK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFLEHRGSIKGKTVAWIGDGNNMCNSYIEAAIQFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP  E+L  A   G  V +  D   AV GAH V TD W SM QE + AR + +F PF
Sbjct: 184 AGYEPNAEFLALA---GERVTVVRDPKAAVAGAHLVSTDVWTSMGQEEETARRKKLFAPF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           QV  +L+ +A  D LFMHCLPAHRGEE+  ++LD  +SV +D+AENRLH QKA+L + 
Sbjct: 241 QVTRALLDLADKDVLFMHCLPAHRGEEISVDLLDDSRSVAWDQAENRLHAQKALLEFL 298


>gi|172038164|ref|YP_001804665.1| ornithine carbamoyltransferase [Cyanothece sp. ATCC 51142]
 gi|171699618|gb|ACB52599.1| ornithine carbamoyltransferase [Cyanothece sp. ATCC 51142]
          Length = 311

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 124/311 (39%), Positives = 189/311 (60%), Gaps = 11/311 (3%)

Query: 1   MMTY--PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRT 58
           +MT    +    + ++S+  ++ ++++   +K+   +         K+L ++F+K STRT
Sbjct: 6   IMTTLQGRDILGIGDLSAEEMTQVLDLGAALKSGQRSPRCQ-----KILGLLFDKASTRT 60

Query: 59  RVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTE 118
           RVSF  A+  LGG  + L+ S  Q+GR E   DTA+VL RY+D + +RT   S+L    E
Sbjct: 61  RVSFSAAIYQLGGQVLDLNPSVTQVGRGEPTKDTARVLDRYLDILAIRTFEQSKLETFAE 120

Query: 119 YATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNY 178
           YAT+P+INALTD  HPCQI+AD MT +E  G + G   ++ GDGNN+ HSLI G A    
Sbjct: 121 YATIPIINALTDLEHPCQILADFMTIKECFGELAGSTVTYLGDGNNVAHSLILGGALMGM 180

Query: 179 LLNIATPIGSEPRNEYLNWARN---QGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-K 234
            + +ATP   +P    +  A+     G  + +  D + AVK ++ ++TD W SM QE   
Sbjct: 181 KIRVATPKDYQPLPMIIEQAKQLAKPGFEIMITDDPMAAVKDSNVLYTDVWASMGQEDLA 240

Query: 235 AREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHT 294
           A    +FQP+Q+N  L+  A  +A+ +HCLPAHRGEE+ + V++G QS V+D+AENR+H 
Sbjct: 241 ASRIPIFQPYQINDELLQKADKNAIVLHCLPAHRGEEITDSVIEGNQSKVWDQAENRMHA 300

Query: 295 QKAILLWCFGI 305
           QKA+++   GI
Sbjct: 301 QKALMVSLLGI 311


>gi|26987815|ref|NP_743240.1| ornithine carbamoyltransferase [Pseudomonas putida KT2440]
 gi|32699438|sp|Q88NX4|OTC_PSEPK RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|24982513|gb|AAN66704.1|AE016298_8 ornithine carbamoyltransferase [Pseudomonas putida KT2440]
          Length = 306

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 146/302 (48%), Positives = 195/302 (64%), Gaps = 5/302 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M+  +HF  L + ++  L  +I    ++K+  +     +PL  +VL MIFEK STRTRVS
Sbjct: 1   MSA-RHFLSLLDFTTDELLGVIRHGIELKDLRKRGVLFEPLKNRVLGMIFEKSSTRTRVS 59

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  IFLS  + QLGR E IGD+A VLS  VD +++RT  HS L E    + 
Sbjct: 60  FEAGMIQLGGQAIFLSPRDTQLGRGEPIGDSAIVLSSMVDVVMIRTHAHSTLTEFAAKSR 119

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN L+D +HPCQ++AD+ TF EHRGS++GK  +W GDG N+ +S IE A +F++ L 
Sbjct: 120 VPVINGLSDESHPCQLLADMQTFVEHRGSIQGKTVTWIGDGFNMCNSYIEAARQFDFQLR 179

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHV 240
           IA P G EP   ++    ++   +    DA +AV+ AH V TD W SM QE + AR    
Sbjct: 180 IACPEGYEPDQRFMALGGDRVQIIR---DAREAVRDAHLVVTDVWTSMGQEEETARRLAH 236

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F P+QV   L+ +A PD LFMHCLPAHRGEE+  ++LD P+SV +DEAENRLH QKA+L 
Sbjct: 237 FAPYQVTRELLDLAAPDVLFMHCLPAHRGEEISQDLLDDPRSVAWDEAENRLHAQKALLE 296

Query: 301 WC 302
           + 
Sbjct: 297 FL 298


>gi|311067615|ref|YP_003972538.1| ornithine carbamoyltransferase [Bacillus atrophaeus 1942]
 gi|310868132|gb|ADP31607.1| ornithine carbamoyltransferase [Bacillus atrophaeus 1942]
          Length = 317

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 147/305 (48%), Positives = 199/305 (65%), Gaps = 9/305 (2%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
           Y K    L ++S +++S ++  A  +K +           GK LAMIFEK STRTRVSFE
Sbjct: 14  YGKDLLTLKDLSEADISALLTEAADLKQNK----IQPIFQGKTLAMIFEKSSTRTRVSFE 69

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
             M  LGG+ +FLS  ++QLGR ET+ DTAKVLS YVDAI++RT  H ++ EL E+A +P
Sbjct: 70  AGMAQLGGNALFLSQKDLQLGRGETVADTAKVLSGYVDAIMIRTFEHEKVEELAEHADIP 129

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQ +AD++T +E +G +KG   ++ GDGNN+ HSL+ G A+    ++IA
Sbjct: 130 VINGLTDKYHPCQALADLLTIKEVKGKLKGVKVAYIGDGNNVAHSLMVGCAKMGCDVSIA 189

Query: 184 TPIGSEPRNEYLN----WARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE- 238
           +P G E  +E +N    +A   G+S+ L  D  +AVKGA  +++D + SM QE +  E  
Sbjct: 190 SPKGYEVLDEAVNAAKEYAGVSGSSITLTADPGEAVKGADVIYSDVFTSMGQEAETNERL 249

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
            VF P+QVN SL+  A PD  F+HCLPAHR EEV  E++DGP S VF +AENRLH QKA+
Sbjct: 250 TVFTPYQVNASLVKHAKPDYTFLHCLPAHREEEVTAEIIDGPNSAVFQQAENRLHVQKAL 309

Query: 299 LLWCF 303
           L    
Sbjct: 310 LKAIL 314


>gi|238917598|ref|YP_002931115.1| ornithine carbamoyltransferase [Eubacterium eligens ATCC 27750]
 gi|238872958|gb|ACR72668.1| ornithine carbamoyltransferase [Eubacterium eligens ATCC 27750]
          Length = 331

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 115/328 (35%), Positives = 168/328 (51%), Gaps = 24/328 (7%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M    + F  L + +   +  +I++A ++K+  +     +PL GK +A+IFEK STRTR 
Sbjct: 1   MDLKGRDFLTLKDYTPEEILYLIDLAAELKDKKKKGIVEQPLIGKNVALIFEKTSTRTRC 60

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFEVA   LG    +L  +  Q+G+ E+I DTA+VL    + I  R      + +L +Y+
Sbjct: 61  SFEVAAHDLGMGVTYLDPTGSQIGKKESIADTARVLCTMFEGIEYRGFGQEIVEDLAKYS 120

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNIL-HSLIEGAARFNYL 179
           +VPV N LT+  HP Q++AD++T +E  G +KG  F + GD    + +SL+   A+    
Sbjct: 121 SVPVWNGLTNEYHPTQMLADMLTIKEKLGRLKGVKFVYMGDARYNMGNSLMIVCAKLGLH 180

Query: 180 LNIATPIGSEPRNE----YLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA 235
               T     P  E       WA+  G SV L  D     K A  ++TD W+SM +  + 
Sbjct: 181 YTACTAKEYFPDKELVAQCEEWAKISGGSVTLTEDVKAGTKDADVLYTDVWVSMGEPDEV 240

Query: 236 R--EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRG-----------------EEVINEV 276
                    P+QVN ++M  A  DA+FMHCLPA                     EV +EV
Sbjct: 241 WAERIKALLPYQVNKAVMDNASKDAIFMHCLPAFHDLKTKIGKEIHDKFGLDEMEVTDEV 300

Query: 277 LDGPQSVVFDEAENRLHTQKAILLWCFG 304
            +  QSVVFDEAENR+HT KA++    G
Sbjct: 301 FESEQSVVFDEAENRMHTIKAVMAATLG 328


>gi|227505059|ref|ZP_03935108.1| ornithine carbamoyltransferase [Corynebacterium striatum ATCC 6940]
 gi|227198347|gb|EEI78395.1| ornithine carbamoyltransferase [Corynebacterium striatum ATCC 6940]
          Length = 306

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 137/301 (45%), Positives = 196/301 (65%), Gaps = 8/301 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRVSFEV 64
           +HF    ++S +  + ++++A K+K      F  +PL G K +A++F+K STRTR SFE 
Sbjct: 4   RHFLADDDLSPAEQAEVLDLALKLKAEP---FSERPLEGPKSVAVLFDKTSTRTRFSFEA 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            + HLGG  I       Q+G+ ET  DTA VLSR+V+AIV RT +H   LE+ E ATVP+
Sbjct: 61  GIAHLGGHAIVTETKSTQMGKGETYQDTAAVLSRFVEAIVWRTYDHQNFLEMAETATVPI 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGD-GNNILHSLIEGAARFNYLLNIA 183
           +NAL+D+ HPCQI+AD++T  E+ G +KG+   + GD  NN+ +S + G A     + I 
Sbjct: 121 VNALSDDLHPCQILADLLTCRENFGDLKGRKAVYLGDGNNNMANSYMLGFATAGMEVGII 180

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREEHVFQ 242
            P G +P+ E+++ AR +G+      D+++AV+GA  V TDTW+SM  +         F 
Sbjct: 181 APEGFQPQQEFVDRARQRGSITVT--DSLEAVRGADVVITDTWVSMGQEADGLDRRTPFI 238

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           P+QVN  +M+MA  DA+F+HCLPA+RG EV  EV+DGPQS VFDEAENRLH QKA+L+W 
Sbjct: 239 PYQVNADVMAMAKDDAIFLHCLPAYRGSEVSAEVIDGPQSRVFDEAENRLHAQKALLVWL 298

Query: 303 F 303
            
Sbjct: 299 L 299


>gi|171322453|ref|ZP_02911259.1| ornithine carbamoyltransferase [Burkholderia ambifaria MEX-5]
 gi|171092220|gb|EDT37607.1| ornithine carbamoyltransferase [Burkholderia ambifaria MEX-5]
          Length = 309

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 121/304 (39%), Positives = 172/304 (56%), Gaps = 3/304 (0%)

Query: 2   MTYP--KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    +H+    + S  +   ++E    +K   +N     PL  + LAMIFEK STRTR
Sbjct: 1   MTAKTIRHYLQFKDFSLEDYEYVLERTGILKRKFKNYETYHPLHDRTLAMIFEKSSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFE  +  LGG  +F+S  + QLGR E + D+A+V+SR VD I++RT     +    + 
Sbjct: 61  LSFEAGIFQLGGHAVFMSTRDTQLGRGEPVEDSAQVISRMVDIIMIRTFEQDVITRFAQN 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           + VPVIN LT++ HPCQ++ADI T+ EHRG + GK  +W GD NN+L++ IE A    + 
Sbjct: 121 SRVPVINGLTNDYHPCQVLADIFTYYEHRGPIAGKTVAWVGDANNMLYTWIEAAQILGFK 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L ++TP G     + ++        V    +              T +    E +A    
Sbjct: 181 LRLSTPPGYALDMKLVSPDSAPFYDVFDDPNEACKGADLVTTDVWTSMGFEAENEA-RMQ 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F  + V+  +M  A+ DALFMHCLPAHRGEEV   V+DGPQSVV+DEAENRLH QKA++
Sbjct: 240 AFADWCVDEEMMGHANADALFMHCLPAHRGEEVTAGVIDGPQSVVWDEAENRLHVQKALM 299

Query: 300 LWCF 303
            +  
Sbjct: 300 EFLL 303


>gi|119504230|ref|ZP_01626310.1| ornithine carbamoyltransferase [marine gamma proteobacterium
           HTCC2080]
 gi|119459738|gb|EAW40833.1| ornithine carbamoyltransferase [marine gamma proteobacterium
           HTCC2080]
          Length = 301

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 133/303 (43%), Positives = 195/303 (64%), Gaps = 4/303 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M+ PKHF  L +++S  L  II  A ++K        +    GKVLAM+F K STRTRVS
Sbjct: 1   MSSPKHFLTLRDLTSDELRGIISRANELKTQQREGIPHAGYPGKVLAMLFSKASTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FEV M+ LGG  +FLS ++ QLGR E + DTA+VLS  VD +++RT +H+ +    + A+
Sbjct: 61  FEVGMRQLGGSALFLSSADTQLGRGEPVEDTARVLSSMVDLVMIRTHDHNSVERFADVAS 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN LTD+ HPCQ++AD+ T+ EHRG ++G+   W GDGNN+ HS I  A   ++ L 
Sbjct: 121 VPVINGLTDDYHPCQLLADMQTWFEHRGDIQGRRVCWLGDGNNMCHSYINAARLLDFELV 180

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHV 240
           +A P G +P ++ ++   ++     + HD  +AV+ A  + TD W SM QE + +     
Sbjct: 181 VACPDGYQPASQLVSENSDRVH---IVHDPREAVQNADLLVTDVWASMGQEDEQQARSAA 237

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
             P+Q+N  L+ +A P+AL+MHCLPAHR EE+  E++  P +V++DEAENRLH QKA++ 
Sbjct: 238 MAPYQLNRKLLELAAPEALYMHCLPAHRDEEISAELMAAPDTVIWDEAENRLHAQKALIE 297

Query: 301 WCF 303
           +  
Sbjct: 298 FLL 300


>gi|291483599|dbj|BAI84674.1| ornithine carbamoyltransferase [Bacillus subtilis subsp. natto
           BEST195]
          Length = 319

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 141/305 (46%), Positives = 195/305 (63%), Gaps = 9/305 (2%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
           Y K    L ++S  +++ ++  A ++K +           GK LAMIFEK STRTRVSFE
Sbjct: 10  YGKDLLTLKDLSEEDINALLAEAGELKQNK----IQPIFHGKTLAMIFEKSSTRTRVSFE 65

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
             M  LGG+ +FLS  ++QLGR ET+ DTAKVLS YVDAI++RT  H ++ EL + A +P
Sbjct: 66  AGMAQLGGNALFLSQKDLQLGRGETVADTAKVLSGYVDAIMIRTFEHEKVEELAKEADIP 125

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQ +AD++T +E +G +KG   S+ GDGNN+ HSL+ G A+    ++IA
Sbjct: 126 VINGLTDKYHPCQALADLLTIKEIKGKLKGVKVSYIGDGNNVAHSLMIGCAKMGCDISIA 185

Query: 184 TPIGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREE 238
           +P G E  +E       +A   G+S+ L  D ++AVK A  +++D + SM  +  +    
Sbjct: 186 SPKGYEVLDEAAEAAKTYALQSGSSITLTDDPIEAVKDADVIYSDVFTSMGQEAEEQERL 245

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
            VF P+QVN +L+S A PD  F+HCLPAHR EEV  E++DGP S VF +AENRLH QKA+
Sbjct: 246 AVFAPYQVNAALVSHAKPDYTFLHCLPAHREEEVTAEIIDGPNSAVFQQAENRLHVQKAL 305

Query: 299 LLWCF 303
           L    
Sbjct: 306 LKAIL 310


>gi|296109021|ref|YP_003615970.1| ornithine carbamoyltransferase [Methanocaldococcus infernus ME]
 gi|295433835|gb|ADG13006.1| ornithine carbamoyltransferase [Methanocaldococcus infernus ME]
          Length = 301

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 126/301 (41%), Positives = 191/301 (63%), Gaps = 8/301 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAM 66
           H  D+ ++S   +  II+ A   K   +   +   L  K  A+IFEKPSTRTR+SF++A+
Sbjct: 2   HILDIDDLSREEILKIIDKAFYFKEHRKEHEK--FLKDKSFALIFEKPSTRTRISFDLAI 59

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
              GG +I ++ +E+ LG+ E+I DTA+V+SRYVD I+ R   HS L E+ +Y+ VPVIN
Sbjct: 60  YESGGHSIIMNQNEIHLGKKESIKDTARVISRYVDGIIARVNRHSDLEEMAKYSDVPVIN 119

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI 186
           AL++ +HPCQI+AD+MT +EH+ S +    ++ GDGNN+ +SLI G +     + +ATP 
Sbjct: 120 ALSNLSHPCQILADLMTIKEHKKSFE-VKVAYLGDGNNVCNSLILGCSILGIDIYVATPK 178

Query: 187 GSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EHVF 241
           G EP +  +     +A    + V + +D  +  K A  ++TD W+SM  +    E + +F
Sbjct: 179 GYEPNSGIVLKAKKFAEENDSVVLITNDPKEVAKDADVIYTDVWLSMGDKKDLEEIKKIF 238

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
            P+QVN  L+ +A  D + MHCLPA RG E+ ++V+DG +SVV+D+AENRLH QKA+L  
Sbjct: 239 PPYQVNSKLLELAKEDVIVMHCLPASRGMEITDDVIDGDRSVVYDQAENRLHAQKALLYH 298

Query: 302 C 302
            
Sbjct: 299 I 299


>gi|302528035|ref|ZP_07280377.1| ornithine carbamoyltransferase [Streptomyces sp. AA4]
 gi|302436930|gb|EFL08746.1| ornithine carbamoyltransferase [Streptomyces sp. AA4]
          Length = 308

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 131/307 (42%), Positives = 191/307 (62%), Gaps = 9/307 (2%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
            P+HF    +++ +  + ++++A ++K         K L+G+ +A IFEK STRTR SFE
Sbjct: 1   MPRHFLRDDDVTPAEQAALLDLADQLKADPLG---TKALTGRTVAAIFEKNSTRTRFSFE 57

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V +  LGG  + + G  MQLGR ETI DT++VLSRYVDA+V RT    R+  +   A++P
Sbjct: 58  VGISQLGGHPVIVDGRSMQLGREETIEDTSRVLSRYVDAVVWRTFAQKRIDSMASVASIP 117

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLNI 182
           +INALTD  HPCQ++ D+MT  E +G + G   ++ GDG NN+ HSL+ G       + +
Sbjct: 118 IINALTDEFHPCQVLTDLMTIRERKGKLAGLTLTYLGDGANNMAHSLLLGGTTAGMNVRV 177

Query: 183 ATPIGSEPRNEYLNWARNQGASV----ALFHDAVQAVKGAHCVFTDTWISMNQEFKA-RE 237
            +P G +P  + +  A+ +G        ++ DA +AV+G+  + TDTW SM QE      
Sbjct: 178 VSPEGFQPDQQVMLDAKQRGTETGGSATVYTDAHEAVEGSDVLVTDTWTSMGQENDGLDR 237

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
              F+  Q+N  L+  A  +A+ +HCLPAHRG E+ +EVLDGP S V+DEAENRLH QKA
Sbjct: 238 VGPFRALQINAGLLKRAADEAIVLHCLPAHRGWEITDEVLDGPASAVWDEAENRLHAQKA 297

Query: 298 ILLWCFG 304
           +L+W FG
Sbjct: 298 LLVWLFG 304


>gi|25019677|gb|AAL03924.2|U30252_12 OtcA [Synechococcus elongatus PCC 7942]
          Length = 305

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 129/305 (42%), Positives = 187/305 (61%), Gaps = 9/305 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +    L+++SS+ +  I+E+A  +K+    +        K L +IF K STRTRVSF  A
Sbjct: 6   RDLLTLADLSSAEVLEILELAATLKSGQTTVHCP-----KTLGLIFSKSSTRTRVSFSAA 60

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  +GG  + L+ +  Q+GR E I DTA+VLSRY+DA+ +RT     L E   YA +PVI
Sbjct: 61  IMQMGGQVLDLNPNVTQVGRGEPIADTARVLSRYLDALAIRTFAQQDLEEYAHYADIPVI 120

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+ HPCQI+AD+ T +E+ G  +    ++ GDGNN+ HSL+ G A+    + IA P
Sbjct: 121 NALTDDYHPCQILADLQTIQENFGQWQDLTLTYLGDGNNVAHSLLLGCAQVGMNVRIACP 180

Query: 186 IGSEPRNEYLNWARN---QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVF 241
              +P+   +  A+      A V + HD + A +GAH ++TD W SM QE +A+     F
Sbjct: 181 PDYQPQERIVAKAQQIAGDRAKVEILHDPIAASQGAHVLYTDVWASMGQEEEAQARVKAF 240

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
            P+ +N +++  A P A+ +HCLPAHR EE+  EVL+G QS V+D+AENRLH QKA+L  
Sbjct: 241 TPYLLNQAMLEKADPAAIVLHCLPAHREEEITAEVLEGSQSRVWDQAENRLHAQKAVLAL 300

Query: 302 CFGII 306
             G I
Sbjct: 301 LLGAI 305


>gi|16078190|ref|NP_389007.1| ornithine carbamoyltransferase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221308966|ref|ZP_03590813.1| ornithine carbamoyltransferase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221313290|ref|ZP_03595095.1| ornithine carbamoyltransferase [Bacillus subtilis subsp. subtilis
           str. NCIB 3610]
 gi|221318214|ref|ZP_03599508.1| ornithine carbamoyltransferase [Bacillus subtilis subsp. subtilis
           str. JH642]
 gi|221322488|ref|ZP_03603782.1| ornithine carbamoyltransferase [Bacillus subtilis subsp. subtilis
           str. SMY]
 gi|321314855|ref|YP_004207142.1| ornithine carbamoyltransferase [Bacillus subtilis BSn5]
 gi|129265|sp|P18186|OTC_BACSU RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|39811|emb|CAA37444.1| unnamed protein product [Bacillus subtilis]
 gi|408120|emb|CAA81542.1| ornithine carbamoyltransferase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|2633462|emb|CAB12966.1| ornithine carbamoyltransferase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|320021129|gb|ADV96115.1| ornithine carbamoyltransferase [Bacillus subtilis BSn5]
          Length = 319

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 141/305 (46%), Positives = 194/305 (63%), Gaps = 9/305 (2%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
           Y K    L ++S  +++ ++  A ++K +           GK LAMIFEK STRTRVSFE
Sbjct: 10  YGKDLLTLKDLSEEDINALLAEAGELKQNK----IQPIFHGKTLAMIFEKSSTRTRVSFE 65

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
             M  LGG  +FLS  ++QLGR ET+ DTAKVLS YVDAI++RT  H ++ EL + A +P
Sbjct: 66  AGMAQLGGSALFLSQKDLQLGRGETVADTAKVLSGYVDAIMIRTFEHEKVEELAKEADIP 125

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQ +AD++T +E +G +KG   ++ GDGNN+ HSL+ G A+    ++IA
Sbjct: 126 VINGLTDKYHPCQALADLLTIKEIKGKLKGVKVAYIGDGNNVAHSLMIGCAKMGCDISIA 185

Query: 184 TPIGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREE 238
           +P G E  +E       +A   G+SV L  D ++AVK A  +++D + SM  +  +    
Sbjct: 186 SPKGYEVLDEAAEAAKTYALQSGSSVTLTDDPIEAVKDADVIYSDVFTSMGQEAEEQERL 245

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
            VF P+QVN +L+S A PD  F+HCLPAHR EEV  E++DGP S VF +AENRLH QKA+
Sbjct: 246 AVFAPYQVNAALVSHAKPDYTFLHCLPAHREEEVTAEIIDGPNSAVFQQAENRLHVQKAL 305

Query: 299 LLWCF 303
           L    
Sbjct: 306 LKAIL 310


>gi|86608303|ref|YP_477065.1| ornithine carbamoyltransferase [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86556845|gb|ABD01802.1| ornithine carbamoyltransferase [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 314

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 135/302 (44%), Positives = 188/302 (62%), Gaps = 7/302 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +    LS+++ + LS ++  A ++K     +     L G+VL ++F+K STRTR SF  A
Sbjct: 15  RDLLKLSDLTPAELSALLAQAAELKRDPYRVE----LRGRVLGLLFQKASTRTRASFTAA 70

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M   GG T+ L  + MQ+ R E + DTA+VLSRY+D I +RT +   L    EYA VPVI
Sbjct: 71  MAQCGGSTLDLVPTVMQVSRGEPLQDTARVLSRYLDVIAIRTYDQKELETFAEYADVPVI 130

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD  HPCQ++AD++T +E+ G + G   ++ GDGNN+ HSL+ G A     + +ATP
Sbjct: 131 NALTDQFHPCQVLADLLTIQENFGQLAGLTLAYCGDGNNVAHSLLLGCAMSGIHIRVATP 190

Query: 186 IGSEPRNEYLNWARN--QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQ 242
            G EP    +  AR   QG+ V +  D  +AV G+  V+TD W SM QE +A   +  F 
Sbjct: 191 PGYEPDAAVVEQARTLAQGSQVLVLQDPQEAVSGSQVVYTDVWASMGQEAEAEARKATFL 250

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           P+QVN  L+  A P A+ +HCLPAHR EE+  EVL+G QS V+D+AENRLH QKA+L+  
Sbjct: 251 PYQVNAELLQRADPQAIVLHCLPAHREEEITTEVLEGSQSRVWDQAENRLHVQKALLIQV 310

Query: 303 FG 304
            G
Sbjct: 311 LG 312


>gi|188996483|ref|YP_001930734.1| ornithine carbamoyltransferase [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188931550|gb|ACD66180.1| ornithine carbamoyltransferase [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 304

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 129/304 (42%), Positives = 201/304 (66%), Gaps = 7/304 (2%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             + F   +++S   +  II+ AKK+K   ++ F ++ L GK + +IF K STRTR+SFE
Sbjct: 1   MKRDFVSFTDLSREEVLGIIDYAKKLK---KDKFADRTLEGKSIGLIFMKQSTRTRLSFE 57

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V +  +GG  I++SGS  QL R E I DTA+V+SRY+D IV+RT +H  + EL +Y ++P
Sbjct: 58  VGVYQMGGQPIYISGSTTQLSRGEDIKDTARVMSRYLDGIVIRTFSHQEVEELAKYGSIP 117

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINALTD  HPCQ++AD+MT +E  GS++ K  ++ GDGNN+ ++L+   A     +++A
Sbjct: 118 VINALTDYQHPCQVLADLMTIDEEFGSLENKKVAYVGDGNNMANTLLLACALMGMDISVA 177

Query: 184 TPIGSEPR----NEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           TP   EP      E ++ A+  G+ + + +D  +AV  A  ++TD W+SM QE +  ++ 
Sbjct: 178 TPPNYEPNSKAVYESVDIAKKTGSKITITNDPKEAVLEADVIYTDVWVSMGQENEKGKKD 237

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           VF+PF VN  L+ +A P+A+ MHCLPAH+GEE+  +V +    V+F++AENRLH QK+++
Sbjct: 238 VFKPFTVNKDLVLLAKPNAIVMHCLPAHKGEEITEDVFEQYSDVIFNQAENRLHVQKSLM 297

Query: 300 LWCF 303
            + F
Sbjct: 298 SFLF 301


>gi|126731531|ref|ZP_01747337.1| ornithine carbamoyltransferase [Sagittula stellata E-37]
 gi|126708067|gb|EBA07127.1| ornithine carbamoyltransferase [Sagittula stellata E-37]
          Length = 308

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 157/305 (51%), Positives = 211/305 (69%), Gaps = 7/305 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKP-----LSGKVLAMIFEKPSTRTR 59
             HF D+     + L  II+ A+ +K++ +   + +P     L  +++A+IFEKPSTRTR
Sbjct: 1   MNHFLDIHKTDKTALRGIIDNARAVKDARKGKPKVEPDDELPLKNRMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
            SF+V ++ +GG T+ LSGS+MQLG  ETI DTA+V+SRYVD I++RT + S L E+ EY
Sbjct: 61  TSFDVGVRQMGGQTMVLSGSDMQLGHGETIADTARVMSRYVDMIMIRTFDESVLEEMAEY 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           A+VPVIN LTD THPCQI+AD+MTFEEHRG + GK   W GDGNN+  S +  A +F + 
Sbjct: 121 ASVPVINGLTDRTHPCQIMADVMTFEEHRGPIAGKKVVWCGDGNNVCASFLHAAGQFGFD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L  + P+  +P  E++ WAR QG+ V +  D  +AV+GA  V  DTW+SM+    ARE  
Sbjct: 181 LTFSGPVQLDPEPEFVGWARQQGSKVTIERDPAKAVEGADLVVADTWVSMHDAQSARERR 240

Query: 240 VFQ--PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
                P+QVN +LM+ A  DALFMHCLPAHR EEV +E++DGP SV++DEAENRLH QKA
Sbjct: 241 HNMLRPYQVNAALMAQAKEDALFMHCLPAHREEEVTSEIMDGPHSVIWDEAENRLHAQKA 300

Query: 298 ILLWC 302
           I+ WC
Sbjct: 301 IMRWC 305


>gi|297842275|ref|XP_002889019.1| hypothetical protein ARALYDRAFT_476678 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297334860|gb|EFH65278.1| hypothetical protein ARALYDRAFT_476678 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 375

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 129/302 (42%), Positives = 187/302 (61%), Gaps = 3/302 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFEN-KPLSGKVLAMIFEKPSTRTRVSFEV 64
           K F  + +  ++ +  I++ A ++K   ++   N  P  GK ++MIF KPS RTRVSFE 
Sbjct: 73  KDFLAIDDFDTATIKKILDKASEVKALLKSGERNYLPFKGKSMSMIFAKPSMRTRVSFET 132

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
               LGG  ++L  +++Q+G+ E   D A+VLSRY D I+ R   H  +L+L  Y++VPV
Sbjct: 133 GFFLLGGHALYLGPNDIQMGKREETRDVARVLSRYNDIIMARVFAHQDILDLANYSSVPV 192

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           +N LTD+ HPCQI+AD +T  EH G V+G    + GDGNN++HS +E A+   +    A 
Sbjct: 193 VNGLTDHNHPCQIMADALTIIEHIGQVEGTKIVYVGDGNNMVHSWLELASVIPFHFVCAC 252

Query: 185 PIGSEPRNEYLNWARNQG-ASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQ 242
           P G EP  E ++ A+  G + + + +D  +AV GA  V++D W SM Q+ +A      FQ
Sbjct: 253 PKGYEPDKERVSKAKQAGLSKIEITNDPKEAVIGADVVYSDVWASMGQKDEAEARRKAFQ 312

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            FQV+ +LM +A P A FMHCLPA RG EV N V++ P S+VF +AENR+H Q AI+L  
Sbjct: 313 GFQVDEALMKLAGPKAYFMHCLPAERGVEVTNGVVEAPYSIVFPQAENRMHAQNAIMLHL 372

Query: 303 FG 304
            G
Sbjct: 373 LG 374


>gi|320325621|gb|EFW81683.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. glycinea
           str. B076]
 gi|320327095|gb|EFW83109.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330879071|gb|EGH13220.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 306

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 147/298 (49%), Positives = 194/298 (65%), Gaps = 4/298 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  + + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSMMDYTPDELLGLIRRGVELKDLRIRGELFEPLKNRVLGMIFEKSSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I D+AKV+SR +DA+++RT  HS L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSHRDTQLGRGEPIADSAKVMSRMLDAVMIRTYAHSNLTEFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS+KGK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFLEHRGSIKGKTVAWIGDGNNMCNSYIEAAIQFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP  E+L  A   G  V +  D   AV GAH V TD W SM QE + AR   +F PF
Sbjct: 184 AGYEPNPEFLALA---GERVTIVRDPKAAVAGAHLVSTDVWTSMGQEEETARRMALFAPF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           QV  +L+ +A  D LFMHCLPAHRGEE+  ++LD  +SV +D+AENRLH QKA+L + 
Sbjct: 241 QVTRALLDLAKKDVLFMHCLPAHRGEEISVDLLDDSRSVAWDQAENRLHAQKALLEFL 298


>gi|224085690|ref|XP_002307666.1| predicted protein [Populus trichocarpa]
 gi|222857115|gb|EEE94662.1| predicted protein [Populus trichocarpa]
          Length = 374

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 130/304 (42%), Positives = 185/304 (60%), Gaps = 3/304 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-PLSGKVLAMIFEKPSTRTRVSFE 63
            + F  +S+   + +  I++ A ++K   ++      P  GK +AMIF KPS RTRVSFE
Sbjct: 71  MEDFLHISDFDKATIMKILDRAAEVKAVIKSGDRTFLPFKGKTMAMIFAKPSMRTRVSFE 130

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
                LGG  I+L   ++Q+G+ E   D A+VLSRY D I+ R   H  +L+L ++ATVP
Sbjct: 131 TGFFLLGGHAIYLGPDDIQMGKREETRDVARVLSRYNDIIMARVFAHQDILDLAKHATVP 190

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQI+AD +T  EH G ++G    + GDGNNI+HS +  AA   +    A
Sbjct: 191 VINGLTDYNHPCQIMADALTIIEHVGRLEGTKVVYVGDGNNIVHSWLLLAAVIPFHFVCA 250

Query: 184 TPIGSEPRNEYLNWARNQ-GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHVF 241
            P G EP  + +  A+    + + + +D  +AV+GA  V++D W SM Q+ +A     VF
Sbjct: 251 CPKGFEPDAKTVQKAQQAGISKIEITNDPQEAVRGADVVYSDVWASMGQKEEAAHRRQVF 310

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           Q FQV+ +LM +A P A FMHCLPA RG EV + V++ P S+VF +AENR+H Q AI+L 
Sbjct: 311 QGFQVDENLMKLAGPKAYFMHCLPAERGVEVTDGVIEAPNSIVFPQAENRMHAQNAIMLH 370

Query: 302 CFGI 305
             G+
Sbjct: 371 ALGL 374


>gi|262376358|ref|ZP_06069587.1| ornithine carbamoyltransferase [Acinetobacter lwoffii SH145]
 gi|262308497|gb|EEY89631.1| ornithine carbamoyltransferase [Acinetobacter lwoffii SH145]
          Length = 306

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 132/297 (44%), Positives = 182/297 (61%), Gaps = 2/297 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  L ++S+  L+ I++ A ++K    N    +P  GKV+ MIFEK STRTRVSFE  
Sbjct: 4   RHFLTLRDLSTLELNQILQRAIELKRKQHNNEVFQPFVGKVMGMIFEKSSTRTRVSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M   GG  IFLS  + QLGR E I D+A+V+S  +D +++RT  H  +     Y+ VPVI
Sbjct: 64  MSQFGGSAIFLSSRDTQLGRGEPIEDSARVISSMLDIVMIRTFGHDIVERFASYSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+ HPCQ++AD+ T+ E RGS++GK  +W GDGNN+ +S IE A  + + L IA P
Sbjct: 124 NALTDDHHPCQLLADMQTYVEQRGSIEGKTVAWIGDGNNMCNSYIEAAHMWGFNLKIAAP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G EP+ ++L+   +    V    DA             +     +E +   E  F  +Q
Sbjct: 184 KGYEPQEKFLSEFAHCVELVPSAEDAAVNADLIVTDVWASM--GQEEEQKIREKAFADYQ 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           VN  LM +AHPD LFMHCLPAHRGEE+   +LD   +VV+DEAENRLH QKA++ + 
Sbjct: 242 VNERLMDLAHPDCLFMHCLPAHRGEEISENLLDHKNAVVWDEAENRLHAQKALVEFL 298


>gi|283851130|ref|ZP_06368414.1| ornithine carbamoyltransferase [Desulfovibrio sp. FW1012B]
 gi|283573526|gb|EFC21502.1| ornithine carbamoyltransferase [Desulfovibrio sp. FW1012B]
          Length = 301

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 143/301 (47%), Positives = 202/301 (67%), Gaps = 4/301 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
            P+HF  + + +      +++ A  +K ++     +  L GK   ++FEK STRTRVSFE
Sbjct: 1   MPQHFLTILDFTPEEAVRLLDRAAAMKAANHR---SDLLHGKTCILVFEKASTRTRVSFE 57

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VA++HLGG  IF++ ++ QLGR E I DTA+VLSRY D +++RT  H +L EL E  ++P
Sbjct: 58  VAVRHLGGWPIFMTQNDSQLGRDEPIRDTARVLSRYADCLIVRTFGHHKLQELAESGSIP 117

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           V+NAL+D  HPCQI+AD++T  EH G + G   ++ GDGNNI HSLI  AAR+   + +A
Sbjct: 118 VVNALSDEYHPCQIMADLLTMREHSGRLDGLTVAFVGDGNNIAHSLINAAARYPIKVVVA 177

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQ 242
            P G EP    +  AR+ GA VA+ +D  +A +GAH ++TD W SM QE + A+    F 
Sbjct: 178 APKGYEPDPAVVEKARSLGADVAVVNDPAEAARGAHYLYTDVWASMGQEAEQAKRAKAFA 237

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            FQ+N +L+++A P A  +HCLPAHRGEE+ + V++GP S+V+DEAENRLH QKAIL W 
Sbjct: 238 GFQINDALLALAAPGAKVLHCLPAHRGEEITDAVMEGPASIVWDEAENRLHVQKAILEWI 297

Query: 303 F 303
           F
Sbjct: 298 F 298


>gi|309776281|ref|ZP_07671270.1| ornithine carbamoyltransferase [Erysipelotrichaceae bacterium
           3_1_53]
 gi|308915961|gb|EFP61712.1| ornithine carbamoyltransferase [Erysipelotrichaceae bacterium
           3_1_53]
          Length = 302

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 124/301 (41%), Positives = 179/301 (59%), Gaps = 3/301 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH   L++++   L  ++++A  +K   +       L  K L MIF K STRTRVSFE 
Sbjct: 1   MKHLLTLADLTKEELYGLLDLADSLKKEVKKGVFTPYLRNKTLGMIFTKSSTRTRVSFET 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG  ++L+ ++MQLGR E I DTA+VLSRY+D I++RT   S L EL EY ++P+
Sbjct: 61  GMAQLGGTALYLNANDMQLGRGEPIKDTARVLSRYLDGIMIRTYKQSDLEELAEYGSIPI 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD  HPCQ++AD+ T  EH+G+++G    + G GNN+ +SLI G       +  A 
Sbjct: 121 INGLTDYVHPCQVLADLQTIREHKGTLEGLKMCFIGAGNNMANSLINGGILAGMEVACAC 180

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA--REEHVFQ 242
           P+   P  + +  A N      L  D ++A K A  + TD W SM +E +A  R +    
Sbjct: 181 PLEYLPDADIVKRA-NASGRFTLTQDVLEAAKDADVLVTDVWASMGEEQEAAQRRKIFEG 239

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            +Q+N ++M+ A  DA+ +HCLPAHR EE+  +V +     +FDEAENRLH QKA+L+  
Sbjct: 240 IYQINDAVMAAAKEDAMVLHCLPAHREEEITEKVFEAHADEIFDEAENRLHAQKAVLVTL 299

Query: 303 F 303
            
Sbjct: 300 M 300


>gi|268610942|ref|ZP_06144669.1| ornithine carbamoyltransferase [Ruminococcus flavefaciens FD-1]
          Length = 302

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 123/300 (41%), Positives = 188/300 (62%), Gaps = 1/300 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH   + ++S+  +  I+ +A ++K   ++   +  L GK L MIF+K STRTRVSFE 
Sbjct: 1   MKHLLKMLDLSTEEIIDILNLADQLKYELKHNIPHPRLKGKTLGMIFQKASTRTRVSFET 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG  +FLS +++Q+GR E + DTA+VLSRY+D I++RT     + +L EY ++P+
Sbjct: 61  GMYQLGGYPLFLSSNDLQIGRGEPVQDTARVLSRYLDGIMIRTFEQKEVEDLAEYGSIPI 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD  HPCQ++AD+MT  E +G+  G    + GDGNN+ +SLI G  +    + +A 
Sbjct: 121 INGLTDFCHPCQVLADLMTIREFKGTFDGLKMCFIGDGNNMANSLIVGCLKVGMSVAVAC 180

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHVFQP 243
           P   +P  E L++A+  G    + +   +A KGA  + TD W SM QE +A + +  F  
Sbjct: 181 PDDYQPPKEILDFAKEYGDKFMMTNSPKEAAKGADVLITDVWASMGQEGEAEKRKKAFAG 240

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +Q+N  LM+ A+ DA+ +HCLPAHR EE+  +V +   + +F+EAENRLH QKA+++   
Sbjct: 241 YQINDDLMAEANSDAMVLHCLPAHREEEITEKVFEAHANEIFEEAENRLHAQKAVMVKLM 300


>gi|126652705|ref|ZP_01724866.1| ornithine carbamoyltransferase [Bacillus sp. B14905]
 gi|126590554|gb|EAZ84672.1| ornithine carbamoyltransferase [Bacillus sp. B14905]
          Length = 337

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 134/305 (43%), Positives = 192/305 (62%), Gaps = 5/305 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K    L + +S  ++ +IE+A ++K  ++     + L GK L MIFEK STRTR+SFE
Sbjct: 32  KGKDLLTLLDYTSQEVAELIELATQLKMITKEGKCPRLLEGKTLGMIFEKHSTRTRISFE 91

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M  LGG ++F+   ++Q+GR E+I DTA VLS Y+D I++R  +H+ + EL E+AT+P
Sbjct: 92  VGMNQLGGKSMFMHARDLQIGRGESIYDTAHVLSGYLDGIMIRANSHAMVRELAEHATIP 151

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQ +AD+ T  E++G +KG   ++ GDGNN+ HSLI  +A     + +A
Sbjct: 152 VINGLTDIYHPCQALADLETIAENKGFLKGLKIAYVGDGNNVAHSLIVASAHVGMNVAVA 211

Query: 184 TPIGSEPRNEYLNWARNQGASVA----LFHDAVQAVKGAHCVFTDTWISMNQEFK-AREE 238
           TP G E   E +  A+   A+      + HD V+AV  A  V+ D W SM QE + A+  
Sbjct: 212 TPAGYECDAEVIAKAQAIAAANGSTILVTHDPVEAVLNADVVYADVWTSMGQEEEAAKRL 271

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F  +Q+N  L++ A P+ +F+HCLPAHR EEV   V+DGP S +F++AENRLH QKA+
Sbjct: 272 QDFADYQINDELVAYAKPNYMFLHCLPAHREEEVATSVIDGPNSYIFEQAENRLHAQKAV 331

Query: 299 LLWCF 303
           L    
Sbjct: 332 LASIL 336


>gi|330898566|gb|EGH29985.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 306

 Score =  213 bits (542), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 134/297 (45%), Positives = 185/297 (62%), Gaps = 2/297 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  + + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSMMDYTPDELLGLIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I D+AKV+SR +DA+++RT  HS L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSHRDTQLGRGEPIADSAKVMSRMLDAVMIRTYAHSNLTEFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS++GK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFLEHRGSIQGKTVAWIGDGNNMCNSYIEAAIQFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G EP  E+L  A  +   V     AV+           +     +E  AR + +F PFQ
Sbjct: 184 AGYEPNAEFLALAGERVTVVRDPKAAVEGAHLVSTDVWTSM--GQEEETARRKKLFAPFQ 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           V  +L+ +A  D LFMHCLPAHRGEE+  ++LD  +SV +D+AENRLH QKA+L + 
Sbjct: 242 VTRALLDLADKDVLFMHCLPAHRGEEISVDLLDDARSVAWDQAENRLHAQKALLEFL 298


>gi|330981573|gb|EGH79676.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 306

 Score =  213 bits (542), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 133/297 (44%), Positives = 183/297 (61%), Gaps = 2/297 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  + + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSMMDYTPDELLGLIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I D+AKV+SR +DA+++RT  HS L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSHRDTQLGRGEPIADSAKVMSRMLDAVMIRTYAHSNLTEFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS++GK  +W GDG N+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFLEHRGSIQGKTVAWIGDGKNMCNSYIEAAIQFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G EP  E+L  A      V     AV+           +     +E  AR + +F PFQ
Sbjct: 184 AGYEPNAEFLALAGEGVTVVRDPKAAVEGAHLVSTDVWTSM--GQEEETARRKKLFAPFQ 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           V  +L+ +A  D LFMHCLPAHRGEE+  ++LD  +SV +D+AENRLH QKA+L + 
Sbjct: 242 VTRALLDLADKDVLFMHCLPAHRGEEISVDLLDDARSVAWDQAENRLHAQKALLEFL 298


>gi|258513891|ref|YP_003190113.1| ornithine carbamoyltransferase [Desulfotomaculum acetoxidans DSM
           771]
 gi|257777596|gb|ACV61490.1| ornithine carbamoyltransferase [Desulfotomaculum acetoxidans DSM
           771]
          Length = 320

 Score =  213 bits (542), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 127/305 (41%), Positives = 178/305 (58%), Gaps = 5/305 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             + F  L + S+  +  +I VA ++K   +    +  L GK LAMIF+K STRTRVSFE
Sbjct: 14  KGRDFLLLLDFSAEEIKHLINVAVELKAIQKKGEPHPYLQGKTLAMIFQKSSTRTRVSFE 73

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VAM  LGG  +FLS +++Q+GR ETI DTA+ LSRYVD I++RT   S + EL EYA +P
Sbjct: 74  VAMYQLGGYPLFLSSNDLQMGRGETIADTARTLSRYVDGIMIRTYAQSDVEELAEYADIP 133

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HP Q+IAD+ T  EH+G + G   ++ GDGNN+ HSL+ G A+    + +A
Sbjct: 134 VINGLTDLVHPTQVIADLQTVLEHKGKLAGLKMAFLGDGNNVAHSLMAGCAKVGMNITLA 193

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN-----QEFKAREE 238
            P G +P  E +  A+    +     + ++    A       +  +      ++ +    
Sbjct: 194 NPAGYKPLPEMVEKAKQVAETTGSIIEIIEDPVAAVKDADVIYTDVWASMGQEKEQEERA 253

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
            +  P+QVN  L+  A PD +F+HCLPA R +EV +E+LD   S  FDEAENRLH  KAI
Sbjct: 254 KMMAPYQVNAELVRHAKPDYIFLHCLPAKREQEVTSEILDSNHSAAFDEAENRLHAHKAI 313

Query: 299 LLWCF 303
           L    
Sbjct: 314 LALLM 318


>gi|330937569|gb|EGH41509.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. pisi str.
           1704B]
          Length = 305

 Score =  213 bits (542), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 134/297 (45%), Positives = 185/297 (62%), Gaps = 2/297 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  + + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSMMDYTPDELLGLIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I D+AKV+SR +DA+++RT  HS L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSHRDTQLGRGEPIADSAKVMSRMLDAVMIRTYAHSNLTEFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS++GK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFLEHRGSIQGKTVAWIGDGNNMCNSYIEAAIQFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G EP  E+L  A  +   V     AV+           +     +E  AR + +F PFQ
Sbjct: 184 AGYEPNAEFLALAGERVTVVRDPKAAVEGAHLVSTDVWTSM--GQEEETARRKKLFAPFQ 241

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           V  +L+ +A  D LFMHCLPAHRGEE+  ++LD  +SV +D+AENRLH QKA+L + 
Sbjct: 242 VTRALLDLADKDVLFMHCLPAHRGEEISVDLLDDARSVAWDQAENRLHAQKALLEFL 298


>gi|151039|gb|AAA25720.1| ornithine carbamoyltransferase (EC 2.1.3.3) [Pseudomonas
           aeruginosa]
          Length = 305

 Score =  213 bits (542), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 142/298 (47%), Positives = 195/298 (65%), Gaps = 4/298 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF    + S   L  +I    ++K+        +PL  +VL M+FEK STRTR+SFE  
Sbjct: 4   RHFLSFMDYSPEELIGLIRRGSELKDLRNRGVLYEPLKSRVLGMVFEKASTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E IGD+A+V+SR +D +++RT  H+ L E   ++ VPVI
Sbjct: 64  MIQLGGQAIFLSPRDTQLGRGEPIGDSARVMSRMLDGVMIRTFAHATLTEFAAHSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS++GK  +W GDGNN+ +S IE   +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFHEHRGSIQGKTVAWIGDGNNMCNSYIEEEMKFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP+ E++  A   G  + +  D  +AV GAH V TD W SM QE + A    +F+P+
Sbjct: 184 EGYEPKAEFVALA---GDRLRVVRDPREAVAGAHLVSTDVWASMGQEDEAAARIAMFRPY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           QVN +L+  A  D LFMHCLPAHRGEE+  E+LD P+SV +D+AENRLH QKA+L   
Sbjct: 241 QVNAALLDGAADDVLFMHCLPAHRGEEISEELLDDPRSVAWDQAENRLHAQKALLELL 298


>gi|218247779|ref|YP_002373150.1| ornithine carbamoyltransferase [Cyanothece sp. PCC 8801]
 gi|218168257|gb|ACK66994.1| ornithine carbamoyltransferase [Cyanothece sp. PCC 8801]
          Length = 309

 Score =  213 bits (542), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 131/312 (41%), Positives = 197/312 (63%), Gaps = 13/312 (4%)

Query: 2   MTYP----KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTR 57
           M+      +    ++++S+S L+ I+E+   +K+   +     P+  KVL ++F K STR
Sbjct: 1   MSMNTLKGRDILGIADLSASELTEILELGALLKSGERS-----PVCQKVLGLLFSKASTR 55

Query: 58  TRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELT 117
           TRVSF VAM  LGG  I L+ S  Q+GR E + DTA+VL RY+D + +RT     L    
Sbjct: 56  TRVSFSVAMYQLGGQVIDLNPSVTQVGRGEPLIDTARVLDRYLDILAIRTYQQEDLETFA 115

Query: 118 EYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFN 177
           +YA +P+INALTD  HPCQI+AD+MT +E  G++ G   ++ GDGNN+ HSLI G A   
Sbjct: 116 KYAKIPIINALTDWEHPCQILADLMTIKECFGTLSGITVTYLGDGNNVAHSLILGGALMG 175

Query: 178 YLLNIATPIGSEPRNEYLNWARNQG---ASVALFHDAVQAVKGAHCVFTDTWISMNQEFK 234
             ++IATP   +P    L+ A+  G     V +  + ++AV+G+  ++TD W SM QE  
Sbjct: 176 MNVHIATPKDYQPNQAILDKAKEIGVEGFQVLVTDNPIEAVEGSQVLYTDVWASMGQESS 235

Query: 235 AR-EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLH 293
           A     +F+P+QVN  L++ A  +A+ +HCLPAHRGEE+ +EV++G QS V+D+AENR+H
Sbjct: 236 AEARIPLFEPYQVNQKLLNHADQEAIVLHCLPAHRGEEITDEVIEGKQSRVWDQAENRMH 295

Query: 294 TQKAILLWCFGI 305
            QKA+++   G+
Sbjct: 296 AQKALMVSLLGV 307


>gi|86159113|ref|YP_465898.1| ornithine carbamoyltransferase [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85775624|gb|ABC82461.1| ornithine carbamoyltransferase [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 309

 Score =  213 bits (542), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 124/303 (40%), Positives = 178/303 (58%), Gaps = 8/303 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            + F  ++++  S L  ++E A + K   ++    +PL  + + ++FEK STRTRVSFEV
Sbjct: 8   KRDFLRITDLDRSELLELVERAAEWKLLGKSG--PRPLERRTVGLVFEKASTRTRVSFEV 65

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           A   LG   I LS  + QLGR E I DTA+VLSRY+D +V+RT  H ++ E+  YA VPV
Sbjct: 66  AANQLGAGAIMLSPRDTQLGRGEPIRDTARVLSRYLDCLVVRTYGHDKIEEMARYAGVPV 125

Query: 125 INALTDNTHPCQIIADIMTFEEHRG----SVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +NALTD +HPCQ++AD++T  E  G    +  G   +W GDGNN+ +S +E      + L
Sbjct: 126 VNALTDASHPCQVLADLLTVTERFGSDALTKPGLRVAWVGDGNNMANSWLEACVLLGFEL 185

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
           ++A P G +P    L  A  +        +AV      +     +     +E        
Sbjct: 186 HLACPAGYDPDPALLARAAGRAKVFRSPAEAVAGAHVVNTDVWASM--GQEEEAEERRRR 243

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+ F V+ +LM+ A P+A+ +HCLPAHRGEE+ +EVL+GPQS VFDEAENRLH QKA+L 
Sbjct: 244 FEGFIVDRALMAQARPNAVVLHCLPAHRGEEITDEVLEGPQSAVFDEAENRLHAQKALLE 303

Query: 301 WCF 303
              
Sbjct: 304 LLL 306


>gi|330950005|gb|EGH50265.1| ornithine carbamoyltransferase [Pseudomonas syringae Cit 7]
          Length = 306

 Score =  213 bits (542), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 147/298 (49%), Positives = 196/298 (65%), Gaps = 4/298 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  + + +   LS +I    ++K+        +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSMMDYTPDELSGLIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I D+AKV+SR +DA+++RT  HS L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSHRDTQLGRGEPIADSAKVMSRMLDAVMIRTYAHSNLTEFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS++GK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFLEHRGSIQGKTVAWIGDGNNMCNSYIEAAIQFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP  E+L  A   G  V +  D   AV GAH V TD W SM QE + AR + +F PF
Sbjct: 184 AGYEPNAEFLALA---GERVTVVRDPKAAVAGAHLVSTDVWTSMGQEEETARRKKLFAPF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           QV  +L+ +A  D LFMHCLPAHRGEE+  ++LD  +SV +D+AENRLH QKA+L + 
Sbjct: 241 QVTRALLDLADKDVLFMHCLPAHRGEEISVDLLDDSRSVAWDQAENRLHAQKALLEFL 298


>gi|17547273|ref|NP_520675.1| ornithine carbamoyltransferase [Ralstonia solanacearum GMI1000]
 gi|32699462|sp|Q8XWC0|OTC_RALSO RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|17429575|emb|CAD16261.1| probable ornithine carbamoyltransferase (otcase) protein [Ralstonia
           solanacearum GMI1000]
          Length = 308

 Score =  213 bits (542), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 126/302 (41%), Positives = 182/302 (60%), Gaps = 3/302 (0%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           +  KH+    + S    + +++ ++ +K   +N     PL  + LAMIFEK STRTR+SF
Sbjct: 5   SKIKHYLQFKDFSLEEYAYLLDRSRILKAKFKNYETWHPLHDRTLAMIFEKNSTRTRLSF 64

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E  +  LGG  +FL+  + QLGR E I D A+V+SR  D I++RT     +     ++ V
Sbjct: 65  EAGIHQLGGHAVFLNTRDSQLGRGEPIEDAAQVISRMTDIIMIRTFGQEIIERFATHSRV 124

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVIN LT+  HPCQ++ADI TF EHRG ++GK  +W GD NN+ ++ I+ A    +  + 
Sbjct: 125 PVINGLTNEYHPCQVLADIFTFIEHRGPIQGKTVTWVGDANNMAYTWIQAAEILGFRFHF 184

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVF 241
           + P G   + + +  A +    V +F + ++A +GAH V TD W SM  E +    +  F
Sbjct: 185 SAPKGY--QLDPVMVADSSRPFVHVFENPLEACEGAHLVTTDVWTSMGYEAENEARKKAF 242

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
             + V  ++M  A PDALFMHCLPAHRGEEV   V+DG QSVV+DEAENRLH QKA++ +
Sbjct: 243 GDWMVTEAMMQRAQPDALFMHCLPAHRGEEVEAAVIDGKQSVVWDEAENRLHVQKALMEY 302

Query: 302 CF 303
             
Sbjct: 303 LL 304


>gi|41053142|dbj|BAD08085.1| putative ornithine carbamoyltransferase [Oryza sativa Japonica
           Group]
 gi|125583394|gb|EAZ24325.1| hypothetical protein OsJ_08078 [Oryza sativa Japonica Group]
 gi|215769252|dbj|BAH01481.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 367

 Score =  213 bits (542), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 131/302 (43%), Positives = 182/302 (60%), Gaps = 2/302 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFEN-KPLSGKVLAMIFEKPSTRTRVSFE 63
           PK F  + +     +  I+  A ++K   ++   + +P  GK +AMIF KPS RTRVSFE
Sbjct: 65  PKDFLHIDDFDKDTIMKILNRAIEVKAMIKSGDRSFQPFKGKSMAMIFAKPSMRTRVSFE 124

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
                LGG  I+L   ++Q+G+ E   D A+VLS Y D I+ R   H  +L+L +YA VP
Sbjct: 125 TGFFLLGGHAIYLGPDDIQMGKREETRDVARVLSGYNDIIMARVFAHQDILDLAKYAAVP 184

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQI+AD +T  EH G ++     + GDGNNI+HS +  AA F      A
Sbjct: 185 VINGLTDYNHPCQIMADALTMLEHIGRIENTKVVYVGDGNNIVHSWLRLAALFPLHFVCA 244

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHVFQ 242
            P G EP  + +  AR+ G+ + +  D ++AVKGA  V+TD W SM Q+ +A   + VFQ
Sbjct: 245 CPKGFEPDAKTVEIARSAGSKIEITDDPMEAVKGADVVYTDVWASMGQKEEAEYRKKVFQ 304

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            F V+ ++M MA P+A  MHCLPA RG EV +  ++ P S+VF +AENR+H Q AI+L  
Sbjct: 305 GFTVDEAMMEMAGPNAFLMHCLPAERGIEVTDGAIEAPNSIVFPQAENRMHAQNAIMLHV 364

Query: 303 FG 304
            G
Sbjct: 365 LG 366


>gi|77460748|ref|YP_350255.1| ornithine carbamoyltransferase [Pseudomonas fluorescens Pf0-1]
 gi|77384751|gb|ABA76264.1| ornithine carbamoyltransferase [Pseudomonas fluorescens Pf0-1]
          Length = 307

 Score =  213 bits (542), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 148/303 (48%), Positives = 198/303 (65%), Gaps = 5/303 (1%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           MM+  +HF  L + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+
Sbjct: 1   MMSA-RHFLSLMDCTPEELVSVIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRI 59

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFE  M  LGG  IFLS  + QLGR E IGD A V+S  +DA+++RT  HS L E    +
Sbjct: 60  SFEAGMIQLGGQAIFLSPRDTQLGRGEPIGDCAIVMSSMLDAVMIRTFAHSTLTEFAANS 119

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
            VPVIN L+D+ HPCQ++AD+ TF EHRGS++GK  +W GDGNN+ +S IE A +F++ L
Sbjct: 120 RVPVINGLSDDLHPCQLLADMQTFLEHRGSIQGKTVAWIGDGNNMCNSYIEAAIQFDFQL 179

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEH 239
            +A P G EP  E++  A   G  V +  D   AV+GAH V TD W SM QE + A+   
Sbjct: 180 RVACPEGYEPNPEFVAKA---GDRVTIVRDPKDAVRGAHLVSTDVWTSMGQEEETAKRLK 236

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           +F PFQVN +L+ +A  D LFMHCLPAHRGEE+  ++LD P+SV +D+AENRLH QKA+L
Sbjct: 237 LFAPFQVNRALLDLAADDVLFMHCLPAHRGEEISLDLLDDPRSVAWDQAENRLHAQKALL 296

Query: 300 LWC 302
            + 
Sbjct: 297 EFL 299


>gi|121608866|ref|YP_996673.1| ornithine carbamoyltransferase [Verminephrobacter eiseniae EF01-2]
 gi|121553506|gb|ABM57655.1| ornithine carbamoyltransferase [Verminephrobacter eiseniae EF01-2]
          Length = 306

 Score =  213 bits (542), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 130/301 (43%), Positives = 187/301 (62%), Gaps = 2/301 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
             H+    ++ +   + + E A  +K+  +   ++ PL+ + LAMIFEK STRTRVSFE 
Sbjct: 1   MTHYLQFGDLDADTYAYLFERAALLKHKFKAYEKHHPLADRTLAMIFEKASTRTRVSFEA 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG  + L+  + Q GRAE I D+A+V+SR VD +++RT   ++L     ++ VPV
Sbjct: 61  GMYQLGGSVVHLTTGDSQWGRAEPIEDSARVISRMVDLVMIRTYEQAKLERFAAHSRVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LT+  HPCQI+ADI TF E RGS++GK  +W GDGNN+ ++ ++ AA   + ++++T
Sbjct: 121 INGLTNEFHPCQILADIFTFIERRGSIRGKTVAWVGDGNNMANTWLQAAALLGFTVHVST 180

Query: 185 PIGSEPRNEYLNWARNQG-ASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQ 242
           P G E   + +  A      S     D   A +GA  V TD W SM  E +    E  F 
Sbjct: 181 PRGYEIDAKLVAGAGKTCAESYKFHSDPRAACEGADLVTTDVWTSMGYEAENEAREKAFA 240

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            + V+  +M+ A PDALFMHCLPAHRG+EV  +V+DGPQSVV+DEAENR+H QKA++ + 
Sbjct: 241 HWCVDAEMMAAAKPDALFMHCLPAHRGQEVHADVIDGPQSVVWDEAENRMHVQKALMEYL 300

Query: 303 F 303
            
Sbjct: 301 L 301


>gi|299065834|emb|CBJ37013.1| ornithine carbamoyltransferase [Ralstonia solanacearum CMR15]
          Length = 308

 Score =  213 bits (541), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 126/302 (41%), Positives = 181/302 (59%), Gaps = 3/302 (0%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           +  KH+    + S    + +++ ++ +K   +N     PL  + LAMIFEK STRTR+SF
Sbjct: 5   SKIKHYLQFKDFSLEEYAYLLDRSRILKAKFKNYETWHPLHDRTLAMIFEKNSTRTRLSF 64

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E  +  LGG  +FL+  + QLGR E I D A+V+SR  D I++RT     +     ++ V
Sbjct: 65  EAGIHQLGGHAVFLNTRDSQLGRGEPIEDAAQVISRMTDIIMIRTFGQEIIERFAAHSRV 124

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVIN LT+  HPCQ++ADI TF EHRG ++GK  +W GD NN+ ++ I+ A    +  + 
Sbjct: 125 PVINGLTNEYHPCQVLADIFTFIEHRGPIQGKTVTWVGDANNMAYTWIQAAEILGFRFHF 184

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVF 241
           + P G +     +  A +    V +F + ++A +GAH V TD W SM  E +    +  F
Sbjct: 185 SAPKGYQLDPAMV--ADSSRPFVHVFENPLEACEGAHLVTTDVWTSMGYEAENEARKKAF 242

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
             + V  ++M  A PDALFMHCLPAHRGEEV   V+DG QSVV+DEAENRLH QKA++ +
Sbjct: 243 GDWMVTEAMMQRAQPDALFMHCLPAHRGEEVEAAVIDGKQSVVWDEAENRLHVQKALMEY 302

Query: 302 CF 303
             
Sbjct: 303 LL 304


>gi|309792401|ref|ZP_07686868.1| ornithine carbamoyltransferase [Oscillochloris trichoides DG6]
 gi|308225556|gb|EFO79317.1| ornithine carbamoyltransferase [Oscillochloris trichoides DG6]
          Length = 311

 Score =  213 bits (541), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 125/310 (40%), Positives = 185/310 (59%), Gaps = 9/310 (2%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK----PLSGKVLAMIFEKPSTRTR 59
             +HF  +++++      +++ A  +K              P+ G+ LA++FEKPS RTR
Sbjct: 1   MVRHFLSVTDMNREESEALLDRAAALKAEWYAAGRGVHPGMPMQGRTLALVFEKPSLRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           V+FE  M  LGG   +LS +++ +G  E++ D A+ LSR+V  I  R   HS +  L  Y
Sbjct: 61  VAFESGMTQLGGHPSYLSANDIDMGGRESVPDVARNLSRWVQVIAARVFKHSTVETLARY 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ++VPVINAL D  HPCQ +AD++T  EH G ++G   ++ GDGNN+ +SL+   A     
Sbjct: 121 SSVPVINALCDVEHPCQALADMLTLREHFGRLQGLKLAYVGDGNNVCNSLLLLGATLGVN 180

Query: 180 LNIATPIGSEPRNEYLNWAR----NQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA 235
           + +  P    P  E +  A        A++ +     +AV  AH V+TD W SM QE +A
Sbjct: 181 VAVGAPQDYLPDPEIVARAEVLAAESDATITVTTSPSEAVADAHAVYTDVWASMGQEHEA 240

Query: 236 -REEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHT 294
            R   VF+P++V+ +LM+ A+  AL MHCLPAHRGEE+  EV+DGP+SV+FD+AENRLH 
Sbjct: 241 ARRRPVFEPYRVDAALMAQANSSALAMHCLPAHRGEEMSAEVIDGPRSVIFDQAENRLHV 300

Query: 295 QKAILLWCFG 304
           QKA++L   G
Sbjct: 301 QKALVLTLLG 310


>gi|163789769|ref|ZP_02184206.1| ornithine carbamoyltransferase [Carnobacterium sp. AT7]
 gi|159874991|gb|EDP69058.1| ornithine carbamoyltransferase [Carnobacterium sp. AT7]
          Length = 317

 Score =  213 bits (541), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 145/307 (47%), Positives = 191/307 (62%), Gaps = 6/307 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
           Y K+   +++++   ++ +IE A  +K  ++    +  L GK L MIFEK STRTRVSFE
Sbjct: 9   YQKNILQVADLTEKEVTLLIEEAIVMKEQTKAGIPHLYLQGKTLGMIFEKSSTRTRVSFE 68

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M  LGG  +FLS  ++QLGR E+I DTAKVLSRYVD +++RT  H  + E  E +TVP
Sbjct: 69  VGMTQLGGHALFLSSKDIQLGRGESIADTAKVLSRYVDGLMIRTFGHEIIEEFAENSTVP 128

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGD-GNNILHSLIEGAARFNYLLNI 182
           +IN LT+  HP Q++AD MT  E +G++KG   ++ GD  NN+ HSL+EGAA     + I
Sbjct: 129 IINGLTNEHHPMQVLADFMTIYEKKGALKGLNLAYIGDGNNNMPHSLMEGAAIMGMNMTI 188

Query: 183 ATPIGSEP----RNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKARE 237
           A+P G EP      +    A   GAS+   +D V+AV  A  V TD W SM  +  +   
Sbjct: 189 ASPKGYEPLEVIFKKVKIKAEQTGASIQFTYDPVEAVTNADIVVTDVWTSMGMEAEETER 248

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
              F P+QVN  L   A  D +F+HCLPAHRGEEV  EV+DG  SVVFDEAENRLH QKA
Sbjct: 249 TTHFLPYQVNAELTHHAKEDFIFLHCLPAHRGEEVTAEVIDGIHSVVFDEAENRLHAQKA 308

Query: 298 ILLWCFG 304
           +L    G
Sbjct: 309 VLKKLMG 315


>gi|117927017|ref|YP_867634.1| ornithine carbamoyltransferase [Magnetococcus sp. MC-1]
 gi|117610773|gb|ABK46228.1| ornithine carbamoyltransferase [Magnetococcus sp. MC-1]
          Length = 321

 Score =  213 bits (541), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 148/306 (48%), Positives = 196/306 (64%), Gaps = 7/306 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            +    L ++     + + + A  +K   E       L G+ LAM+FEK STRTRVSFE 
Sbjct: 8   KRDLLSLFDLRDEEFTVLFQRATTLKRKLERHEPVHSLDGRTLAMLFEKSSTRTRVSFEA 67

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG  +FLS  ++QLGR E + D+A+VLSRYVD I++RT +H+ +  + EYA+VPV
Sbjct: 68  GMFQLGGKALFLSSRDIQLGRGEGVKDSARVLSRYVDGIMVRTFDHANVEIMAEYASVPV 127

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD  HPCQ++ADI TFEE RGS+KGK  +W GDGNN+ ++ I+ A R+ + L +A 
Sbjct: 128 INGLTDTLHPCQVLADIFTFEEKRGSLKGKRVAWVGDGNNMANTWIQAAVRYGFHLTLAC 187

Query: 185 PIGSEPRNEYLNWARNQGASVALF------HDAVQAVKGAHCVFTDTWISMNQEFKAR-E 237
           P+G EP  + L+ AR + A   +        D  Q V  AH V TD W SM QE ++   
Sbjct: 188 PLGYEPDGDILSAARKELAEREVDASLTLVRDPRQGVDRAHLVTTDVWTSMGQEGESDTR 247

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
           + VF  +QV+  LM+ A  +ALFMHCLPAHRGEEV   VL+G QSVV+DEAENRLH QKA
Sbjct: 248 KAVFAAYQVDSGLMAAADAEALFMHCLPAHRGEEVTAAVLEGSQSVVWDEAENRLHVQKA 307

Query: 298 ILLWCF 303
           IL +  
Sbjct: 308 ILEFLM 313


>gi|332711668|ref|ZP_08431599.1| ornithine carbamoyltransferase [Lyngbya majuscula 3L]
 gi|332349646|gb|EGJ29255.1| ornithine carbamoyltransferase [Lyngbya majuscula 3L]
          Length = 306

 Score =  213 bits (541), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 118/306 (38%), Positives = 174/306 (56%), Gaps = 9/306 (2%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             + F   +++S+S++  +++ A K+K          P   KVL ++F K STRTRVSF 
Sbjct: 5   KGRDFLGFTDLSASDIQELLDKATKLKKGQ-----WNPRCNKVLGLLFYKASTRTRVSFS 59

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VAM  LGG  I L+ +  Q+GR E + DTA+VL RY+D + +RT    +L    EYA +P
Sbjct: 60  VAMYQLGGQVIDLNPNVTQVGRGEPVVDTARVLDRYLDILAIRTFEQKQLETFAEYAKIP 119

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           +INALTD  HPCQI+AD++T +E  G++ G   ++ GDGNN+ HSL+ G A     + +A
Sbjct: 120 IINALTDWEHPCQILADLLTIQECFGTLAGLTLTYVGDGNNVAHSLMLGCALMGMNVRVA 179

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA----REEH 239
           TP   +P +     A    AS          +  A               +         
Sbjct: 180 TPPAYQPDSAICELALKTAASRTEVMVTNDPIAAAKESQVIYTDVWASMGQEASAEERIP 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           +F+P+QVN  L+  A P A+ +HCLPAHRGEE+ N+V++G +S V+D+AENRLH QKA+L
Sbjct: 240 IFEPYQVNQQLLDHADPSAIVLHCLPAHRGEEITNQVIEGSRSRVWDQAENRLHAQKALL 299

Query: 300 LWCFGI 305
           +   G+
Sbjct: 300 VSLLGV 305


>gi|302876836|ref|YP_003845469.1| ornithine carbamoyltransferase [Clostridium cellulovorans 743B]
 gi|307687521|ref|ZP_07629967.1| ornithine carbamoyltransferase [Clostridium cellulovorans 743B]
 gi|302579693|gb|ADL53705.1| ornithine carbamoyltransferase [Clostridium cellulovorans 743B]
          Length = 309

 Score =  213 bits (541), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 133/304 (43%), Positives = 200/304 (65%), Gaps = 5/304 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             KH   + +++  ++  +I++ + +K   +N   +K L GK L MIFEK STRTRVSFE
Sbjct: 1   MNKHLTSMIDLTKEDILDLIQLGEDLKFKRKNNIPHKYLEGKTLGMIFEKASTRTRVSFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
             +  LGG   FLS +++Q+GR E I DTA+VLSRY+D I++RT     + EL +Y++VP
Sbjct: 61  TGIFQLGGVGEFLSSNDLQIGRGEPIKDTARVLSRYLDIIMIRTFKDEVVKELAQYSSVP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINALTDN HPCQ++AD+MT +E++G ++G   ++ GDGNN+++S + G +     ++IA
Sbjct: 121 VINALTDNEHPCQVLADLMTIKEYKGQLQGLKVAFIGDGNNMVNSYLIGCSIMGMDISIA 180

Query: 184 TPIGSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREE 238
           +P G +P + Y+     +A+  G+ + + +  + A K A  V TD W SM QE + A   
Sbjct: 181 SPEGYKPNDFYVEKAKEYAKATGSKIEISNSPIAATKDADVVVTDVWASMGQESEAAERI 240

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F+ FQVN+ L+S A  DA+ +HCLPAHR EE+ +EVL+   + +FDEAENRLH QKAI
Sbjct: 241 KAFKGFQVNMELLSYAKKDAMVLHCLPAHREEEITDEVLEAHANEIFDEAENRLHIQKAI 300

Query: 299 LLWC 302
           ++  
Sbjct: 301 MVKL 304


>gi|167758618|ref|ZP_02430745.1| hypothetical protein CLOSCI_00958 [Clostridium scindens ATCC 35704]
 gi|167663814|gb|EDS07944.1| hypothetical protein CLOSCI_00958 [Clostridium scindens ATCC 35704]
          Length = 697

 Score =  213 bits (541), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 109/328 (33%), Positives = 167/328 (50%), Gaps = 24/328 (7%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M    ++F  L + +   ++ ++++A  +K   +N        G  +A+IFEK STRTR 
Sbjct: 368 MDLKGRNFLTLKDFTPEEITYLLDLAADLKEKKKNGVLVDHYRGMNVALIFEKTSTRTRC 427

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFE+A   +G  T +L  S  Q+G+ E+I DTA+VL R  D I  R      +  L +YA
Sbjct: 428 SFEIAAHDMGMGTTYLDPSGSQIGKKESIEDTARVLGRMFDGIEYRGYGQGIVEALAKYA 487

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
            VPV N LT+  HP Q++AD++T  EH G ++G    + GD    + + +  A     + 
Sbjct: 488 GVPVWNGLTNEYHPTQMLADLLTIREHFGRLEGIKLVYMGDARYNMGNSLMIACAKMGMH 547

Query: 181 NIATPIGSEPRNE-----YLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA 235
            +A    +   NE        +AR  G +V L  D  +  K A  ++TD W+SM +  + 
Sbjct: 548 FVACTTKAYFPNEELVETCKGYARESGGTVTLTEDVDEGTKNADVIYTDVWVSMGEPDEV 607

Query: 236 REEHVFQ--PFQVNLSLMSMAHPDALFMHCLPAHR-----------------GEEVINEV 276
            EE + +  P++V   +M  A  DA+F+HCLPA                     EV +EV
Sbjct: 608 WEERIRELSPYKVTKKVMENAGEDAIFLHCLPAFHDLKTRIGKEIEEKYGISDMEVTDEV 667

Query: 277 LDGPQSVVFDEAENRLHTQKAILLWCFG 304
            +  QS VFDEAENR+HT KA+++   G
Sbjct: 668 FESAQSKVFDEAENRMHTIKAVMVATLG 695


>gi|46579509|ref|YP_010317.1| ornithine carbamoyltransferase [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120602942|ref|YP_967342.1| ornithine carbamoyltransferase [Desulfovibrio vulgaris DP4]
 gi|56404382|sp|Q72D35|OTC_DESVH RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|189036323|sp|A1VEP9|OTC_DESVV RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|46448923|gb|AAS95576.1| ornithine carbamoyltransferase [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120563171|gb|ABM28915.1| ornithine carbamoyltransferase [Desulfovibrio vulgaris DP4]
 gi|311233323|gb|ADP86177.1| ornithine carbamoyltransferase [Desulfovibrio vulgaris RCH1]
          Length = 300

 Score =  213 bits (541), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 141/301 (46%), Positives = 198/301 (65%), Gaps = 4/301 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
            PKHF  + ++       ++E AK++K++       + L GKV  +IFEK STRTR+SFE
Sbjct: 1   MPKHFTRIRDLGFEGAWKVLERAKEMKDTGYRG---RTLEGKVATLIFEKASTRTRISFE 57

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VA++HLGG TIF++ +E QLGR+E + DTA+V+SRY D +++RT   +++ EL  + ++P
Sbjct: 58  VAVRHLGGTTIFMTPAESQLGRSEPLRDTARVISRYTDCMIVRTFGQAKIDELASFGSIP 117

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           V+NALTD  HPCQ+++D++T  E    +     +W GDGNN+ +S IE A  F + L +A
Sbjct: 118 VVNALTDEGHPCQVMSDVLTMYERTPDLSQVRVAWIGDGNNMANSWIEAAMYFPFELFMA 177

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV-FQ 242
            P G EP  + L  A   GA + L  D   A+ GAH V TD W SM QE + +     F+
Sbjct: 178 FPEGYEPDRQLLGLALEAGAKIFLTRDPHMAIDGAHYVNTDVWASMGQEEEQKRREAAFK 237

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            F ++ +LM  AHPDA FMHCLPAHRGEEV +EV++ P S+V+D+AENRLH QKAIL W 
Sbjct: 238 GFCIDGALMGRAHPDAKFMHCLPAHRGEEVTDEVMESPASIVWDQAENRLHMQKAILEWV 297

Query: 303 F 303
           F
Sbjct: 298 F 298


>gi|257486617|ref|ZP_05640658.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|289624949|ref|ZP_06457903.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. aesculi
           str. NCPPB3681]
 gi|289650474|ref|ZP_06481817.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. aesculi
           str. 2250]
 gi|298488728|ref|ZP_07006757.1| Ornithine carbamoyltransferase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298156801|gb|EFH97892.1| Ornithine carbamoyltransferase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|330867239|gb|EGH01948.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. aesculi
           str. 0893_23]
 gi|330989522|gb|EGH87625.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. lachrymans
           str. M301315]
 gi|331010099|gb|EGH90155.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 306

 Score =  213 bits (541), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 147/298 (49%), Positives = 194/298 (65%), Gaps = 4/298 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  + + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSMMDYTPDELLGLIRRGVELKDLRNRGELFEPLKNRVLGMIFEKSSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I D+AKV+SR +DA+++RT  HS L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSHRDTQLGRGEPIADSAKVMSRMLDAVMIRTYAHSNLTEFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS+KGK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFLEHRGSIKGKTVAWIGDGNNMCNSYIEAAIQFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP  E+L  A   G  V +  D   AV GAH V TD W SM QE + AR   +F PF
Sbjct: 184 AGYEPNPEFLALA---GERVTIVRDPKAAVAGAHLVSTDVWTSMGQEEETARRMALFAPF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           QV  +L+ +A  D LFMHCLPAHRGEE+  ++LD  +SV +D+AENRLH QKA+L + 
Sbjct: 241 QVTRALLDLADKDVLFMHCLPAHRGEEISVDLLDDSRSVAWDQAENRLHAQKALLEFL 298


>gi|330504581|ref|YP_004381450.1| ornithine carbamoyltransferase [Pseudomonas mendocina NK-01]
 gi|328918867|gb|AEB59698.1| ornithine carbamoyltransferase [Pseudomonas mendocina NK-01]
          Length = 306

 Score =  213 bits (541), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 143/298 (47%), Positives = 193/298 (64%), Gaps = 4/298 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  + + +   L  +I  A ++K+        +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSMMDYTPDELVGLIRRAIELKDLRNRGVLFEPLKNRVLGMIFEKASTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E IGD A V+S  +DA+++RT  HS L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSPRDTQLGRGEPIGDAAIVMSSMLDAVMIRTFAHSNLTEFAAKSKVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS+ GK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFLEHRGSIAGKTVAWIGDGNNMCNSYIEAAIQFDFQLKVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHVFQPF 244
            G EP   +L  A ++   +    D  +AV GAH V TD W SM QE +A +   +F+P+
Sbjct: 184 EGYEPDARFLALAGDRVQVLR---DPREAVAGAHLVSTDVWASMGQEDEAEQRMALFRPY 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           QV  +L+  A PD LFMHCLPAHRGEE+  ++LD P+SV +D+AENRLH QKA+L   
Sbjct: 241 QVTPTLLDNAAPDVLFMHCLPAHRGEEISIDMLDDPRSVAWDQAENRLHAQKALLELL 298


>gi|126659743|ref|ZP_01730871.1| ornithine carbamoyltransferase [Cyanothece sp. CCY0110]
 gi|126618991|gb|EAZ89732.1| ornithine carbamoyltransferase [Cyanothece sp. CCY0110]
          Length = 305

 Score =  212 bits (540), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 122/310 (39%), Positives = 186/310 (60%), Gaps = 11/310 (3%)

Query: 2   MTY--PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           MT    +    + ++S+  ++ ++++   +K+   +         K+L ++F+K STRTR
Sbjct: 1   MTTLQGRDILGIGDLSAEEMTQVLDLGAALKSGQRSPRCQ-----KILGLLFDKASTRTR 55

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF  A+  LGG  + L+ S  Q+GR E   DTA+VL RY+D + +RT   S+L    EY
Sbjct: 56  VSFSAAIYQLGGQVLDLNPSVTQVGRGEPTKDTARVLDRYLDILAIRTFEQSKLEIFAEY 115

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           A +P+INALTD  HPCQI+AD MT +E  G + G   ++ GDGNN+ HSLI G A     
Sbjct: 116 AEIPIINALTDLEHPCQILADFMTIKECFGQLAGSTVTYLGDGNNVAHSLILGGALMGMK 175

Query: 180 LNIATPIGSEPRNEYLNWARN---QGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KA 235
           + +ATP   +P    +  A+     G  + +  D + AVK ++ ++TD W SM QE    
Sbjct: 176 IRVATPKDYQPLPMIIEQAKQLAKPGFEITITDDPIAAVKDSNVLYTDVWASMGQENLAE 235

Query: 236 REEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
               +FQ +Q+N  L++ A  DA+ +HCLPAHRGEE+ + V++G QS V+D+AENR+H Q
Sbjct: 236 SRIPIFQSYQINDELLNQADKDAIVLHCLPAHRGEEITDSVIEGKQSKVWDQAENRMHAQ 295

Query: 296 KAILLWCFGI 305
           KA+++   GI
Sbjct: 296 KALMVSLLGI 305


>gi|313897852|ref|ZP_07831393.1| ornithine carbamoyltransferase [Clostridium sp. HGF2]
 gi|312957387|gb|EFR39014.1| ornithine carbamoyltransferase [Clostridium sp. HGF2]
          Length = 302

 Score =  212 bits (540), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 115/300 (38%), Positives = 165/300 (55%), Gaps = 1/300 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH   L++++   L  ++++A  +K   +       L  K L MIF K STRTRVSFE 
Sbjct: 1   MKHLLTLADLTKEELYDLLDLADSLKKEVKKGVFTPYLRNKTLGMIFTKSSTRTRVSFET 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG  ++L+ ++MQLGR E I DTA+VLSRY+D I++RT  HS + EL EY ++P+
Sbjct: 61  GMAQLGGTALYLNANDMQLGRGEPIKDTARVLSRYLDGIMIRTYKHSDVEELAEYGSIPI 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD  HPCQ++AD+ T  EH+G++ G    + G GNN+ +SLI G       +  A 
Sbjct: 121 INGLTDYVHPCQVLADLQTIREHKGTLTGLKMCFIGAGNNMANSLINGGILAGMEVACAC 180

Query: 185 PIGSEPRNEYLNWARNQGASV-ALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQP 243
           P+   P  E    A+  G                         +   QE   R +     
Sbjct: 181 PLEYLPDEEITKRAQASGRFTLTQNVLEAAKDADVLVTDVWASMGEEQEAAQRRKIFEGI 240

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +Q+N + M++A  DA+ +HCLPAHR EE+  +V +     +FDEAENRLH QKA+L+   
Sbjct: 241 YQINDACMAVAKADAMVLHCLPAHREEEITEKVFEAHADEIFDEAENRLHAQKAVLVTLL 300


>gi|302810596|ref|XP_002986989.1| hypothetical protein SELMODRAFT_158392 [Selaginella moellendorffii]
 gi|300145394|gb|EFJ12071.1| hypothetical protein SELMODRAFT_158392 [Selaginella moellendorffii]
          Length = 355

 Score =  212 bits (540), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 132/305 (43%), Positives = 184/305 (60%), Gaps = 3/305 (0%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFEN-KPLSGKVLAMIFEKPSTRTRVS 61
           + P HF  + +     +  ++E A ++K   ++   + +P +GK +AMIF KPS RTRVS
Sbjct: 50  SKPLHFLHVDDFDKKEILHLLERAVEVKALLKSGDRSFRPFNGKSMAMIFTKPSMRTRVS 109

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE     LGG  I+L   ++Q+G+ E   D A+VLS Y D I+ R   H  LL+L +YA+
Sbjct: 110 FETGFFLLGGHAIYLGPDDIQIGKREETRDVARVLSGYNDVIMARLFAHQDLLDLAKYAS 169

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           +PVIN LTD  HPCQI+AD +T  EH G ++G    + GDGNNI+HS +  AA   +   
Sbjct: 170 IPVINGLTDYNHPCQIMADALTIIEHVGRIEGVKVVYVGDGNNIVHSWLRLAAVVPFHFV 229

Query: 182 IATPIGSEPRNEYLNWARNQG-ASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEH 239
            A P G EP  E +N A   G + + + +D ++AVKGAH V++D W SM Q+ + A    
Sbjct: 230 CACPRGFEPDKETVNRATAAGLSKIEITNDPLEAVKGAHVVYSDVWASMGQKDQTAARLE 289

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            FQ FQVN  LM  A   A FMHCLPA R  +V + V++ P S+VF +AENR+H Q AI+
Sbjct: 290 RFQGFQVNEKLMEAAGSQAYFMHCLPAERDVDVTDAVIESPNSIVFTQAENRMHAQNAIM 349

Query: 300 LWCFG 304
           L   G
Sbjct: 350 LHVLG 354


>gi|325261216|ref|ZP_08127954.1| ornithine carbamoyltransferase [Clostridium sp. D5]
 gi|324032670|gb|EGB93947.1| ornithine carbamoyltransferase [Clostridium sp. D5]
          Length = 697

 Score =  212 bits (540), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 109/328 (33%), Positives = 168/328 (51%), Gaps = 24/328 (7%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M    ++F  L + +   ++ ++++A  +K   +N        GK +A+IFEK STRTR 
Sbjct: 368 MNLKGRNFLTLKDFTPEEITYLLDLAADLKEKKKNGVPVDYYKGKNVALIFEKTSTRTRC 427

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           +FEVA   +G  + +L  S  Q+G+ E+I DTA+VL R  D I  R      + EL +YA
Sbjct: 428 AFEVAAHDMGMGSTYLDPSGSQIGKKESIEDTARVLGRMYDGIEYRGFGQDIVEELAKYA 487

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
            VPV N LT+  HP Q++AD++T  EH G ++G    + GD    + + +  A     + 
Sbjct: 488 GVPVWNGLTNEYHPTQMLADLLTIREHFGRLEGIKLVYMGDARYNMGNSLMIACAKMGMH 547

Query: 181 NIATPIGSEPRNE-----YLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA 235
            +A        NE        +A   GA++ L  DA+   K A  ++TD W+SM +  + 
Sbjct: 548 FVACTTSRYFPNEELVETCRGYAAESGATITLTEDAMAGTKDADVIYTDVWVSMGEPDEV 607

Query: 236 REEHVFQ--PFQVNLSLMSMAHPDALFMHCLPAHR-----------------GEEVINEV 276
            EE + +  P++V   +M  A   A+F+HCLPA                     EV +EV
Sbjct: 608 WEERIKELSPYKVRKEIMDNAGEGAIFLHCLPAFHDLKTKIGKEMGARFGITDMEVTDEV 667

Query: 277 LDGPQSVVFDEAENRLHTQKAILLWCFG 304
            +  QS VFDEAENR+HT KA+++   G
Sbjct: 668 FESAQSKVFDEAENRMHTIKAVMVATLG 695


>gi|149913426|ref|ZP_01901959.1| ornithine carbamoyltransferase [Roseobacter sp. AzwK-3b]
 gi|149812546|gb|EDM72375.1| ornithine carbamoyltransferase [Roseobacter sp. AzwK-3b]
          Length = 308

 Score =  212 bits (540), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 156/306 (50%), Positives = 216/306 (70%), Gaps = 7/306 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-----PLSGKVLAMIFEKPSTRTR 59
            ++F D+       L  II+ AK +K++ ++          PL+G ++A+IFEKPSTRTR
Sbjct: 1   MENFLDIHKTDPEALRHIIDSAKAMKDARKDRPRGATDDELPLAGHMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
            SF+V ++ +GG T+ LSG++MQLG  ETI DTA+VLSRYVD I++RT + S LLE+ +Y
Sbjct: 61  TSFDVGVRQMGGQTMVLSGTDMQLGHGETIADTARVLSRYVDLIMIRTFDESVLLEMADY 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           A VPVIN LT+ THPCQI+ADIMT+EEHRG + G+   WSGDGNN+  SL+  A +F + 
Sbjct: 121 ADVPVINGLTNRTHPCQIMADIMTYEEHRGPIAGRKVVWSGDGNNVCASLLHAAGQFGFD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKARE 237
           +    P   +P + ++ +AR +G+++ +  D V+AV GA  V TDTW+SM+  Q  K R 
Sbjct: 181 VTFTGPAQLDPEDAFVGFARQKGSTIQIERDPVKAVSGADLVVTDTWVSMHDSQSTKERR 240

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
            ++ +P+QVN  LM+ A PDALFMHCLPAHR EEV ++V+DGP SV++DEAENRLH QKA
Sbjct: 241 HNMLRPYQVNEELMAHAKPDALFMHCLPAHREEEVTSQVMDGPHSVIWDEAENRLHAQKA 300

Query: 298 ILLWCF 303
           I+ WC 
Sbjct: 301 IMRWCL 306


>gi|226306767|ref|YP_002766727.1| ornithine carbamoyltransferase [Rhodococcus erythropolis PR4]
 gi|226185884|dbj|BAH33988.1| ornithine carbamoyltransferase [Rhodococcus erythropolis PR4]
          Length = 316

 Score =  212 bits (540), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 140/310 (45%), Positives = 195/310 (62%), Gaps = 10/310 (3%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTR 59
           M T  KHF    +++ +  + ++E+A  +K   ++ F  +PL G + + +IFEK STRTR
Sbjct: 1   MTTVVKHFLRDDDLTPAQQAEVLELAAILK---KDPFARRPLEGPRGVGVIFEKNSTRTR 57

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
            SFE+ +  +GG  + + G   QLGR ET+ DT +VLSRYVDA+V RT    RL ++   
Sbjct: 58  FSFEMGIAQMGGHAVVVDGRSTQLGREETLADTGRVLSRYVDAVVWRTFGQKRLEQMATG 117

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNY 178
           AT+P++NAL+D  HPCQ++AD+ T  E +G +KG   ++ GDG NN+ HSL+ G      
Sbjct: 118 ATIPIVNALSDEFHPCQVLADLQTLIEQKGELKGLKLTYLGDGANNMAHSLMLGGVTAGI 177

Query: 179 LLNIATPIGSEPRNEYLNWARNQGAS----VALFHDAVQAVKGAHCVFTDTWISMNQEFK 234
            + IA+P G EP +  +  AR + A     + L  D    V GA  + TDTW SM QE  
Sbjct: 178 DVTIASPAGFEPADWVVAAARTRAAETGATITLTQDPQAGVVGADALVTDTWTSMGQEND 237

Query: 235 A-REEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLH 293
                  F+PFQ+N  L++ A P A+ +HCLPAHRGEEV +EVLDGPQSVV+DEAENRLH
Sbjct: 238 GLDRVGPFRPFQINKELLAKADPKAVVLHCLPAHRGEEVTDEVLDGPQSVVWDEAENRLH 297

Query: 294 TQKAILLWCF 303
            QKA+L+W  
Sbjct: 298 AQKALLVWLL 307


>gi|75908416|ref|YP_322712.1| ornithine carbamoyltransferase [Anabaena variabilis ATCC 29413]
 gi|123609593|sp|Q3MB19|OTC_ANAVT RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|75702141|gb|ABA21817.1| ornithine carbamoyltransferase [Anabaena variabilis ATCC 29413]
          Length = 306

 Score =  212 bits (540), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 126/303 (41%), Positives = 185/303 (61%), Gaps = 9/303 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +    L++++ + L  ++++A ++K+    +        KVL ++F K STRTRVSF VA
Sbjct: 7   RDLLSLADLTPTELQELLQLATQLKSQQLKLR-----CNKVLGLLFSKASTRTRVSFTVA 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  I L+ +  Q+ R E + DTA+VL RY+D + +RT     L    EYA +PVI
Sbjct: 62  MYQLGGQVIDLNPNVTQVSRGEPVQDTARVLERYLDVLAIRTFEQQELATFAEYAKIPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD  HPCQI+AD++T +E   ++ G   ++ GDGNN+ +SL+ G A     + IATP
Sbjct: 122 NALTDLEHPCQILADLLTAQECFDTISGLTLTYVGDGNNVANSLMLGCALAGMNVRIATP 181

Query: 186 IGSEPRNEYLNWARNQGASVALF---HDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVF 241
            G EP  + +  A+            +D   A KGA  ++TD W SM QE +A     +F
Sbjct: 182 SGYEPNPQVVAQAQAIADGKTEILLTNDPELATKGASVLYTDVWASMGQEAEANDRFPIF 241

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q++  L+S+A P+A+ +HCLPAHRGEE+  EV++G QS V+ +AENRLH QKA+L  
Sbjct: 242 QPYQISEKLLSLAEPNAIVLHCLPAHRGEEITEEVIEGSQSRVWQQAENRLHVQKALLAS 301

Query: 302 CFG 304
             G
Sbjct: 302 ILG 304


>gi|3183094|sp|Q43814|OTC_PEA RecName: Full=Ornithine carbamoyltransferase, chloroplastic;
           AltName: Full=Ornithine transcarbamylase; Short=OTCase;
           Flags: Precursor
 gi|971168|gb|AAA74997.1| ornithine carbamoyltransferase [Pisum sativum]
          Length = 375

 Score =  212 bits (540), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 128/303 (42%), Positives = 181/303 (59%), Gaps = 3/303 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFEN-KPLSGKVLAMIFEKPSTRTRVSFEV 64
           K F  + +     +  I++ A ++K   ++     +P  GK ++MIF KPS RTRVSFE 
Sbjct: 73  KDFIHIDDFDKETILKILDRAIEVKTLLKSGDRTFRPFEGKTMSMIFAKPSMRTRVSFET 132

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
               LGG  I+L  +++Q+G+ E   D A+VLSRY D I+ R  +H  +L+L +YA+VPV
Sbjct: 133 GFSLLGGHAIYLGPNDIQMGKREETRDVARVLSRYNDIIMARVFSHQDILDLAKYASVPV 192

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD  HP QI+AD +T  EH G  +G    + GDGNNI+HS +  AA   +    A 
Sbjct: 193 INGLTDYNHPVQIMADALTMIEHIGRFEGTKVVYVGDGNNIVHSWLLLAAVVPFHFVCAC 252

Query: 185 PIGSEPRNEYLNWARN-QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHVFQ 242
           P G EP  + +  AR    + + + HD  +AV+GA  V++D W SM Q+ +A      F+
Sbjct: 253 PKGFEPDAKTVEKARKAGISKIEISHDPKEAVRGADVVYSDVWASMGQKEEAAYRREAFK 312

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            FQV+ +LM  A   A FMHCLPA RG EV +EV++ P S+VF +AENR+H Q AI+L  
Sbjct: 313 GFQVDQNLMDAAGSKAFFMHCLPAERGVEVTDEVVEAPYSIVFPQAENRMHAQNAIMLHV 372

Query: 303 FGI 305
            G 
Sbjct: 373 LGK 375


>gi|169829533|ref|YP_001699691.1| ornithine carbamoyltransferase [Lysinibacillus sphaericus C3-41]
 gi|168994021|gb|ACA41561.1| Ornithine carbamoyltransferase [Lysinibacillus sphaericus C3-41]
          Length = 337

 Score =  212 bits (540), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 133/305 (43%), Positives = 190/305 (62%), Gaps = 5/305 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K    L + +S  +  +IE+A ++K  ++     + L GK L MIFEK STRTR+SFE
Sbjct: 32  KGKDLLTLLDYTSQEVKELIELATQLKMITKEGKCPRLLEGKTLGMIFEKHSTRTRISFE 91

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M  LGG ++F+   ++Q+GR E+I DTA VLS Y+D I++R  +H+ + EL E+A +P
Sbjct: 92  VGMNQLGGKSMFMHARDLQIGRGESIYDTAHVLSGYLDGIMIRANSHAMVKELAEHAAIP 151

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQ +AD+ T  E++G +KG   ++ GDGNN+ HSLI  +A     + +A
Sbjct: 152 VINGLTDIYHPCQALADLETIAENKGFLKGLKIAYVGDGNNVAHSLIVASAHVGMNVAVA 211

Query: 184 TPIGSEPRNEYLNWARNQGASV----ALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREE 238
           TP G E   E +  A+   A+      + HD V+AV  A  V+ D W SM QE + A+  
Sbjct: 212 TPAGYECDAEVIANAQAIAAANGSTIMVTHDPVEAVLQADVVYADVWTSMGQEEEAAKRL 271

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F  +Q+N  L++ A P+ +F+HCLPAHR EEV   V+DGP S +F++AENRLH QKA+
Sbjct: 272 QDFADYQINDELVAYAKPNYMFLHCLPAHREEEVATSVIDGPNSYIFEQAENRLHAQKAV 331

Query: 299 LLWCF 303
           L    
Sbjct: 332 LASIL 336


>gi|291541921|emb|CBL15031.1| ornithine carbamoyltransferase [Ruminococcus bromii L2-63]
          Length = 309

 Score =  212 bits (540), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 126/301 (41%), Positives = 184/301 (61%), Gaps = 2/301 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH   L + S+  +   + +A ++K   ++  E+K L GK L MIFEK STRTRVSFEV
Sbjct: 1   MKHLLKLEDWSTEEIINTLNLADQLKYEQKHGIEHKILKGKSLGMIFEKSSTRTRVSFEV 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG  +FLS +++Q+GR E + DTA+VLSR++D I++RT     +  L EY ++P+
Sbjct: 61  GMTQLGGYPLFLSSNDLQIGRGEPVEDTARVLSRFLDGIMIRTFEQKEVEALAEYGSIPI 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD  HPCQ++AD+MT  E +G ++G    + GDGNN+++SLI GA       + A 
Sbjct: 121 INGLTDYCHPCQVLADLMTIREFKGKLEGLKMCFIGDGNNMMNSLIVGALSTGMSFSAAC 180

Query: 185 PIGSEPRNEYLNWARNQ-GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQ 242
           P    P    + +          +  D ++A K A  V+TD W SM QE + +  E  F 
Sbjct: 181 PKDYMPPKHIIEFGEKYGNGKFEIVTDPLEAAKNADIVYTDVWASMGQEEEKKIREAAFA 240

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            +QVN  LM++ + D + +HCLPAHRGEE+  +V +   + +F+EAENRLH QKA+L+ C
Sbjct: 241 GYQVNKELMAVTNKDCMVLHCLPAHRGEEITADVFEEHANEIFEEAENRLHAQKAVLVEC 300

Query: 303 F 303
            
Sbjct: 301 M 301


>gi|85703319|ref|ZP_01034423.1| ornithine carbamoyltransferase [Roseovarius sp. 217]
 gi|85672247|gb|EAQ27104.1| ornithine carbamoyltransferase [Roseovarius sp. 217]
          Length = 291

 Score =  212 bits (540), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 155/291 (53%), Positives = 214/291 (73%), Gaps = 7/291 (2%)

Query: 22  IIEVAKKIKNSSENI-----FENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFL 76
           +I+ A+ +K +  +       + +PL+G+++A+IFEKPSTRTRVSF+V ++ +GG T+ L
Sbjct: 1   MIDQARSMKEARADRPRGTPDDEQPLAGRMVALIFEKPSTRTRVSFDVGVRQMGGQTLVL 60

Query: 77  SGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQ 136
           SG++MQLG  ETI DTA+V+SRYVD I++RT + S LLE+ E+A VPVIN LTD THPCQ
Sbjct: 61  SGADMQLGHGETIADTARVMSRYVDLIMIRTFDESVLLEMAEHADVPVINGLTDRTHPCQ 120

Query: 137 IIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLN 196
           I+ADI+T+EEHRG ++GK   WSGDGNN+  SL+  A +F + L    P+  +P  E++ 
Sbjct: 121 IMADILTYEEHRGPIQGKKVVWSGDGNNVCASLLHAAGQFGFDLTFTGPMQLDPEPEFIG 180

Query: 197 WARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKAREEHVFQPFQVNLSLMSMA 254
            AR  G+++ +  D  +AV GA  V TDTW+SM+  Q  K R  ++ +P+QVN  LM+ A
Sbjct: 181 LARKAGSTITIERDPFKAVDGADLVVTDTWVSMHDSQSMKERRHNMLRPYQVNDKLMAAA 240

Query: 255 HPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGI 305
            PDALFMHCLPAHRGEEV ++V+DGP SV+FDEAENRLH QKA++ WC G+
Sbjct: 241 KPDALFMHCLPAHRGEEVTSDVMDGPTSVIFDEAENRLHAQKAVMRWCLGV 291


>gi|303243630|ref|ZP_07329971.1| ornithine carbamoyltransferase [Methanothermococcus okinawensis
           IH1]
 gi|302485872|gb|EFL48795.1| ornithine carbamoyltransferase [Methanothermococcus okinawensis
           IH1]
          Length = 317

 Score =  212 bits (540), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 131/304 (43%), Positives = 189/304 (62%), Gaps = 10/304 (3%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAM 66
           H   L ++  +++  II+ A   K + +       L  K +A+IFE PSTRTR+SF++A+
Sbjct: 14  HLLTLGDLERNDVENIIKDAIYFKQNRK---TMDILKDKNIALIFESPSTRTRISFDIAV 70

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
             LGG ++ L+  E  LG+ E+I DTA+V+SRYVD IV R  NH  L EL +Y  VPVIN
Sbjct: 71  NELGGHSLMLNTGETHLGKKESIKDTARVMSRYVDGIVARVKNHKTLEELAKYGNVPVIN 130

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI 186
           AL++  HPCQI+ADI+T +EH+  +KG   S+ GDGNN+ +SL+ G A     +  ATP 
Sbjct: 131 ALSNLAHPCQILADILTIKEHKNKLKGLKLSYFGDGNNVCNSLLIGGALLGMDVYAATPK 190

Query: 187 GSEPRNEYLNWARNQGASV-----ALFHDAVQAVKGAHCVFTDTWISMNQEFKARE--EH 239
           G EP   ++  A             L +D  +  + A  ++TD WISM+ + K  +    
Sbjct: 191 GYEPNAMFVKKALEIVDKYGEGSITLTNDPKEGAEDADVLYTDVWISMSDKNKDLDEVNK 250

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           +F P+Q+N  L+S A  +A+ MHCLPA+RG E+ ++V+DG QSVV+DEAENRLH QKA+ 
Sbjct: 251 IFPPYQINEKLLSYAKNNAIVMHCLPANRGMEITDDVIDGKQSVVYDEAENRLHAQKAVF 310

Query: 300 LWCF 303
            + F
Sbjct: 311 KYIF 314


>gi|152990110|ref|YP_001355832.1| ornithine carbamoyltransferase [Nitratiruptor sp. SB155-2]
 gi|189036335|sp|A6Q1W6|OTC_NITSB RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|151421971|dbj|BAF69475.1| ornithine carbamoyltransferase [Nitratiruptor sp. SB155-2]
          Length = 309

 Score =  212 bits (540), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 131/303 (43%), Positives = 183/303 (60%), Gaps = 6/303 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            +HF  L + +   +  +IE+A+ IK  ++       +  K LAMIFEK STRTRVSFEV
Sbjct: 1   MRHFLTLKDFTKEEILEMIELARSIKAQTKRREFVPYMENKTLAMIFEKSSTRTRVSFEV 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG  +FLS +++QLGR E + DTA+V+SR  D +++RT   S+L E   ++ VPV
Sbjct: 61  GIYQLGGIGLFLSKNDIQLGRGEPMKDTARVVSRICDMVMIRTYEQSKLEEFAAFSQVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LT+  HP Q++AD +T     G     + ++ GDGNN+ HS +  A++  + L IAT
Sbjct: 121 INGLTNEYHPVQLMADYLTMI-EYGKADSPVVAYVGDGNNMTHSWLMLASKLGFTLRIAT 179

Query: 185 PIGSEPRNEYLNWARNQGA----SVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEH 239
           P G EP    +  A         ++ L HD   AV+ A  V TDTWISM QE +  +   
Sbjct: 180 PKGYEPDPNIVEDAMRFAKESGATIELMHDPKAAVQDADVVTTDTWISMGQEEEKEKRIK 239

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ FQV+  LMS+A  DA+F+HCLPA+RG EV  EV +     +FDEAENRLH QK I+
Sbjct: 240 DFKGFQVDTILMSLAKKDAIFLHCLPAYRGYEVSEEVFEAHAEEIFDEAENRLHAQKGIM 299

Query: 300 LWC 302
           +W 
Sbjct: 300 VWL 302


>gi|257060900|ref|YP_003138788.1| ornithine carbamoyltransferase [Cyanothece sp. PCC 8802]
 gi|256591066|gb|ACV01953.1| ornithine carbamoyltransferase [Cyanothece sp. PCC 8802]
          Length = 309

 Score =  212 bits (539), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 130/312 (41%), Positives = 197/312 (63%), Gaps = 13/312 (4%)

Query: 2   MTYP----KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTR 57
           M+      +    ++++S+S L+ I+++   +K+   +     P+  KVL ++F K STR
Sbjct: 1   MSMNTLKGRDILGIADLSASELTEILKLGALLKSGERS-----PVCQKVLGLLFSKASTR 55

Query: 58  TRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELT 117
           TRVSF VAM  LGG  I L+ S  Q+GR E + DTA+VL RY+D + +RT     L    
Sbjct: 56  TRVSFSVAMYQLGGQVIDLNPSVTQVGRGEPLIDTARVLDRYLDILAIRTYQQEDLETFA 115

Query: 118 EYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFN 177
           +YA +P+INALTD  HPCQI+AD+MT +E  G++ G   ++ GDGNN+ HSLI G A   
Sbjct: 116 KYAKIPIINALTDWEHPCQILADLMTIKECFGTLSGITVTYLGDGNNVAHSLILGGALMG 175

Query: 178 YLLNIATPIGSEPRNEYLNWARNQG---ASVALFHDAVQAVKGAHCVFTDTWISMNQEFK 234
             ++IATP   +P    L+ A+  G     V +  + ++AV+G+  ++TD W SM QE  
Sbjct: 176 MNVHIATPKDYQPNQAILDKAKEIGVEGFQVLVTDNPIEAVEGSQVLYTDVWASMGQESS 235

Query: 235 AR-EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLH 293
           A     +F+P+QVN  L++ A  +A+ +HCLPAHRGEE+ +EV++G QS V+D+AENR+H
Sbjct: 236 AEARIPLFEPYQVNQKLLNHADQEAIVLHCLPAHRGEEITDEVIEGKQSRVWDQAENRMH 295

Query: 294 TQKAILLWCFGI 305
            QKA+++   G+
Sbjct: 296 AQKALMVSLLGV 307


>gi|258405851|ref|YP_003198593.1| ornithine carbamoyltransferase [Desulfohalobium retbaense DSM 5692]
 gi|257798078|gb|ACV69015.1| ornithine carbamoyltransferase [Desulfohalobium retbaense DSM 5692]
          Length = 304

 Score =  212 bits (539), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 132/301 (43%), Positives = 193/301 (64%), Gaps = 4/301 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             +HF  + +I    +  +I+ A+++K       ++  L+GK + ++FEK STRTR+SFE
Sbjct: 1   MSRHFLRILDIPQQEMLPLIQRAQQLKAVRA---QSHLLAGKTILLVFEKASTRTRLSFE 57

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           +A++ LGG TIF++  E QLGR+E + D+A+V SRYV  +V+RT    +L EL EY  +P
Sbjct: 58  MAVRELGGSTIFMTPMESQLGRSEPLKDSARVFSRYVHGLVVRTFGQEKLEELVEYGAIP 117

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           V+NALTD+ HPCQ+++D++T  E   ++K ++ +W GDGNN+ HS I  AA+  + L +A
Sbjct: 118 VVNALTDSYHPCQVMSDLLTMYERTPALKDQVVAWIGDGNNMAHSWINAAAQVGFHLQMA 177

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREEHVFQ 242
            P G EP    L  AR  GA ++L  D  +AV GA  V TD W SM ++         F 
Sbjct: 178 VPAGYEPDAGLLEQARAAGARISLSQDPREAVTGADYVNTDVWASMGDEAEAEERARAFA 237

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            + V+  L+ +A+P    MHCLPAHRGEE+   V++GP S+V+D+AENRLH QKAIL W 
Sbjct: 238 GYLVDEELLRLANPGVKVMHCLPAHRGEEISEAVMEGPASIVWDQAENRLHMQKAILEWV 297

Query: 303 F 303
           F
Sbjct: 298 F 298


>gi|92114252|ref|YP_574180.1| ornithine carbamoyltransferase [Chromohalobacter salexigens DSM
           3043]
 gi|122419725|sp|Q1QVM7|OTC_CHRSD RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|91797342|gb|ABE59481.1| ornithine carbamoyltransferase [Chromohalobacter salexigens DSM
           3043]
          Length = 305

 Score =  212 bits (539), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 146/304 (48%), Positives = 191/304 (62%), Gaps = 6/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFEN-KPLSGKVLAMIFEKPSTRTRVSFEV 64
           +HF  L +++   LS +I+ A  IKN  +       P S + LAM FEK STRTRVSFE 
Sbjct: 4   RHFLTLLDLTPEELSHLIQRAITIKNRLKAQGPTYTPFSNRTLAMFFEKSSTRTRVSFET 63

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           AM H GG  +FLS  + QLGR E IGDTA+VL+  VD +++RT +H+ L E    + VPV
Sbjct: 64  AMAHFGGHALFLSPRDTQLGRGEPIGDTARVLAEMVDIVMIRTFSHAGLEEYAAASAVPV 123

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALTD+ HPCQ++AD+MT+ E RGSVKGK   W GDGNN+ HS I  A +F++ L +  
Sbjct: 124 INALTDDYHPCQLLADVMTWTECRGSVKGKTAVWIGDGNNMCHSWINAARQFDFRLRVCC 183

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQP 243
           P G EP  + +  A  +     + HD  QAV+GA  V TD W SM QE + AR E  F  
Sbjct: 184 PPGYEPDADIVAAAGERV---EILHDPRQAVQGADLVTTDVWASMGQEEEQARRERDFAG 240

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL-WC 302
           FQV   L+  A  + LF+HCLPAHRGEE+   +LD P++ V+ EA NRLH QKA++    
Sbjct: 241 FQVTEKLLDHAADNVLFLHCLPAHRGEEISTTLLDDPRAAVWQEAGNRLHAQKALIEFLL 300

Query: 303 FGII 306
            G +
Sbjct: 301 LGKV 304


>gi|260577984|ref|ZP_05845908.1| ornithine carbamoyltransferase [Corynebacterium jeikeium ATCC
           43734]
 gi|258603874|gb|EEW17127.1| ornithine carbamoyltransferase [Corynebacterium jeikeium ATCC
           43734]
          Length = 313

 Score =  212 bits (539), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 113/300 (37%), Positives = 173/300 (57%), Gaps = 2/300 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +H     +++    + ++ +A+++K++         L  + +A++F+K STRTR SF+  
Sbjct: 13  RHMLADDDLTPEEQAEVLALAEELKDNRYGNGYRNLLERRSVAVLFDKTSTRTRFSFDAG 72

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           +  LGG+ I +     Q+G+ ET  DT  VLSRYV AIV RT  H  L ++ E A VP++
Sbjct: 73  ITELGGNAIVVDSGSSQMGKGETFQDTGAVLSRYVTAIVWRTGAHDNLHQMAETAGVPIV 132

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLNIAT 184
           N+L+D+ HPCQI+AD++T +EH+G +KG    + GDG NN+ +S + G A     + IA 
Sbjct: 133 NSLSDDFHPCQILADLVTIKEHKGELKGLNAVYFGDGANNMANSYMLGFATAGVNITIAA 192

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWIS-MNQEFKAREEHVFQP 243
           P G +P  +++  A+ +             V         T       +  + +    + 
Sbjct: 193 PEGFQPEAKFVERAQQRAELTGATVTVTDKVDATGADVVITDTWLSMGQDASEDRSALRA 252

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           +QV+  LM  A  DA+F+HCLPA+RG EV  EV+DGPQSVVFDEAENRLH QKA+L+W  
Sbjct: 253 YQVDEKLMGTAKDDAIFLHCLPAYRGNEVTPEVIDGPQSVVFDEAENRLHAQKALLVWLL 312


>gi|298527842|ref|ZP_07015246.1| ornithine carbamoyltransferase [Desulfonatronospira thiodismutans
           ASO3-1]
 gi|298511494|gb|EFI35396.1| ornithine carbamoyltransferase [Desulfonatronospira thiodismutans
           ASO3-1]
          Length = 299

 Score =  212 bits (539), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 134/302 (44%), Positives = 197/302 (65%), Gaps = 4/302 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K F  + +++      ++E A  +K      F +  L GK + +IFEK STRT+VSFE
Sbjct: 1   MKKDFLSIRDLTREEAHELVERAHWMKA---EDFRSNLLEGKTVILIFEKASTRTKVSFE 57

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V++ HLGG  +F++ +E QLGR+E + DTA+VLSRY   +V+RT    +L+EL  + +VP
Sbjct: 58  VSINHLGGHHVFMTPAESQLGRSEPLRDTARVLSRYAQGMVVRTFGQDKLVELARHGSVP 117

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINAL+D+ HPCQ+++D++T  E     +    +W GDGNN+ HS I  A  F + LNIA
Sbjct: 118 VINALSDDFHPCQVMSDLLTIFERTPEFEALNIAWVGDGNNMSHSWINAAVHFPFRLNIA 177

Query: 184 TPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQ 242
            P G EPR + L  A++ GA++   HD ++AV+ AH + TD W SM QE + +     F 
Sbjct: 178 VPRGFEPRADILQEAKDLGANINFTHDPLEAVREAHYINTDVWASMGQEEEKKSRADAFA 237

Query: 243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
            F+V+  ++  AHP+A  +HCLPAHRGEE+ + V++G +S+V+D+AENRLH QKAIL W 
Sbjct: 238 GFRVDDRILEAAHPEARVLHCLPAHRGEEITDAVMEGERSIVWDQAENRLHMQKAILEWI 297

Query: 303 FG 304
           +G
Sbjct: 298 YG 299


>gi|254436638|ref|ZP_05050132.1| ornithine carbamoyltransferase [Octadecabacter antarcticus 307]
 gi|198252084|gb|EDY76398.1| ornithine carbamoyltransferase [Octadecabacter antarcticus 307]
          Length = 301

 Score =  212 bits (539), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 139/305 (45%), Positives = 192/305 (62%), Gaps = 10/305 (3%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFE-----NKPLSGKVLAMIFEKPSTRTR 59
             HF D+   S ++L  II+ A  +K++   + +     ++PL+  ++A+IFEKPSTRTR
Sbjct: 1   MTHFLDIHTTSPADLRGIIDSAASMKSARAGLPKGTPDADQPLANHMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SF+V ++ +GG+T+ LSG +MQLG  ETI DTA+VLSRYVD I++RT     LLE+ EY
Sbjct: 61  ISFDVGVRQMGGETMVLSGKDMQLGHGETIADTARVLSRYVDLIMIRTFEEQTLLEMAEY 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           A+VPVIN LTD THPCQI+ADI+TFEEH G +KGK   WSGDGNN+  S    A +F++ 
Sbjct: 121 ASVPVINGLTDRTHPCQIMADILTFEEHSGPIKGKKVVWSGDGNNVFASFAHAAKQFDFD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           L    P   +        A +   +     +            T   +   Q  + R  +
Sbjct: 181 LVFTGPETLQ-----PEAALDGLYTTERNPNLAVQGADLVVTDTWVSMHDPQSARERRHN 235

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             + +QVN  LMS A PDALFMHCLPAHR +E  +EV+DG +SV++DEAENR+H QKA+L
Sbjct: 236 QLRGYQVNADLMSKAKPDALFMHCLPAHRDDEATSEVMDGLRSVIWDEAENRMHAQKAVL 295

Query: 300 LWCFG 304
            +C G
Sbjct: 296 RYCLG 300


>gi|291279238|ref|YP_003496073.1| aspartate carbamoyltransferase catalytic subunit [Deferribacter
           desulfuricans SSM1]
 gi|290753940|dbj|BAI80317.1| aspartate carbamoyltransferase, catalytic subunit [Deferribacter
           desulfuricans SSM1]
          Length = 309

 Score =  212 bits (539), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 79/307 (25%), Positives = 134/307 (43%), Gaps = 11/307 (3%)

Query: 2   MTYPK-HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKP-LSGKVLAMIFEKPSTRTR 59
           M++ K     L ++S   +  I+E A+K K  ++   +  P L GK +  +F +PSTRTR
Sbjct: 1   MSFTKTDLIGLKDLSKEEILFILETAEKFKEINQRDVKKVPTLKGKTIVNLFFEPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYV-DAIVMRTTNHSRLLELTE 118
            SFE+A K L  DTI  S S     + ET+ DT + +     D  V+R      +  + E
Sbjct: 61  TSFEIAGKRLSADTINFSSSSSSTTKGETLIDTVRNIESMNADIFVVRHAFSGSVKFIAE 120

Query: 119 YATVPVINA-LTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGD--GNNILHSLIEGAAR 175
                V+NA    N HP Q + D++T +EH+ + +G   +  GD   + +  S + G  +
Sbjct: 121 NTKANVVNAGDGTNEHPTQALLDLLTIKEHKKTFEGLNVAIIGDIEHSRVARSNLWGMPK 180

Query: 176 FNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA 235
               + +  P      +      +   +      D          +        +     
Sbjct: 181 LGITVRLFGPKTMLTEHFNEFNCKVCSSIEEAVDDV-----DVIMMLRIQRERQSNLLLP 235

Query: 236 REEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
                 + F +N  L+S+A  DA+ MH  P +RG E+ + + D  QSV+ D+ EN +  +
Sbjct: 236 SLREYSKFFGLNKILLSLAKKDAIIMHPGPINRGVELPSILADSKQSVILDQVENGVAVR 295

Query: 296 KAILLWC 302
            A+L   
Sbjct: 296 MAVLYLL 302


>gi|154505274|ref|ZP_02042012.1| hypothetical protein RUMGNA_02788 [Ruminococcus gnavus ATCC 29149]
 gi|153794472|gb|EDN76892.1| hypothetical protein RUMGNA_02788 [Ruminococcus gnavus ATCC 29149]
          Length = 697

 Score =  212 bits (539), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 107/328 (32%), Positives = 168/328 (51%), Gaps = 24/328 (7%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M    ++F  L + +   ++ ++++A  +K   +N        GK +A+IFEK STRTR 
Sbjct: 368 MNLKGRNFLTLKDFTPEEITYLLDLAADLKEKKKNGEPVDFYRGKNIALIFEKTSTRTRC 427

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           +FEVA   LG  + +L  +  Q+G+ E+I DTA+VL R  D I  R      + EL +YA
Sbjct: 428 AFEVAAHDLGMGSTYLDPTGSQIGKKESIEDTARVLGRMYDGIEYRGYGQEIVEELAKYA 487

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
            VPV N LT+  HP Q++AD++T  E+ G++KG    + GD    + + +        L 
Sbjct: 488 GVPVWNGLTNEYHPTQMLADMLTIRENFGTLKGLKLVYMGDARYNMGNSLMIVCAKLGLD 547

Query: 181 NIATPIGSEPRNE-----YLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA 235
            +A        NE        +A+  GA++ L  +  +  K A  ++TD W+SM +  + 
Sbjct: 548 FVACTTEKYFPNEELVETCRGYAKESGATITLTENVEEGTKDADVIYTDVWVSMGEPDEV 607

Query: 236 REEHVFQ--PFQVNLSLMSMAHPDALFMHCLPAHR-----------------GEEVINEV 276
            EE + +  P++V   +M+ A   A+F+HCLPA                     EV +EV
Sbjct: 608 WEERIRELSPYKVTKEVMANAKESAIFLHCLPAFHDLKTKIGKEMGERFGITDMEVTDEV 667

Query: 277 LDGPQSVVFDEAENRLHTQKAILLWCFG 304
            +  QS VFDEAENR+HT KA++    G
Sbjct: 668 FESAQSKVFDEAENRMHTIKAVMAATLG 695


>gi|229544084|ref|ZP_04433143.1| ornithine carbamoyltransferase [Bacillus coagulans 36D1]
 gi|229325223|gb|EEN90899.1| ornithine carbamoyltransferase [Bacillus coagulans 36D1]
          Length = 317

 Score =  212 bits (539), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 139/307 (45%), Positives = 184/307 (59%), Gaps = 6/307 (1%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           T  K F  +  +    L+ +++ A  +K + +   E   L GKVL MIFEK STRTRVSF
Sbjct: 7   TKKKDFLTIGALQEEELNDLLQEAAALKKAHKEGKETPYLKGKVLGMIFEKSSTRTRVSF 66

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E  M  LGG  +FLS  ++QLGR ETI DTAKVLSRYVD +++RT  H  +     +A V
Sbjct: 67  EAGMLQLGGHALFLSSRDIQLGRGETIHDTAKVLSRYVDCLMIRTFAHETIESFARHADV 126

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGD-GNNILHSLIEGAARFNYLLN 181
           PVIN LTD  HP Q++AD++T +E++G + G    + GD  NN+ HSL+EGAA+    ++
Sbjct: 127 PVINGLTDLHHPTQVLADLLTIQEYKGQLAGLKICYLGDGNNNMCHSLLEGAAKAGMHMS 186

Query: 182 IATPIGSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AR 236
           +A P G  P    L      A  +G  + +  +  + ++ A  V TD W SM QE +  +
Sbjct: 187 VAAPEGYLPNAGILAGAQKEAAKKGVCIEMGQNPEEMIRNADVVITDVWASMGQEDETKK 246

Query: 237 EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
                Q +QVN SL  +A  D LF+HCLPAHRGEEV   V+DGP S VFDEAENRLH  K
Sbjct: 247 RLEDLQDYQVNESLCKLAKKDFLFLHCLPAHRGEEVTEAVIDGPHSAVFDEAENRLHAHK 306

Query: 297 AILLWCF 303
           AIL    
Sbjct: 307 AILKKLL 313


>gi|323490997|ref|ZP_08096191.1| ornithine carbamoyltransferase (argf) [Planococcus donghaensis
           MPA1U2]
 gi|323395353|gb|EGA88205.1| ornithine carbamoyltransferase (argf) [Planococcus donghaensis
           MPA1U2]
          Length = 317

 Score =  212 bits (539), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 138/303 (45%), Positives = 194/303 (64%), Gaps = 7/303 (2%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAM 66
            F  L + S++ L  ++ +A ++K           L GKVL MIFEK STRTRVSFE  M
Sbjct: 15  DFLSLKDYSTTELMDLLNLAIELKKPENKNLP--LLKGKVLGMIFEKSSTRTRVSFEAGM 72

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
             LGG  +FLS  + QLGR ETI DT +VLS Y+D +++RT + S + EL +++++PVIN
Sbjct: 73  LQLGGHAMFLSSQDTQLGRGETIADTGRVLSGYLDGLMIRTYHQSTVQELADFSSIPVIN 132

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI 186
            LTD+ HPCQ++AD+MT  EH G++KGK  ++ GDGNN+ +SL+ GAA+    ++IA+P 
Sbjct: 133 GLTDDYHPCQVMADLMTMLEHFGTLKGKKMAYIGDGNNMANSLMIGAAKVGMDISIASPA 192

Query: 187 GSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHVF 241
              P    +      A   G+++ +     +AV G+  V+TD W SM QE +       F
Sbjct: 193 AYAPTPAMVALAKEIAHYTGSTIEITDSPEKAVTGSDAVYTDVWASMGQEQETIERLEHF 252

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           Q FQVN  L+  A+PD +FMHCLPAHR EEV   +L+GPQSV+F ++ENRLH QKA+L+ 
Sbjct: 253 QGFQVNEELIKYANPDFIFMHCLPAHREEEVTTAILEGPQSVIFQQSENRLHAQKAVLVA 312

Query: 302 CFG 304
             G
Sbjct: 313 LMG 315


>gi|6578122|gb|AAF17704.1|AF033561_1 ornithine carbamoyltransferase [Canavalia lineata]
 gi|15428286|gb|AAK97813.1|AF203387_1 ornithine carbamoyltransferase OOCT2 [Canavalia lineata]
          Length = 369

 Score =  212 bits (539), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 125/306 (40%), Positives = 191/306 (62%), Gaps = 3/306 (0%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFEN-KPLSGKVLAMIFEKPSTRTRVS 61
           T  K F  +++    ++  I++ A ++K   ++     +P  GK +AM+F KPS RT VS
Sbjct: 64  TEVKDFLHINDFDKKSIFKILDRAIEVKALIKSGDRAFQPFKGKTMAMVFCKPSLRTHVS 123

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE     LGG  ++L+ +++Q+G  E   D A++LSR+ D I+ R  +H  +L L++Y +
Sbjct: 124 FETGFTLLGGHAVYLAPTDIQMGTREETRDVARILSRFTDIIMARVFSHQDILVLSKYGS 183

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPV+N LTD  HPCQ++AD +T  EH G ++G   ++ GDGNN++HS +E A+       
Sbjct: 184 VPVVNGLTDYNHPCQVMADAITIIEHIGKLEGTKIAYVGDGNNVVHSWLEMASLVPIQFV 243

Query: 182 IATPIGSEPRNEYLNWARNQG-ASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-H 239
            A+P G EP  + +  A+  G + + + +D  +AVKGA  V+TD W SM Q+ +A     
Sbjct: 244 CASPKGFEPDKKTVEKAKQAGLSKIVITNDPKEAVKGADIVYTDVWASMGQKEEADRRLA 303

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ FQV+ SLM +A   ALFMHCLPA +G EV  +V++GP+S++FD+AENRLH Q AI+
Sbjct: 304 SFKGFQVDQSLMDLAGSKALFMHCLPAEKGTEVTEDVIEGPRSIIFDQAENRLHAQNAIM 363

Query: 300 LWCFGI 305
           L   G 
Sbjct: 364 LHVLGK 369


>gi|84488861|ref|YP_447093.1| ornithine carbamoyltransferase [Methanosphaera stadtmanae DSM 3091]
 gi|121697947|sp|Q2NI83|OTC_METST RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|84372180|gb|ABC56450.1| ArgF [Methanosphaera stadtmanae DSM 3091]
          Length = 302

 Score =  212 bits (539), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 127/304 (41%), Positives = 193/304 (63%), Gaps = 9/304 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            K+   +S+ + + ++ I+E+A  +K+        KPL+ K + MIFEK STRTRVSFEV
Sbjct: 1   MKNLLSMSD-AKNEVNAILEIASGLKSG---EITEKPLTNKYIGMIFEKSSTRTRVSFEV 56

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  LGG  ++LS  ++QL R E I DTA+VLSR++D I++R   H  + EL +Y+T+P+
Sbjct: 57  GIHQLGGTPLYLSSKDLQLNRGEPIEDTARVLSRFLDGIMIRAKKHENVEELVQYSTIPI 116

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           I+ LTD  HPCQI AD++T +E++G    K   + GDGNN+ +SL+  AA     + +A 
Sbjct: 117 ISGLTDKEHPCQIFADLLTIKEYKGDFNDKKIVFIGDGNNVCNSLLLAAAYVGMDMTVAC 176

Query: 185 PIGSEPRNEY----LNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEH 239
           P G EP  +        A+   +++ + ++  +AVK A  ++TD W+SM  E +    E 
Sbjct: 177 PEGYEPNEKIYTLAKQEAQKTNSTIKIENNVNEAVKDADVLYTDVWVSMGDEDEQDERER 236

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           +F+P+Q+N  L+S A  DA+ MHCLPA RG+E+  +V+  PQS ++D+AENRLH QKAIL
Sbjct: 237 IFKPYQINNELLSQAKDDAIVMHCLPAIRGQEITADVMVSPQSAIWDQAENRLHAQKAIL 296

Query: 300 LWCF 303
              F
Sbjct: 297 YHIF 300


>gi|291280007|ref|YP_003496842.1| ornithine carbamoyltransferase [Deferribacter desulfuricans SSM1]
 gi|290754709|dbj|BAI81086.1| ornithine carbamoyltransferase [Deferribacter desulfuricans SSM1]
          Length = 310

 Score =  212 bits (538), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 139/305 (45%), Positives = 193/305 (63%), Gaps = 5/305 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             + F  L++ S+  L  +IE A K+K   +N    K L  K +A+IFEK STRTRVSFE
Sbjct: 1   MKRDFLTLADFSTQELKEMIESAIKLKEERKNGIFRKYLENKKVALIFEKSSTRTRVSFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V +  +GG  +FLS +++QL R E+I DTA+ LSRYVD +++RT  H R+ E  ++A+VP
Sbjct: 61  VGVAEMGGYPLFLSRNDIQLARGESIRDTARTLSRYVDMVMIRTFEHERIEEFAKFASVP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LT+  HPCQ++ADIMT  E  G  +G   ++ GDGNN+ HSL+ G A+F   ++IA
Sbjct: 121 VINGLTNEFHPCQVMADIMTIYEKMGKYEGVKLAYVGDGNNMAHSLLIGCAKFGIDISIA 180

Query: 184 TPIGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REE 238
           TP   +   + +  A+      GA + + +D  +AVKGA  ++TD W SM  E +A   +
Sbjct: 181 TPEKYQCLQDVVEKAKTIAAETGAKIEITNDPFKAVKGADFIYTDVWASMGFEDEAEERK 240

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
            +F  +QVN +L+        FMHCLPAH GEEV  EV +   S+VFDEAENRLH QKAI
Sbjct: 241 KIFIDYQVNKNLLEATGKRTYFMHCLPAHLGEEVTEEVFESEISIVFDEAENRLHAQKAI 300

Query: 299 LLWCF 303
           + W F
Sbjct: 301 MKWLF 305


>gi|17232399|ref|NP_488947.1| ornithine carbamoyltransferase [Nostoc sp. PCC 7120]
 gi|32699465|sp|Q8YMM6|OTC_ANASP RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|17134045|dbj|BAB76606.1| ornithine carbamoyltransferase [Nostoc sp. PCC 7120]
          Length = 306

 Score =  212 bits (538), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 127/303 (41%), Positives = 185/303 (61%), Gaps = 9/303 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +    L++++ + L  ++++A ++K+    +        KVL ++F K STRTRVSF VA
Sbjct: 7   RDLLSLADLTPTELQELLQLATQLKSQQLKLR-----CNKVLGLLFSKASTRTRVSFTVA 61

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  I L+ +  Q+ R E + DTA+VL RY+D + +RT     L    EYA +PVI
Sbjct: 62  MYQLGGQVIDLNPNVTQVSRGEPVQDTARVLERYLDVLAIRTFEQQELATFAEYAKIPVI 121

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD  HPCQI+AD++T +E   S+ G   ++ GDGNN+ +SL+ G A     + IATP
Sbjct: 122 NALTDLEHPCQILADLLTVQECFDSISGLTLTYVGDGNNVANSLMLGCALAGMNVRIATP 181

Query: 186 IGSEPRNEYLNWARNQGASVALF---HDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVF 241
            G EP  + +  A+            +D   A KGA  ++TD W SM QE +A     +F
Sbjct: 182 SGYEPNPQVVAQAQAIADGKTEILLTNDPDLATKGASVLYTDVWASMGQEAEADDRFPIF 241

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           QP+Q++  L+S+A P+A+ +HCLPAHRGEE+  EV++G QS V+ +AENRLH QKA+L  
Sbjct: 242 QPYQISEQLLSLAEPNAIVLHCLPAHRGEEITEEVIEGSQSRVWQQAENRLHVQKALLAS 301

Query: 302 CFG 304
             G
Sbjct: 302 ILG 304


>gi|300787892|ref|YP_003768183.1| ornithine carbamoyltransferase [Amycolatopsis mediterranei U32]
 gi|299797406|gb|ADJ47781.1| ornithine carbamoyltransferase [Amycolatopsis mediterranei U32]
          Length = 308

 Score =  212 bits (538), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 134/306 (43%), Positives = 183/306 (59%), Gaps = 9/306 (2%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             +HF    ++S +    I+++A  +K        NK L+GK +  IFEK STRTR SFE
Sbjct: 1   MLRHFLRDDDVSPAEQKAILDLADALKADPLG---NKTLAGKSITAIFEKNSTRTRFSFE 57

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V +  LGG  + + G  MQLGR ETI DT++VLSRYVD IV RT    R+  +   A++P
Sbjct: 58  VGISQLGGHPVIVDGRSMQLGREETIEDTSRVLSRYVDGIVWRTFAQKRIETMASAASIP 117

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLNI 182
           V+NALTD  HPCQ++ D+MT  E +G + G    + GDG NN+ HSL+ G       + +
Sbjct: 118 VVNALTDEFHPCQVLTDLMTIRERKGELAGLTLVYLGDGANNMAHSLLLGGITAGMHVRV 177

Query: 183 ATPIGSEPRNEYLNWARNQGASV----ALFHDAVQAVKGAHCVFTDTWISMNQEFKA-RE 237
            +P+G +P  + +  A+ +G         F D  +AV GA  + TDTW SM QE      
Sbjct: 178 VSPLGFQPDQQVMVDAKKRGEETGGTATAFTDPYEAVSGADVLVTDTWTSMGQENDGLDR 237

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
              F+  QVN  L+  A  DA+ +HCLPAHRG E+ +EV+DGP S V+DEAENRLH QKA
Sbjct: 238 VGPFRALQVNAELLKKAADDAIVLHCLPAHRGWEITDEVIDGPASAVWDEAENRLHAQKA 297

Query: 298 ILLWCF 303
           +L+W F
Sbjct: 298 LLVWLF 303


>gi|89053514|ref|YP_508965.1| ornithine carbamoyltransferase [Jannaschia sp. CCS1]
 gi|88863063|gb|ABD53940.1| ornithine carbamoyltransferase [Jannaschia sp. CCS1]
          Length = 308

 Score =  212 bits (538), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 154/306 (50%), Positives = 202/306 (66%), Gaps = 7/306 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFE-----NKPLSGKVLAMIFEKPSTRTR 59
             +F D+     + L  I+  A  +K +     +     ++PL+G V+A+IFEKPSTRTR
Sbjct: 1   MPNFLDIHTTDPAALRDILAQAGNMKTARGTRPKGTPDDDQPLAGHVVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V ++ +GG T+ LSG+EMQLG  ETI DTA+VLSRYVD I++RT     L E+ E+
Sbjct: 61  VSFDVGVRQMGGSTLVLSGAEMQLGHGETIADTARVLSRYVDLIMIRTFGEDILHEMAEH 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           ATVPVIN LTDN+HPCQI+AD+MTFEEHRG +KGK  +W GDGNN+  S +  AA F + 
Sbjct: 121 ATVPVINGLTDNSHPCQIMADVMTFEEHRGPIKGKRVAWMGDGNNVAQSFLHAAASFGFD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
              + P   +PR++ +   R  G  V +  D  +AV  A  V TDTW+SM     +R+  
Sbjct: 181 FTFSGPAQLDPRDDLVGAVRKAGQDVRIERDPAKAVADADLVVTDTWVSMGDAESSRQRR 240

Query: 240 VF--QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
               +P+QVN  LM  A   A+ MHCLPAHRGEEV + +LDGP+SVVFDEAENRLH QKA
Sbjct: 241 HNLLRPYQVNERLMDAAPDHAMVMHCLPAHRGEEVTDAILDGPRSVVFDEAENRLHAQKA 300

Query: 298 ILLWCF 303
           I+ WC 
Sbjct: 301 IMRWCL 306


>gi|220906663|ref|YP_002481974.1| ornithine carbamoyltransferase [Cyanothece sp. PCC 7425]
 gi|219863274|gb|ACL43613.1| ornithine carbamoyltransferase [Cyanothece sp. PCC 7425]
          Length = 304

 Score =  212 bits (538), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 126/303 (41%), Positives = 187/303 (61%), Gaps = 8/303 (2%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             +    L+++S   +  ++E+A ++K    ++        KVL ++F+K STRTRVSF 
Sbjct: 5   KGRDLLSLADLSREEVMHLLELAVQLKQGRVSLQ-----CNKVLGLLFQKASTRTRVSFS 59

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VAM  LGG  I L+ +  Q+ R E + DTA+VL RY+DA+ +RT     L  +  +A +P
Sbjct: 60  VAMYQLGGQVIDLNPASTQVSRGEPLEDTARVLDRYLDALAIRTFKQDDLETMAHHARIP 119

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINALTD  HPCQI+AD++T +E  GS++G   ++ GDGNN+ HSL+ G A     + IA
Sbjct: 120 VINALTDQEHPCQILADLLTVQESFGSLRGLTLAYVGDGNNVAHSLLLGCALVGMNVRIA 179

Query: 184 TPIGSEPRNEYLNWARN--QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHV 240
           +P   +P    ++ A        V + +D   AV  AH ++TD W SM QE +      V
Sbjct: 180 SPAEYQPAAAIVSQAERLAIDTEVKITNDPAIAVADAHVLYTDVWASMGQEDEVGSRVPV 239

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           FQP+Q+N +L+ +A P A+ +HCLPAHRGEE+ + V++GPQS V+++AENRLH QKA+L 
Sbjct: 240 FQPYQLNEALLQVADPQAIVLHCLPAHRGEEITDAVIEGPQSRVWEQAENRLHAQKALLA 299

Query: 301 WCF 303
              
Sbjct: 300 SIL 302


>gi|261419032|ref|YP_003252714.1| ornithine carbamoyltransferase [Geobacillus sp. Y412MC61]
 gi|297530996|ref|YP_003672271.1| ornithine carbamoyltransferase [Geobacillus sp. C56-T3]
 gi|319765849|ref|YP_004131350.1| ornithine carbamoyltransferase [Geobacillus sp. Y412MC52]
 gi|261375489|gb|ACX78232.1| ornithine carbamoyltransferase [Geobacillus sp. Y412MC61]
 gi|297254248|gb|ADI27694.1| ornithine carbamoyltransferase [Geobacillus sp. C56-T3]
 gi|317110715|gb|ADU93207.1| ornithine carbamoyltransferase [Geobacillus sp. Y412MC52]
          Length = 312

 Score =  212 bits (538), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 150/308 (48%), Positives = 203/308 (65%), Gaps = 5/308 (1%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRV 60
           M    + F  L + S+  +  ++ +A  +K   +      PLSGK +AMIFEKPSTRTRV
Sbjct: 5   MSLKGRDFLTLLDFSTDEIMDLLALAADLKAKQKAGVPYAPLSGKTMAMIFEKPSTRTRV 64

Query: 61  SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYA 120
           SFEV M  LGG  ++L+G+++QLGR ETI DTA+VLS+YVD +++RT  H ++ EL EYA
Sbjct: 65  SFEVGMIQLGGQAMYLNGNDLQLGRGETIADTARVLSQYVDVMMIRTFAHQKVEELAEYA 124

Query: 121 TVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +VPVIN LTD+ HPCQ +AD++T  E + + +G   ++ GDGNN+ ++L+  AA+    +
Sbjct: 125 SVPVINGLTDDDHPCQALADLLTIYEAKKTFQGVKLAYVGDGNNVANALLAAAAKVGMDI 184

Query: 181 NIATPIGSEPRNEYLNWARNQGASV----ALFHDAVQAVKGAHCVFTDTWISMNQEFK-A 235
            IA P G EP+ EY+  AR  G        + HD ++AV GA  ++TD W SM QE + A
Sbjct: 185 FIACPPGYEPKEEYVEAARQIGEKTGATVVVTHDPLEAVAGADAIYTDVWTSMGQESESA 244

Query: 236 REEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQ 295
               VFQP+QVN  L   A PD LF+HCLPAHRGEEV   V+DGP SVVF++A NRLH Q
Sbjct: 245 ERLQVFQPYQVNEELAKAAKPDYLFLHCLPAHRGEEVTAGVMDGPNSVVFEQAGNRLHAQ 304

Query: 296 KAILLWCF 303
           KAIL+   
Sbjct: 305 KAILVSIL 312


>gi|154685559|ref|YP_001420720.1| ornithine carbamoyltransferase [Bacillus amyloliquefaciens FZB42]
 gi|154351410|gb|ABS73489.1| ArgF [Bacillus amyloliquefaciens FZB42]
          Length = 323

 Score =  212 bits (538), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 144/305 (47%), Positives = 198/305 (64%), Gaps = 9/305 (2%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
           Y K F  L ++S S+++ ++  A  +K             GK LAMIFEK STRTRVSFE
Sbjct: 14  YGKDFLSLKDVSPSDINALLTEASLLKQHP----IQPIFQGKTLAMIFEKSSTRTRVSFE 69

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
             M  LGG  +FLS S++QLGR ET+ DTAKVLS +VDAI++RT  H ++ EL E+A +P
Sbjct: 70  AGMAQLGGTGLFLSSSDLQLGRGETVADTAKVLSGFVDAIMIRTFEHEKVEELAEHADIP 129

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQ +AD++T +E +G +KG   ++ GDGNN+ HSL+ G A+    + IA
Sbjct: 130 VINGLTDRYHPCQALADLLTIQEIKGKLKGVKAAYIGDGNNVAHSLMIGCAKMGCDIAIA 189

Query: 184 TPIGSEPRNEYLNWARNQGA----SVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREE 238
           +P G E   E +N A+   A     + L  +  +AV+ A  +++D + SM QE +  +  
Sbjct: 190 SPKGYEVEEEAVNAAKEAAAVSGAKITLTENPQEAVRDADVIYSDVFTSMGQEEETQQRL 249

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
           +VF P+QVN SL+S+A PD  F+HCLPAHR EEV +E++DGP S VF +AENRLH QKA+
Sbjct: 250 NVFAPYQVNASLVSLAKPDYTFLHCLPAHREEEVTSEIIDGPNSAVFQQAENRLHAQKAL 309

Query: 299 LLWCF 303
           L    
Sbjct: 310 LKALL 314


>gi|126435562|ref|YP_001071253.1| ornithine carbamoyltransferase [Mycobacterium sp. JLS]
 gi|126235362|gb|ABN98762.1| ornithine carbamoyltransferase [Mycobacterium sp. JLS]
          Length = 307

 Score =  211 bits (537), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 141/306 (46%), Positives = 193/306 (63%), Gaps = 10/306 (3%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRVSFE 63
            +HF    +++    + ++ +A ++K   ++   ++PL+G + +A+IF+K STRTR SFE
Sbjct: 1   MRHFLRDDDLTPEEQAEVLALAAELK---KDPLLHRPLAGPRGVAVIFDKNSTRTRFSFE 57

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V +  LGG  + + G   QLGR ET+ DT KVLSRYVDAIV RT    RL  +   ATVP
Sbjct: 58  VGIAQLGGHAVVVDGRSTQLGREETLEDTGKVLSRYVDAIVWRTFAQERLTSMAAGATVP 117

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLNI 182
           VINAL+D  HPCQ++AD+ T  E RG++ G   ++ GDG NN+ HSL+ G A     + I
Sbjct: 118 VINALSDEFHPCQVLADLQTLIERRGALPGLRMAYFGDGANNMAHSLMLGGATAGMHVTI 177

Query: 183 ATPIGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-RE 237
           A P G EP   ++  A+ +    GASV +  D  QA  GA  + TDTW SM QE      
Sbjct: 178 AAPQGFEPHPMFVAAAQERAALTGASVTVTADPHQAADGADVLVTDTWTSMGQENDGLDR 237

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
              F+PFQVN  L+  AH +A+ +HCLPAHRG E+ +EV+DGP S V+DEAENRLH QKA
Sbjct: 238 VRPFRPFQVNTGLLDRAHAEAVVLHCLPAHRGHEITDEVIDGPHSAVWDEAENRLHAQKA 297

Query: 298 ILLWCF 303
           +L+W  
Sbjct: 298 LLVWLL 303


>gi|239814458|ref|YP_002943368.1| ornithine carbamoyltransferase [Variovorax paradoxus S110]
 gi|239801035|gb|ACS18102.1| ornithine carbamoyltransferase [Variovorax paradoxus S110]
          Length = 311

 Score =  211 bits (537), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 122/298 (40%), Positives = 179/298 (60%), Gaps = 1/298 (0%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +H+   S+ ++   + + +    IK   +   +++PL+ + LAMIFEK STRTRVSFE  
Sbjct: 11  RHYLQFSDFTADEYAYLFDRMAIIKKKFKTYEKHQPLTDRTLAMIFEKASTRTRVSFEAG 70

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  + L+  + QLGRAE I D+AKV+SR VD +++RT   +++     ++ VPVI
Sbjct: 71  MYQLGGSVVHLTTGDSQLGRAEPIEDSAKVISRMVDLVMIRTYEQTKIDTFAAHSRVPVI 130

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N LT+  HPCQI+ADI T+ EHRGS++GK  +W GDGNN+ ++ ++ +    + ++++TP
Sbjct: 131 NGLTNEFHPCQILADIFTYIEHRGSIQGKTVAWVGDGNNMANTWLQASEILGFKVHVSTP 190

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
            G E               V                   T +    E +AR +  F  + 
Sbjct: 191 SGYEVDQSVAGLRSADSYQVFKDPMEACRGADLVTTDVWTSMGYESENEARRKA-FADWC 249

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           V+  +M +A PD+LFMHCLPAHRGEEV  EV+DGPQSVV+DEAENRLH QKA++ +  
Sbjct: 250 VDEDMMRIAQPDSLFMHCLPAHRGEEVQAEVIDGPQSVVWDEAENRLHAQKALMEFLL 307


>gi|70732188|ref|YP_261944.1| ornithine carbamoyltransferase [Pseudomonas fluorescens Pf-5]
 gi|68346487|gb|AAY94093.1| ornithine carbamoyltransferase [Pseudomonas fluorescens Pf-5]
          Length = 306

 Score =  211 bits (537), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 148/302 (49%), Positives = 199/302 (65%), Gaps = 5/302 (1%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M+  +HF  L + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+S
Sbjct: 1   MSA-RHFLSLMDCTPEELVSVIRRGIELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRLS 59

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  IFLS  + QLGR E IGD A V+SR +DA+++RT  HS L E    + 
Sbjct: 60  FEAGMIQLGGQAIFLSPRDTQLGRGEPIGDCAIVMSRMLDAVMIRTFAHSTLTEFAANSR 119

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN L+D+ HPCQ++AD+ TF EHRGS++GK  +W GDGNN+ +S IE A +F++ L 
Sbjct: 120 VPVINGLSDDLHPCQLLADMQTFLEHRGSIQGKTVAWIGDGNNMCNSYIEAAIQFDFQLR 179

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHV 240
           IA P G EP  +++  A   G  V +  D  +AV+GAH V TD W SM QE + A+   +
Sbjct: 180 IACPEGYEPNADFVAQA---GERVTIVRDPREAVRGAHLVSTDVWTSMGQEEETAKRLQL 236

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F PFQVN +L+ +A  D LFMHCLPAHRGEE+  ++LD P+SV +D+AENRLH QKA+L 
Sbjct: 237 FAPFQVNRALLDLAAEDVLFMHCLPAHRGEEISLDLLDDPRSVAWDQAENRLHAQKALLE 296

Query: 301 WC 302
           + 
Sbjct: 297 FL 298


>gi|294013051|ref|YP_003546511.1| ornithine carbamoyltransferase [Sphingobium japonicum UT26S]
 gi|292676381|dbj|BAI97899.1| ornithine carbamoyltransferase [Sphingobium japonicum UT26S]
          Length = 309

 Score =  211 bits (537), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 148/308 (48%), Positives = 206/308 (66%), Gaps = 7/308 (2%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-----PLSGKVLAMIFEKPST 56
           MT   HF +LS+     ++ +I  A   K + +   + +     PL+G  LAMIFEK ST
Sbjct: 1   MTN--HFLNLSDAGGDAIAAMISDAIDRKAARKGWPKGRADADAPLAGHTLAMIFEKNST 58

Query: 57  RTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLEL 116
           RTRVSF++A++ LGG ++ L G+  QLGR ETI DTA+VLSR  DAI++RT +H+++ E+
Sbjct: 59  RTRVSFDMAIRQLGGTSLILDGATSQLGRGETIADTARVLSRMADAIMIRTDDHAKIEEM 118

Query: 117 TEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARF 176
             +ATVPVIN LTD +HPCQI+AD++T  EH  ++ G  ++W GDGNN+LHS++E A   
Sbjct: 119 AHHATVPVINGLTDLSHPCQIVADLLTVVEHGVALPGSQWAWLGDGNNVLHSIVEAAGLM 178

Query: 177 NYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR 236
            + + IA P G +P   +   A+ +GA++    D + AV GA  V TDTWISM Q     
Sbjct: 179 KFGVRIAVPEGYDPDPSFEAEAQARGATITRTRDPLAAVAGADIVVTDTWISMGQAHAEE 238

Query: 237 EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
           +     P+QV   LM++A P A F+HCLPAHRGEEV+  V+DGPQSV++DEAENR+H QK
Sbjct: 239 KLAAMMPYQVTPELMALAKPTAKFLHCLPAHRGEEVVEAVIDGPQSVIWDEAENRIHAQK 298

Query: 297 AILLWCFG 304
           ++LLW  G
Sbjct: 299 SVLLWALG 306


>gi|73749079|ref|YP_308318.1| ornithine carbamoyltransferase [Dehalococcoides sp. CBDB1]
 gi|289433055|ref|YP_003462928.1| ornithine carbamoyltransferase [Dehalococcoides sp. GT]
 gi|73660795|emb|CAI83402.1| ornithine carbamoyltransferase [Dehalococcoides sp. CBDB1]
 gi|288946775|gb|ADC74472.1| ornithine carbamoyltransferase [Dehalococcoides sp. GT]
          Length = 311

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 135/308 (43%), Positives = 189/308 (61%), Gaps = 10/308 (3%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M   K    +S++S  ++  ++  A ++K        N  LSGK LA++FEKPS RTRVS
Sbjct: 1   MNT-KDLLSISDLSPDDIGRLLSDAVELKA----RGWNNSLSGKTLALVFEKPSLRTRVS 55

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE+AMK + G+ ++LS +E+ LG+ E + D A+VLSR+VD I  RT  H  L++L +YA 
Sbjct: 56  FELAMKQMDGEALYLSPAEVGLGKREPVADVARVLSRFVDVIACRTFGHETLVQLAKYAD 115

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           +PVINAL+D  HPCQ +ADI+T  E +G +KG   ++ GDGNN  +SL+   A       
Sbjct: 116 IPVINALSDLEHPCQALADILTIYEKKGDLKGLSLAYIGDGNNCANSLLLACAMTGINCR 175

Query: 182 IATPIGSEPRNEYLN----WARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AR 236
           +A+P G     +       +A + GA +    D   A++GA  ++TD W SM QE +  +
Sbjct: 176 LASPKGYLVDKDLFARAEAYAEDSGAELYSGTDLKTALRGADVIYTDVWTSMGQEAETEK 235

Query: 237 EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
               F  FQVN  L+SMA  DA+ MH LPAH GEEV  E+L+ PQSV+FD+AENRLH QK
Sbjct: 236 RLKDFTGFQVNAKLVSMAKKDAIIMHPLPAHYGEEVDREILECPQSVIFDQAENRLHAQK 295

Query: 297 AILLWCFG 304
           A+L    G
Sbjct: 296 AVLRDMLG 303


>gi|307293822|ref|ZP_07573666.1| ornithine carbamoyltransferase [Sphingobium chlorophenolicum L-1]
 gi|306879973|gb|EFN11190.1| ornithine carbamoyltransferase [Sphingobium chlorophenolicum L-1]
          Length = 309

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 148/308 (48%), Positives = 204/308 (66%), Gaps = 7/308 (2%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNS-----SENIFENKPLSGKVLAMIFEKPST 56
           MT   HF +LS+     ++ +I  A   K +           + PL+G  LAMIFEK ST
Sbjct: 1   MTN--HFLNLSDAGGDAIAAMISDAIDRKAARLGQPKGRADADAPLAGHTLAMIFEKNST 58

Query: 57  RTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLEL 116
           RTRVSF++A++ LGG ++ L G+  QLGR ETI DTA+VLSR  DAI++RT +H+++ E+
Sbjct: 59  RTRVSFDMAIRQLGGTSLILDGATSQLGRGETIADTARVLSRMADAIMIRTDDHAKIEEM 118

Query: 117 TEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARF 176
             +ATVPVIN LTD +HPCQI+AD++T  EH  ++ G  ++W GDGNN+LHS++E A   
Sbjct: 119 AHHATVPVINGLTDLSHPCQIVADLLTVVEHGVALPGSQWAWLGDGNNVLHSIVEAAGLM 178

Query: 177 NYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR 236
            + + IA P G +P   +   A+ +GA++    D + AV GA  V TDTWISM Q     
Sbjct: 179 KFGVRIAVPEGYDPDPSFEAEAQARGATITRTRDPLAAVTGADIVVTDTWISMGQAHAEE 238

Query: 237 EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
           +     P+QV   LM++A P A F+HCLPAHRGEEV+  V+DGPQSV++DEAENR+H QK
Sbjct: 239 KLAAMMPYQVTPELMALAKPTAKFLHCLPAHRGEEVVEAVIDGPQSVIWDEAENRIHAQK 298

Query: 297 AILLWCFG 304
           ++LLW  G
Sbjct: 299 SVLLWALG 306


>gi|308173089|ref|YP_003919794.1| ornithine carbamoyltransferase [Bacillus amyloliquefaciens DSM 7]
 gi|307605953|emb|CBI42324.1| ornithine carbamoyltransferase [Bacillus amyloliquefaciens DSM 7]
 gi|328554069|gb|AEB24561.1| ornithine carbamoyltransferase [Bacillus amyloliquefaciens TA208]
 gi|328911150|gb|AEB62746.1| ornithine carbamoyltransferase [Bacillus amyloliquefaciens LL3]
          Length = 318

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 142/305 (46%), Positives = 197/305 (64%), Gaps = 9/305 (2%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
           Y K F  L ++S S+++ ++  A  +K             GK LAMIFEK STRTRVSFE
Sbjct: 14  YGKDFLSLKDVSPSDINALLTEASLLKQHP----IQPIFQGKTLAMIFEKSSTRTRVSFE 69

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
             M  LGG  +FLS S++QLGR ET+ DTAKVLS +VDAI++RT  H ++ EL E+A +P
Sbjct: 70  AGMAQLGGTGLFLSSSDLQLGRGETVADTAKVLSGFVDAIMIRTFAHEKVEELAEHADIP 129

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQ +AD++T +E +G +KG   ++ GDGNN+ HSL+ G A+    + +A
Sbjct: 130 VINGLTDRYHPCQALADLLTIQEIKGKLKGVKVAYIGDGNNVAHSLMIGCAKMGCDVAVA 189

Query: 184 TPIGSEPRNEYLNWARNQGA----SVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREE 238
           +P G E   E +N A+   A     + L  +  +AV+ A  +++D + SM QE +  +  
Sbjct: 190 SPKGYEVEEEAVNAAKEAAAVSGTKITLTDNPQEAVRDADVIYSDVFTSMGQEEETQQRL 249

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
            VF P+QVN SL+S+A PD  F+HCLPAHR EEV ++++DGP S VF +AENRLH QKA+
Sbjct: 250 SVFAPYQVNASLVSLAKPDYTFLHCLPAHREEEVTSDIIDGPNSAVFQQAENRLHAQKAL 309

Query: 299 LLWCF 303
           L    
Sbjct: 310 LKALL 314


>gi|94971185|ref|YP_593233.1| ornithine carbamoyltransferase [Candidatus Koribacter versatilis
           Ellin345]
 gi|94553235|gb|ABF43159.1| ornithine carbamoyltransferase [Candidatus Koribacter versatilis
           Ellin345]
          Length = 338

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 119/307 (38%), Positives = 171/307 (55%), Gaps = 7/307 (2%)

Query: 3   TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSF 62
           T  +    +++ +   ++  +++A  +K    +      L+GK + M FEKPS RTR++F
Sbjct: 20  TNDRDLVSITDFTPEEITSALDLASAMKVHPADFRG--ALAGKQVVMFFEKPSLRTRITF 77

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E  +  LGG + F+     +LG  E + D A  L R+VD IV+RT  H     + E++++
Sbjct: 78  ESGISSLGGVSFFVDQGASRLGAREPLSDIAHNLERWVDGIVLRTFAHDTCSVMAEHSSI 137

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI 182
           PVINAL+D+ HPCQ +AD++T +EH GS++    ++ GDGNN+ HSL+   A     L +
Sbjct: 138 PVINALSDHEHPCQALADVLTLKEHFGSLRKLKVAFVGDGNNVAHSLMLACASVGANLTV 197

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN-----QEFKARE 237
            TP G EP  + L  A+    S     D       A       +  +      +   A  
Sbjct: 198 GTPKGYEPSVQVLKQAQKIAKSTGATIDVTTDAVAAVTGAQAIYTDVWASMGQESEAAER 257

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
           + +F PFQVN  LMS A   A FMHCLPAHRG+EV  +V+D P SVVFD+AENRLH QKA
Sbjct: 258 QQIFLPFQVNAKLMSQAAKKAKFMHCLPAHRGDEVTADVIDSPSSVVFDQAENRLHAQKA 317

Query: 298 ILLWCFG 304
           ILL   G
Sbjct: 318 ILLMLLG 324


>gi|330721142|gb|EGG99267.1| Ornithine carbamoyltransferase [gamma proteobacterium IMCC2047]
          Length = 306

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 141/298 (47%), Positives = 194/298 (65%), Gaps = 4/298 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           KHF  L +++ +    +++ A ++K    +    +PL  +VLAM+FEK STRTRVSFE  
Sbjct: 4   KHFLTLCDLTGAEFEQLLQRAIELKKMQHDGVIYEPLKNRVLAMVFEKSSTRTRVSFETG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M   GG  +FLS  + QLGR E I D+A+V+SR VD I++RT  HS++    EY++  VI
Sbjct: 64  MAQFGGSALFLSPRDTQLGRGEAIEDSARVMSRMVDIIMIRTFEHSKIERFAEYSSGLVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NALTD+ HPCQ++AD+ T+ EHRGS++GK  ++ GDGNN+ +S I  A    + L+IA P
Sbjct: 124 NALTDDYHPCQLLADMQTYVEHRGSIRGKTVTYIGDGNNMCNSYINAAHLLGFKLHIACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREEHVFQPF 244
            G EP    L       + V +F D  +A  G+H V TD W SM  +E +   E  F  F
Sbjct: 184 EGFEPMASLL---EQHKSHVKIFRDPAEATLGSHLVVTDVWASMGQEEEQKEREQQFAGF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           QVN  LM +A PDALFMHCLPAHRGEE+ +++LD P+SVV++EAENRLH QKA++   
Sbjct: 241 QVNPKLMDLASPDALFMHCLPAHRGEEISHDMLDDPRSVVWEEAENRLHAQKALIEHL 298


>gi|307545336|ref|YP_003897815.1| ornithine carbamoyltransferase [Halomonas elongata DSM 2581]
 gi|307217360|emb|CBV42630.1| ornithine carbamoyltransferase [Halomonas elongata DSM 2581]
          Length = 306

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 130/299 (43%), Positives = 182/299 (60%), Gaps = 3/299 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSE-NIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
           +HF  L ++S      +++ A  IKN  + +     P + + LAMIFEK STRTRVSFE 
Sbjct: 4   RHFLTLLDLSPEESRYLVQRAISIKNGLKTHGPTYTPFANRTLAMIFEKSSTRTRVSFET 63

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           AM   GG  +FLS  + QLGR E IGDTA+VL+  VD +++RT +H  L E    + VPV
Sbjct: 64  AMAQFGGHALFLSPRDTQLGRGEPIGDTARVLAEMVDIVMIRTFSHQGLEEYAAASDVPV 123

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           INALTD+ HPCQ++AD+MT+ E RGSV+G+   W GDGNN+ HS I  A +F++ L I  
Sbjct: 124 INALTDDYHPCQLLADVMTWTELRGSVRGRTAVWIGDGNNMCHSWINAARQFDFQLRICC 183

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF 244
           P G EP  + L+ A ++         AV+           +     +E +A+ E  F  F
Sbjct: 184 PEGYEPHQDILDAAGDRVTIHRDPMSAVEGADLVTTDVWASM--GQEEEQAKREADFAGF 241

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           QV+ +++  A  D LF+HCLPAHRGEE+   +LD P++VV+ EA NRLH QKA++ +  
Sbjct: 242 QVSEAMLDRAASDVLFLHCLPAHRGEEISETLLDDPRAVVWQEAGNRLHAQKALIEFLL 300


>gi|197123187|ref|YP_002135138.1| ornithine carbamoyltransferase [Anaeromyxobacter sp. K]
 gi|220917976|ref|YP_002493280.1| ornithine carbamoyltransferase [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|196173036|gb|ACG74009.1| ornithine carbamoyltransferase [Anaeromyxobacter sp. K]
 gi|219955830|gb|ACL66214.1| ornithine carbamoyltransferase [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 309

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 123/303 (40%), Positives = 177/303 (58%), Gaps = 8/303 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            + F  ++++  S L  ++E A + K   +     +PL  + + ++FEK STRTRVSFEV
Sbjct: 8   KRDFLRITDLDRSELLELVERAAEWKLLGKGG--PRPLERRTVGLVFEKASTRTRVSFEV 65

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
           A   LG  +I LS  + QLGR E I DTA+VLSRY+D +V+RT  H ++ E+  YA VPV
Sbjct: 66  AAHQLGAGSIMLSPRDTQLGRGEPIRDTARVLSRYLDCLVVRTYGHEKIEEMARYAGVPV 125

Query: 125 INALTDNTHPCQIIADIMTFEEHRG----SVKGKLFSWSGDGNNILHSLIEGAARFNYLL 180
           +NALTD +HPCQ++AD++T  E  G    +  G   +W GDGNN+ +S +E      + L
Sbjct: 126 VNALTDASHPCQVLADLLTVTERFGSDALTKPGLRVAWVGDGNNMANSWLEACVLLGFEL 185

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
           ++A P G +P    L  A  +        +AV      +     +     ++        
Sbjct: 186 HLACPAGYDPDPALLARAAGRAKVFRSPAEAVAGAHVVNTDVWASM--GQEQEAEERRRR 243

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+ F V+  LM+ A P+A+ +HCLPAHRGEE+ +EVL+GPQS VFDEAENRLH QKA+L 
Sbjct: 244 FEGFIVDGPLMARARPNAVVLHCLPAHRGEEITDEVLEGPQSAVFDEAENRLHAQKALLE 303

Query: 301 WCF 303
              
Sbjct: 304 LLL 306


>gi|118575527|ref|YP_875270.1| ornithine carbamoyltransferase [Cenarchaeum symbiosum A]
 gi|226739194|sp|A0RUE9|OTC_CENSY RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|118194048|gb|ABK76966.1| ornithine carbamoyltransferase [Cenarchaeum symbiosum A]
          Length = 301

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 140/300 (46%), Positives = 185/300 (61%), Gaps = 4/300 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K     + +    +  IIE A ++K    +  +  PL G+ LAM+F+KPSTRTRVSF   
Sbjct: 6   KDLLTGAELDRKEILGIIESAIRLKKGGRS--KAHPLDGRTLAMVFQKPSTRTRVSFAAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG+ I+L   +MQL R ETI DTA+ LS YVD IV R   H  + E+   A+VPVI
Sbjct: 64  MFQLGGEAIYLPPGDMQLSRGETIPDTARALSGYVDVIVARVFGHETIEEIAASASVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D  HPCQI+AD+MT +E +G +KG   +W GDGNN+ +SL+ G A     +++ATP
Sbjct: 124 NGLSDTFHPCQILADLMTIKERKGRLKGLRAAWIGDGNNVCNSLLYGCAAVGIDISVATP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ 245
               P    ++    +   V L  D  +A  GA  VFTDT+ S++   K RE      ++
Sbjct: 184 AVFRPIPGVVDK-CRESIDVKLTTDPAEAAAGADIVFTDTFASIHNMDKERERKFLPKYR 242

Query: 246 VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGI 305
           VN  LM  A  DA+FMHCLPA RG+EV  EV+DGPQS V+DEAENRLH+QKA+LL   GI
Sbjct: 243 VNAPLMKKAADDAIFMHCLPAKRGQEVDGEVIDGPQSAVWDEAENRLHSQKALLLA-LGI 301


>gi|254463226|ref|ZP_05076642.1| ornithine carbamoyltransferase [Rhodobacterales bacterium HTCC2083]
 gi|206679815|gb|EDZ44302.1| ornithine carbamoyltransferase [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 308

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 166/308 (53%), Positives = 219/308 (71%), Gaps = 7/308 (2%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFE-----NKPLSGKVLAMIFEKPSTRTR 59
             HF D+    +S LS II  A+++K++   + +     ++PL+G ++A+IFEKPSTRTR
Sbjct: 1   MNHFLDIHKTDTSALSGIITNARRMKDARVGLPKATLDADQPLAGHMVALIFEKPSTRTR 60

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           VSF+V ++ +GG+T+ LSGS+MQLG  ETI DTA+VLSRYVD I++RT + S LLE+ EY
Sbjct: 61  VSFDVGVRQMGGETMVLSGSDMQLGHGETIADTARVLSRYVDLIMIRTFDESVLLEMAEY 120

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL 179
           A VPVIN LTD THPCQI+AD+MTFEEHRG +KGK   W GDGNN+  S +  A +F + 
Sbjct: 121 ADVPVINGLTDRTHPCQIMADVMTFEEHRGPIKGKKVVWCGDGNNVCASFLHAAGQFGFD 180

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN--QEFKARE 237
           +    P   +P +E++  ARN G SV++  DA +AV+ A  V  DTW+SM+  Q  K R 
Sbjct: 181 MVFTGPKQLDPEDEFIGLARNAGVSVSIERDAQKAVENADLVVADTWVSMHDSQSAKERR 240

Query: 238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKA 297
            ++ +P+QVN  LMS A PDALFMHCLPAHR EE  + V+DGP SV+FDEAENRLH QKA
Sbjct: 241 HNMLRPYQVNEELMSHAKPDALFMHCLPAHREEEATSTVMDGPNSVIFDEAENRLHAQKA 300

Query: 298 ILLWCFGI 305
           I+ WC G 
Sbjct: 301 IMRWCLGK 308


>gi|147669842|ref|YP_001214660.1| ornithine carbamoyltransferase [Dehalococcoides sp. BAV1]
 gi|146270790|gb|ABQ17782.1| ornithine carbamoyltransferase [Dehalococcoides sp. BAV1]
          Length = 317

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 135/304 (44%), Positives = 189/304 (62%), Gaps = 9/304 (2%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           K    +S++S  ++  ++  A ++K        N  LSGK LA++FEKPS RTRVSFE+A
Sbjct: 10  KDLLSISDLSPDDIGRLLSDAVELKA----RGWNNSLSGKTLALVFEKPSLRTRVSFELA 65

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           MK +GG+ ++LS +E+ LG+ E + D A+VLSR+VD I  RT  H  L++L +YA +PVI
Sbjct: 66  MKQMGGEALYLSPAEVGLGKREPVADVARVLSRFVDVIACRTFGHETLVQLAKYADIPVI 125

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           NAL+D  HPCQ +ADI+T  E +G +KG   ++ GDGNN  +SL+   A       +A+P
Sbjct: 126 NALSDLEHPCQALADILTIYEKKGDLKGLSLAYIGDGNNCANSLLLACAMTGINCRLASP 185

Query: 186 IGSEPRNEYLN----WARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHV 240
            G     +       +A + GA +    D   A++GA  ++TD W SM QE +  +    
Sbjct: 186 KGYLVDKDLFARAEAYAEDSGAELYSETDLKTALRGADVIYTDVWTSMGQEAETEKRLKD 245

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F  FQVN  L+SMA  DA+ MH LPAH GEEV  E+L+ PQSV+FD+AENRLH QKA+L 
Sbjct: 246 FTGFQVNAKLVSMAKKDAIIMHPLPAHYGEEVDREILECPQSVIFDQAENRLHAQKAVLR 305

Query: 301 WCFG 304
              G
Sbjct: 306 DMLG 309


>gi|258654249|ref|YP_003203405.1| ornithine carbamoyltransferase [Nakamurella multipartita DSM 44233]
 gi|258557474|gb|ACV80416.1| ornithine carbamoyltransferase [Nakamurella multipartita DSM 44233]
          Length = 312

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 133/310 (42%), Positives = 189/310 (60%), Gaps = 10/310 (3%)

Query: 1   MMTYP-KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR 59
           M T P +H+    +++   L+ +++ A   K          PL+GK +A++FEK STRTR
Sbjct: 1   MTTAPVRHYLRDDDVTPDELTALLDTADTFKKDRTGYT---PLAGKAIAVVFEKNSTRTR 57

Query: 60  VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY 119
           +SFEV +  LGG  + + G   QLGR ETI DT++VLSR+VDA+ +RT    R+  L   
Sbjct: 58  LSFEVGIAQLGGQPVIVDGRTSQLGREETIEDTSRVLSRFVDAVAIRTFAQRRIDALAGV 117

Query: 120 ATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNY 178
           + VPVINALTD  HPCQ++AD+ T  E +G + G   ++ GDG NN+ HSL+ G A    
Sbjct: 118 SRVPVINALTDEFHPCQVLADLQTIRERKGRLAGLTLTYLGDGANNMAHSLMLGGANAGL 177

Query: 179 LLNIATPIGSEPRNEYLNWARNQGASV----ALFHDAVQAVKGAHCVFTDTWISMNQEFK 234
            + ++ P G +P  E++  AR +GA       L  D   AV G   + TDTW+SM QE  
Sbjct: 178 HVRVSAPAGFDPHPEFVAAARQRGAQTGATVELITDPHAAVDGCDVLVTDTWVSMGQEND 237

Query: 235 A-REEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLH 293
                  F+P+Q+N  L++ A+ DA+ +HCLPAHRG E+ +EV+DG  S V+DEAENRLH
Sbjct: 238 GLDRVGPFRPYQINRELLARANQDAIVLHCLPAHRGFEITDEVIDGASSAVWDEAENRLH 297

Query: 294 TQKAILLWCF 303
            QKA+L +  
Sbjct: 298 AQKALLAFLL 307


>gi|296269331|ref|YP_003651963.1| aspartate carbamoyltransferase [Thermobispora bispora DSM 43833]
 gi|296092118|gb|ADG88070.1| aspartate carbamoyltransferase [Thermobispora bispora DSM 43833]
          Length = 311

 Score =  210 bits (535), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 71/306 (23%), Positives = 126/306 (41%), Gaps = 10/306 (3%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKP-LSGKVLAMIFEKPSTRTRVSF 62
             +H     ++S  +   I++ A+++   S+   +  P L G+ +  +F + STRTR+SF
Sbjct: 1   MKRHLLSAGDLSREDALLILDTAEELSKVSQRSIKKLPTLRGRTVVNLFFEDSTRTRISF 60

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTA-KVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           E A K L  D I  S     + + E++ DTA  + +   DA+V+R         L  +  
Sbjct: 61  EAAAKRLSADVINFSARGSSVSKGESLKDTALTLEAMGADAVVIRHGASGAPHRLAGWIR 120

Query: 122 VPVINA-LTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGD--GNNILHSLIEGAARFNY 178
             VINA    + HP Q + D  +     G V+G   +  GD   + +  S ++       
Sbjct: 121 GSVINAGDGTHEHPTQALLDAFSIRRAMGRVEGLKVAIVGDVLHSRVARSNVQLLHTLGA 180

Query: 179 LLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE 238
            + +  P                   V+   DAV        +       MN  +     
Sbjct: 181 EVTLVGPPTLI-----PVAVDTWPCQVSYDFDAVLPKTDVVMMLRVQQERMNGAYFPSAR 235

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
              + + ++    +  H DA+ MH  P +RG E+  EV D P+S++ ++  N +  + A+
Sbjct: 236 EYSRRYGLDRDRFAKLHDDAIVMHPGPLNRGMEISAEVADSPRSIIVEQVGNGVLVRMAV 295

Query: 299 LLWCFG 304
           L    G
Sbjct: 296 LYLLLG 301


>gi|270308558|ref|YP_003330616.1| ornithine carbamoyltransferase [Dehalococcoides sp. VS]
 gi|270154450|gb|ACZ62288.1| ornithine carbamoyltransferase [Dehalococcoides sp. VS]
          Length = 311

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 136/308 (44%), Positives = 190/308 (61%), Gaps = 10/308 (3%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M   K    +S++S  ++  ++  A ++K        N  LSGK LA++FEKPS RTRVS
Sbjct: 1   MNT-KDLLSISDLSPDDIGRLLSDAVELKA----RGWNNSLSGKTLALVFEKPSLRTRVS 55

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE+AMK LGG+ ++LS +E+ LG+ E + D A+VLSR+VD I  RT  H  L++L +YA 
Sbjct: 56  FELAMKQLGGEALYLSPAEVGLGKREPVADVARVLSRFVDIIACRTFGHDTLVQLAKYAD 115

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           +P+INAL+D  HPCQ +ADIMT  E +G +KG   ++ GDGNN  +SL+   A       
Sbjct: 116 IPIINALSDLEHPCQALADIMTIYEKKGELKGLNLAYIGDGNNCANSLLLACAMTGINCR 175

Query: 182 IATPIGS----EPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR- 236
           +A+P G         +   +A + GA +    D   A++GA  ++TD W SM QE ++  
Sbjct: 176 LASPEGYLVDKNIFAKAKAYAEDSGAELYSGTDLKTAIRGADVIYTDVWTSMGQEAESEK 235

Query: 237 EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
               F  FQVN  L+S+A  DA+ MH LPAH GEEV  E+L+ PQSV+FD+AENRLH QK
Sbjct: 236 RLKDFAGFQVNAKLVSLADKDAIIMHPLPAHYGEEVDREILECPQSVIFDQAENRLHAQK 295

Query: 297 AILLWCFG 304
           A+L    G
Sbjct: 296 AVLRDMLG 303


>gi|311032896|ref|ZP_07710986.1| ornithine carbamoyltransferase [Bacillus sp. m3-13]
          Length = 324

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 148/304 (48%), Positives = 197/304 (64%), Gaps = 6/304 (1%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAM 66
           HF  L + S  ++  ++E A K+K   +    +  L GKVLAM+FEK STRTRVSFEV M
Sbjct: 20  HFLTLGSFSQEDIYFLLEDAIKLKKYQKEGIPHPFLQGKVLAMLFEKASTRTRVSFEVGM 79

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
             LGG  IFLS +++QLGR E+  DTAKVLSRYVD +++RT +H  L +   ++ VP+IN
Sbjct: 80  LQLGGHAIFLSSNDIQLGRGESPADTAKVLSRYVDGLMIRTFDHEILEDFARHSDVPIIN 139

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGD-GNNILHSLIEGAARFNYLLNIATP 185
            LTD+ HP Q++AD++T +EH+G +KG    + GD  NN+ HSLIEGA +    ++IA P
Sbjct: 140 GLTDSHHPAQVLADLLTIKEHKGKLKGLKICYLGDANNNMAHSLIEGAVKVGMDISIACP 199

Query: 186 IGSEPRNEYLNWARNQG----ASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HV 240
            G EP    L   + +     +S+ +    V+ +K A  V TD W SM QE +++E   V
Sbjct: 200 SGFEPDLSILTAMKKETLLTGSSIHVGESPVEMIKDADVVVTDVWTSMGQEAESKERLKV 259

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F P+QVN  L   A  D +F+HCLPAHRGEEV  E++DGP SVVFDEAENRLH QKAIL 
Sbjct: 260 FAPYQVNKELCKHAKDDFIFLHCLPAHRGEEVAIEIIDGPHSVVFDEAENRLHAQKAILK 319

Query: 301 WCFG 304
              G
Sbjct: 320 ALLG 323


>gi|158522503|ref|YP_001530373.1| ornithine carbamoyltransferase [Desulfococcus oleovorans Hxd3]
 gi|158511329|gb|ABW68296.1| ornithine carbamoyltransferase [Desulfococcus oleovorans Hxd3]
          Length = 305

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 139/301 (46%), Positives = 193/301 (64%), Gaps = 2/301 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K    L ++   +   + + A ++K        +  LSG+V+ MIF+K STRTRVSFE
Sbjct: 1   MKKDITTLYDMEKEDFQILFDSALELKKRQRMGIYDAVLSGRVMGMIFDKHSTRTRVSFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
            AM  LGG  I++S  +MQ+ RAE + DTA+VLSRY+DA+V+RT + S + E  +YA +P
Sbjct: 61  AAMTRLGGTVIYMSSRDMQIARAEPVKDTARVLSRYIDALVIRTYSQSLIEEYAQYADIP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VINAL+D  HPCQ+++D++T  EH+G  +G   +W GDGNN+ HS I  AA     L + 
Sbjct: 121 VINALSDKYHPCQVLSDLLTVIEHKGGYQGVRIAWVGDGNNVAHSWIAAAAVLGLDLVLG 180

Query: 184 TPIGSEPRNEYLNWARNQ-GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREE-HVF 241
            P    P  + L  AR +   SV + +DA +AV GA  ++TD W SM QE + RE   VF
Sbjct: 181 CPADYMPDPDILENARQKGNGSVTVVNDAAEAVAGADVIYTDVWASMGQEEEHRERLAVF 240

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           +PFQVN +L  +A  DA+ MHCLPAHRGEE+   VL+GP+SVV+D+AEN++H  KAIL  
Sbjct: 241 EPFQVNDALAGLAKKDAIVMHCLPAHRGEEITEAVLEGPRSVVWDQAENKMHMHKAILKA 300

Query: 302 C 302
            
Sbjct: 301 L 301


>gi|302392284|ref|YP_003828104.1| ornithine carbamoyltransferase [Acetohalobium arabaticum DSM 5501]
 gi|302204361|gb|ADL13039.1| ornithine carbamoyltransferase [Acetohalobium arabaticum DSM 5501]
          Length = 313

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 134/304 (44%), Positives = 193/304 (63%), Gaps = 5/304 (1%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
             H   +S+++   +  I  +  K+K  ++   ++  L+G+ L MIF+K STRTRVSFE 
Sbjct: 1   MDHLLTISDLTDEEIKQIFSLTNKLKEQNKQGIDHPVLAGQTLGMIFQKSSTRTRVSFET 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG  +FLS  ++QLGR ETI DTAK LSRYV+ I++RT +HS + EL    ++PV
Sbjct: 61  GMFQLGGHGLFLSSDDIQLGRGETISDTAKTLSRYVNGIMIRTYDHSDVEELAAAGSIPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD  HPCQ++AD+ T +E  GS++ K  ++ GDGNN+ HSL+ GA +    +++A 
Sbjct: 121 INGLTDLLHPCQVLADLYTIQEKLGSLQDKKLTYIGDGNNMSHSLLIGATKVGMDISLAV 180

Query: 185 PIGSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHV 240
           P    P  + +      A   G+ + +  D +QA + A  V+TD W SM  E +A E   
Sbjct: 181 PNAYRPDEDIVATADKQAEESGSQIEILTDPLQAAENADAVYTDVWASMGDEDEAEERMK 240

Query: 241 -FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
            F+ +QVN  +M+ A   A+F+HCLPA+RG+EV   V+DGPQSVVFDEAENR+H QKAI+
Sbjct: 241 AFKDYQVNEEVMNAAQNKAVFLHCLPAYRGKEVTAGVIDGPQSVVFDEAENRMHVQKAIM 300

Query: 300 LWCF 303
           +   
Sbjct: 301 VELM 304


>gi|226507636|ref|NP_001151252.1| ornithine carbamoyltransferase [Zea mays]
 gi|195645336|gb|ACG42136.1| ornithine carbamoyltransferase [Zea mays]
          Length = 372

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 126/303 (41%), Positives = 177/303 (58%), Gaps = 3/303 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFEN-KPLSGKVLAMIFEKPSTRTRVSFE 63
           PK F  + +     +  I+  A ++K   ++  ++ +P  GK +AMIF KPS RTRVSFE
Sbjct: 69  PKDFLQIIDFDKDTIMKILNRAIEVKALIKSGDKSFQPFKGKTMAMIFAKPSMRTRVSFE 128

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
                LGG  I+L   ++Q+G+ E   D A+VLS Y D I+ R   H  +L+L +YA+VP
Sbjct: 129 TGFFLLGGHAIYLGPDDIQMGKREETRDVARVLSGYNDIIMARVFAHQDILDLAKYASVP 188

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQI+AD +T  E  G ++     + GDGNNI+HS +  AA   +    A
Sbjct: 189 VINGLTDYNHPCQIMADALTMLEQIGRIENTKVVYVGDGNNIVHSWLLLAAVLPFHFVCA 248

Query: 184 TPIGSEPRNEYLNWARNQ-GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHVF 241
            P G EP    +  AR    + + + +   +AVKGA  V+TD W SM Q+ +A   +  F
Sbjct: 249 CPKGFEPDAHTVEIARGAGISKIEITNSPREAVKGADVVYTDVWASMGQKEEADYRKQKF 308

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           Q F V+ +LM +A P A  MHCLPA RG EV +  ++ P S+VF +AENR+H Q AI+L 
Sbjct: 309 QGFTVDETLMEIAGPQAYLMHCLPAERGVEVTDGAIEAPNSIVFPQAENRMHAQNAIMLH 368

Query: 302 CFG 304
             G
Sbjct: 369 VLG 371


>gi|297544810|ref|YP_003677112.1| aspartate carbamoyltransferase [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|296842585|gb|ADH61101.1| aspartate carbamoyltransferase [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 304

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 71/303 (23%), Positives = 123/303 (40%), Gaps = 9/303 (2%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K    + ++S   +  ++E AK++K        ++ L GK +  IF +PSTRTR+SFE
Sbjct: 2   KRKDLLGIKDLSKEEILEVLETAKEMKKILNGEKYSQILKGKTVVTIFFEPSTRTRLSFE 61

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYV-DAIVMRTTNHSRLLELTEYATV 122
           +A K+LG     +  +   + + E++ DT + +     D I+ R         + +Y   
Sbjct: 62  MATKYLGAHYGNIEVATSSVAKGESLIDTIRTVEMMKADVIITRHNMSGAPHLMAKYTDA 121

Query: 123 PVINA-LTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGD--GNNILHSLIEGAARFNYL 179
            +INA    N HP Q + D+MT  E + S +G   +  GD   + +  S I G  +    
Sbjct: 122 SIINAGDGINEHPTQALLDMMTIREKKESFEGLKVAIIGDIMHSRVARSNIWGLKKMGAE 181

Query: 180 LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
           +  A P    P        +          D                           + 
Sbjct: 182 VRAAGPSTLIPPAIEKMGVKAYYNVEEAIKD-----VDVVMGLRIQLERQKSGLFPSIDE 236

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             + F +N   M +A PDA+ MH  P +R  E+ +E  +   SV+ ++  N +  + A+L
Sbjct: 237 YREYFGINKERMKLAKPDAILMHPGPINRNVELTSEAANDKYSVIEEQVTNGVAVRMALL 296

Query: 300 LWC 302
              
Sbjct: 297 KIL 299


>gi|296332546|ref|ZP_06875007.1| ornithine carbamoyltransferase [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305673827|ref|YP_003865499.1| ornithine carbamoyltransferase [Bacillus subtilis subsp. spizizenii
           str. W23]
 gi|296150464|gb|EFG91352.1| ornithine carbamoyltransferase [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305412071|gb|ADM37190.1| ornithine carbamoyltransferase [Bacillus subtilis subsp. spizizenii
           str. W23]
          Length = 314

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 140/305 (45%), Positives = 191/305 (62%), Gaps = 9/305 (2%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
           Y K    L  +S  +++ ++  A ++K +           GK LAMIFEK STRTRVSFE
Sbjct: 10  YGKDLLTLKGLSEQDINALLAEAGELKRNK----IQPIFQGKTLAMIFEKSSTRTRVSFE 65

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
             M  LGG  +FLS  ++QLGR ETI DTAKVLS YVDAI++RT  H ++ EL + A +P
Sbjct: 66  AGMAQLGGSALFLSQKDLQLGRGETIADTAKVLSGYVDAIMIRTYEHEKVEELAKEADIP 125

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQ +AD++T +E +G +KG   ++ GDGNN+ HSL+ G A+    ++IA
Sbjct: 126 VINGLTDKYHPCQALADLLTIKEMKGKLKGVKVAYIGDGNNVAHSLMIGCAKMGCEISIA 185

Query: 184 TPIGSEPRNEYLNWARNQGAS----VALFHDAVQAVKGAHCVFTDTWISM-NQEFKAREE 238
           +P G E  +E +  A+         + L  D V+AVK A  +++D + SM  +  +    
Sbjct: 186 SPKGYEVLDEAVEAAKTSALQSGASITLTADPVEAVKDADVIYSDVFTSMGQEAEEQERL 245

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
            VF P+QVN +L+S A PD  F+HCLPAHR EEV  E++DGP S VF +AENRLH QKA+
Sbjct: 246 AVFAPYQVNAALVSHAKPDYTFLHCLPAHREEEVTAEIIDGPNSAVFQQAENRLHVQKAL 305

Query: 299 LLWCF 303
           L    
Sbjct: 306 LKAIL 310


>gi|167750885|ref|ZP_02423012.1| hypothetical protein EUBSIR_01869 [Eubacterium siraeum DSM 15702]
 gi|167656064|gb|EDS00194.1| hypothetical protein EUBSIR_01869 [Eubacterium siraeum DSM 15702]
          Length = 303

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 128/301 (42%), Positives = 189/301 (62%), Gaps = 2/301 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH   + ++S+  +  I+ +A ++K   ++   +  L GK L MIF K STRTRVSFE 
Sbjct: 1   MKHLLKMMDLSTEEIIEILNLADQLKYELKHGIPHDHLKGKTLGMIFRKASTRTRVSFET 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            M  LGG+ ++LS S+MQ+GR E I DTA+VLSRY+D I++RT + + +  L EY  +P+
Sbjct: 61  GMYQLGGNPLYLSASDMQIGRGEPIQDTARVLSRYIDGIMIRTFDQAEVENLAEYGNIPI 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           IN LTD +HPCQ++AD+MT  E++G + G    + GDGNN+ +SLI G  +    +++A 
Sbjct: 121 INGLTDLSHPCQVLADLMTIREYKGKLDGLKMCYIGDGNNMANSLIVGGLKTGMSVSVAC 180

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EEHVFQP 243
           P    P    L +A+       L  D ++A K A  +FTD W SM QE +A   +  F+ 
Sbjct: 181 PENYHPAATTLAFAKKYDCF-ELTDDPIKAAKDADVIFTDVWASMGQEGEAEIRKKAFKG 239

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           FQ+N  +M++A PDA+  HCLPAHR EE+  +V +   + +FDEAENRLH QKA+++   
Sbjct: 240 FQINDEVMAVAKPDAMVQHCLPAHREEEITAKVFEEHANEIFDEAENRLHAQKAVMVLLM 299

Query: 304 G 304
           G
Sbjct: 300 G 300


>gi|182419135|ref|ZP_02950389.1| ornithine carbamoyltransferase [Clostridium butyricum 5521]
 gi|237669176|ref|ZP_04529158.1| ornithine carbamoyltransferase [Clostridium butyricum E4 str. BoNT
           E BL5262]
 gi|182377090|gb|EDT74660.1| ornithine carbamoyltransferase [Clostridium butyricum 5521]
 gi|237655063|gb|EEP52621.1| ornithine carbamoyltransferase [Clostridium butyricum E4 str. BoNT
           E BL5262]
          Length = 306

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 124/305 (40%), Positives = 185/305 (60%), Gaps = 5/305 (1%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             K    + ++S   +  I+ +A ++K   ++  E+  L GK L MIFEK STRTRVSFE
Sbjct: 1   MKKDLLKMDDLSKEEILDILNLADQLKYEQKHGIEHPLLKGKSLGMIFEKASTRTRVSFE 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           V M  LGG+ +FLS  E+Q+GR E I DTA+VLSR++  I++RT +      L +Y+++P
Sbjct: 61  VGMYQLGGNALFLSDKELQIGRGEPIEDTARVLSRFIQGIMIRTFSQKEAETLAKYSSIP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           +IN LTD+ HPCQ++AD+MT  E++  ++G   ++ GDGNN+ +SL+ G  +     +IA
Sbjct: 121 IINGLTDDEHPCQVLADLMTIRENKNILEGLKVAFVGDGNNMANSLMIGCLKVGMNFSIA 180

Query: 184 TPIGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-EE 238
           +P       +YL+ A+           +    ++AVK A  V TD W SM  E +A+   
Sbjct: 181 SPKIYSASEKYLSRAKEIAESENVEFTITTSPIEAVKCADVVITDVWTSMGHEEEAQERI 240

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F+ FQVN  L+  A+ D L +HCLP HR EE+ +EVL+     +FDE+ENRLH QKA+
Sbjct: 241 KHFEGFQVNNELLKNANDDVLVLHCLPCHRDEEITSEVLEAHAEEIFDESENRLHAQKAV 300

Query: 299 LLWCF 303
           L+   
Sbjct: 301 LVKLM 305


>gi|219666858|ref|YP_002457293.1| ornithine carbamoyltransferase [Desulfitobacterium hafniense DCB-2]
 gi|219537118|gb|ACL18857.1| ornithine carbamoyltransferase [Desulfitobacterium hafniense DCB-2]
          Length = 313

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 132/302 (43%), Positives = 188/302 (62%), Gaps = 6/302 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F  L + +   +  +++VAK++K   +    +  L GK LAMIF K STRTRV+FE  
Sbjct: 12  RDFICLQDFTPDEILYMLKVAKELKEEKKGGTPHPILQGKSLAMIFTKSSTRTRVAFEAG 71

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  +FLS  ++Q+GR E I DTA+VLSR VD I++RT +H  ++EL +YA +PVI
Sbjct: 72  MLQLGGHALFLSNRDIQIGRGEPIKDTARVLSRMVDGIMIRTHSHQDVIELAKYADIPVI 131

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D  HP Q++AD++T +EH+  ++G   ++ GDGNN+ HSL+         + IATP
Sbjct: 132 NGLSDFLHPTQVLADLLTIQEHKHCLEGLKLTYIGDGNNMAHSLMFAGKM-GMHVVIATP 190

Query: 186 IGSEPRNEYLNWARNQGASV----ALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHV 240
            G +P  + +  A+ Q            D + A +GA  ++TD W SM QE + A     
Sbjct: 191 AGYKPDAQVVAQAQAQAKQYGGLVEWVEDPLAAAEGADVLYTDVWASMGQEEEAAIRMKA 250

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           FQ ++++   M  A  +A+ MHCLPAHRGEE+  EVL+GPQSVVFDEAENRLH  KAI+ 
Sbjct: 251 FQSYRIDRETMERAQANAIVMHCLPAHRGEEITEEVLEGPQSVVFDEAENRLHAHKAIMA 310

Query: 301 WC 302
             
Sbjct: 311 LL 312


>gi|150403487|ref|YP_001330781.1| ornithine carbamoyltransferase [Methanococcus maripaludis C7]
 gi|189036331|sp|A6VJK4|OTC_METM7 RecName: Full=Ornithine carbamoyltransferase; Short=OTCase
 gi|150034517|gb|ABR66630.1| ornithine carbamoyltransferase [Methanococcus maripaludis C7]
          Length = 304

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 121/304 (39%), Positives = 175/304 (57%), Gaps = 10/304 (3%)

Query: 7   HFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAM 66
               L N+    +  IIE A+  K   +N + +  L  K +A+IFE PSTRTR+SF++A+
Sbjct: 2   DLLTLWNLEREEVLKIIENAEYFK---KNRYGHDILKNKSIALIFESPSTRTRMSFDLAV 58

Query: 67  KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN 126
             LGG ++ ++  E+ LG+ E+I DTA+V+SR+VDAIV R  +H  L +L EY +VPVIN
Sbjct: 59  HELGGHSLMMNEGEIHLGKKESIADTARVMSRFVDAIVARVKSHKTLEDLAEYGSVPVIN 118

Query: 127 ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI 186
           AL D  HPCQI+AD++T +E+  + KG   ++ GDGNN+ +SL+   A     + IATP 
Sbjct: 119 ALCDLAHPCQILADLLTMKENGKNFKGLKLAYFGDGNNVSNSLMIAGAILGMDVVIATPR 178

Query: 187 GSEPRNEYLNWARNQGASV-------ALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
             EP   ++  A    A             +                +S   +       
Sbjct: 179 SYEPSGLFVKKALEIIAKYGEGSLTLTDDPEIAAKDADVLYTDVWISMSDKNKNLDEILK 238

Query: 240 VFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           +F  FQ+N  L+S A  DA+ +HCLPA+RG E+ +EV+DG QS VFD+AENRLH QKA+L
Sbjct: 239 IFPKFQINAELLSKAKEDAIVLHCLPANRGLEITDEVIDGKQSKVFDQAENRLHAQKAVL 298

Query: 300 LWCF 303
            + F
Sbjct: 299 KYIF 302


>gi|261368765|ref|ZP_05981648.1| ornithine carbamoyltransferase [Subdoligranulum variabile DSM
           15176]
 gi|282569187|gb|EFB74722.1| ornithine carbamoyltransferase [Subdoligranulum variabile DSM
           15176]
          Length = 303

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 115/300 (38%), Positives = 171/300 (57%), Gaps = 1/300 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEV 64
            KH   L  +S   +  I++VA + K   +   + K L GK +A++F K STRTR S EV
Sbjct: 1   MKHLLKLGGLSRDEILHILDVADEYKRLHKQGVDPKDLQGKAVALLFAKHSTRTRTSLEV 60

Query: 65  AMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPV 124
            +  +GG   +LS +++Q  R E + DTA+VL RY DAIV RT   + L  L +Y+ VPV
Sbjct: 61  GIYQMGGLGTYLSANDLQTARGEPVQDTARVLGRYYDAIVCRTYKQTDLDALAQYSGVPV 120

Query: 125 INALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT 184
           ++ +TD  HP Q++ D+MT  E++G ++G    + GDG N+ +SLI G       + +A 
Sbjct: 121 VSGMTDYAHPLQVLTDLMTVREYKGKLEGLRMGFIGDGYNMANSLIVGCLAVGMQVTMAC 180

Query: 185 PIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQP 243
           P G  P  + L  A+  G +  L HD  +A + A  +FTD W+SM  E +  R    F  
Sbjct: 181 PKGYRPAADVLMQAKAYGDAFRLVHDPDEAARDADVLFTDVWVSMGMERETERRYRDFTG 240

Query: 244 FQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF 303
           F ++   M++A PD +  H LPA RGEE+  +V +   + +FDEAENRLH +KA+L    
Sbjct: 241 FTLDADRMALAKPDCMVQHPLPARRGEEIATDVFEKHANEIFDEAENRLHVEKAVLAILL 300


>gi|238006418|gb|ACR34244.1| unknown [Zea mays]
          Length = 372

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 126/303 (41%), Positives = 178/303 (58%), Gaps = 3/303 (0%)

Query: 5   PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFEN-KPLSGKVLAMIFEKPSTRTRVSFE 63
           PK F  + +     +  I+  A ++K   ++  ++ +P  GK +AMIF KPS RTRVSFE
Sbjct: 69  PKDFLQIIDFDKDTIMKILNRAIEVKALIKSGDKSFQPFKGKTMAMIFAKPSMRTRVSFE 128

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
                LGG  I+L   ++Q+G+ E   D A+VLS Y D I+ R   H  +L+L +YA+VP
Sbjct: 129 TGFFLLGGHAIYLGPDDIQMGKREETRDVARVLSGYNDIIMARVFAHQDILDLAKYASVP 188

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA 183
           VIN LTD  HPCQI+AD +T  E  G ++     + GDGNNI+HS +  AA   +    A
Sbjct: 189 VINGLTDYNHPCQIMADALTMLEQIGRIENTKVVYVGDGNNIVHSWLLLAAVLPFHFVCA 248

Query: 184 TPIGSEPRNEYLNWARNQ-GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHVF 241
            P G EP    +  AR+   + + + +   +AVKGA  V+TD W SM Q+ +A   +  F
Sbjct: 249 CPKGFEPDANTVEIARSAGISKIEITNSPREAVKGADIVYTDVWASMGQKEEADYRKQKF 308

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           Q F V+ +LM +A P A  MHCLPA RG EV +  ++ P S+VF +AENR+H Q AI+L 
Sbjct: 309 QGFTVDEALMEIAGPQAYLMHCLPAERGVEVTDGAIEAPNSIVFPQAENRMHAQNAIMLH 368

Query: 302 CFG 304
             G
Sbjct: 369 VLG 371


>gi|312959237|ref|ZP_07773755.1| ornithine carbamoyltransferase [Pseudomonas fluorescens WH6]
 gi|311286497|gb|EFQ65060.1| ornithine carbamoyltransferase [Pseudomonas fluorescens WH6]
          Length = 306

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 135/301 (44%), Positives = 185/301 (61%), Gaps = 3/301 (0%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           M+  +HF  L + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+S
Sbjct: 1   MSA-RHFLSLMDCTPEELVSVIRRGIELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRLS 59

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  IFLS  + QLGR E I D A V+SR +DA+++RT  HS L E    + 
Sbjct: 60  FEAGMIQLGGQAIFLSPRDTQLGRGEPISDCAIVMSRMLDAVMIRTFAHSTLTEFAANSR 119

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVIN L+D+ HPCQ++AD+ TF EHRGS++GK  +W GDGNN+ +S IE A +F++ L 
Sbjct: 120 VPVINGLSDDLHPCQLLADMQTFLEHRGSIQGKTVAWIGDGNNMCNSYIEAAIQFDFHLR 179

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           IA P G EP  E+L  A  +   +    DAV            +     ++  A+   +F
Sbjct: 180 IACPEGYEPSAEFLAKADGRVQLLRDPKDAVVGAHLVSTDVWTSM--GQEDETAKRLALF 237

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
            P+QV  +L+  A PD LFMHCLPAHRGEE+  ++LD P+SV +D+AENRLH QKA+L +
Sbjct: 238 APYQVTRALLDTAAPDVLFMHCLPAHRGEEISLDLLDDPRSVAWDQAENRLHAQKALLEF 297

Query: 302 C 302
            
Sbjct: 298 L 298


>gi|300933434|ref|ZP_07148690.1| ornithine carbamoyltransferase [Corynebacterium resistens DSM
           45100]
          Length = 303

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 119/302 (39%), Positives = 177/302 (58%), Gaps = 2/302 (0%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
             KHF    +++ +  + ++E+A ++K    N      +  + +A++F+K STRTR SF+
Sbjct: 1   MVKHFLVDDDLTPAEQAEVLELAAELKADRFNNQYRDMMQRRSVAVLFDKTSTRTRFSFD 60

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
             +  LGG+ I +     Q+G+ ETI DT  VLSR+V AIV RT  H  L ++ E ATVP
Sbjct: 61  AGVTELGGNPIIVETGVSQMGKGETIQDTGAVLSRFVHAIVWRTGPHKNLTDMAETATVP 120

Query: 124 VINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLNI 182
           +I++L+D+ HPCQI+AD+ T +EH+G ++G    + GDG NN+ +S + G A     + I
Sbjct: 121 IISSLSDDYHPCQILADLQTIKEHKGRLQGLKAVYFGDGANNMANSYMLGFATAGIDVTI 180

Query: 183 ATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWIS-MNQEFKAREEHVF 241
           + P G +P+ E++  AR +             V  A      T       +    +  V 
Sbjct: 181 SAPEGFQPKPEFVERARKRAEETGATITITDEVDAAGADVVITDTWLSMGQDPNEDRSVL 240

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           + +QVN +LM+ A  DA+ MHCLPA+RG EV  EV+DG QSVVFDEAENRLH QKA+L+W
Sbjct: 241 REYQVNEALMATAADDAILMHCLPAYRGNEVTAEVIDGKQSVVFDEAENRLHAQKALLVW 300

Query: 302 CF 303
             
Sbjct: 301 LL 302


>gi|322368210|ref|ZP_08042779.1| ornithine carbamoyltransferase [Haladaptatus paucihalophilus DX253]
 gi|320552226|gb|EFW93871.1| ornithine carbamoyltransferase [Haladaptatus paucihalophilus DX253]
          Length = 297

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 132/306 (43%), Positives = 186/306 (60%), Gaps = 12/306 (3%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MT  +HF D+ ++S   ++ ++ +A + K S         LSG+ LAM+FEKPSTRTR+S
Sbjct: 1   MT--RHFLDVDDLSPEEVAEVLALASEYKES----GSPHVLSGQTLAMLFEKPSTRTRIS 54

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FE  M  LGG  IFL  ++ QL R E + DT +VLS YVDA++ R  +H  L+E+ E+AT
Sbjct: 55  FETGMTDLGGHAIFLGPNDTQLNRGEPLSDTGRVLSGYVDAVMARVFDHDSLVEMAEHAT 114

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           +P+IN L+D  HPCQ +AD+ T  EH G  +    +W GDGNN+++S    AA     L 
Sbjct: 115 IPIINGLSDVAHPCQALADLQTIREHFGGFEDLTVAWVGDGNNVVNSFAIAAATVGIDLT 174

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHV 240
           IATP G EP  + ++ A  +G    + +D   AV  A  V+TD W+SM +E +   +   
Sbjct: 175 IATPEGYEPSTDAISTAAARGPKPTVTNDPDAAVADADVVYTDVWVSMGEEDERESKLAA 234

Query: 241 FQPFQVNLSLMSMAHPD-ALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
           F  FQ+N  L+    PD    MHCLPAHRGEE+   VL+  +S+ +D+AENRLH QKA+L
Sbjct: 235 FDGFQLNEELL----PDSMPVMHCLPAHRGEEITGNVLESDRSLSWDQAENRLHAQKALL 290

Query: 300 LWCFGI 305
            +  G 
Sbjct: 291 AFLAGK 296


>gi|220930280|ref|YP_002507189.1| ornithine carbamoyltransferase [Clostridium cellulolyticum H10]
 gi|220000608|gb|ACL77209.1| ornithine carbamoyltransferase [Clostridium cellulolyticum H10]
          Length = 305

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 139/292 (47%), Positives = 201/292 (68%), Gaps = 5/292 (1%)

Query: 18  NLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLS 77
            +  ++++++K+K  ++   ++  L GK L MIF K STRTRVSFEV M  LGG ++FLS
Sbjct: 14  EIQDLLKLSEKLKRQTKEGVQHHLLKGKTLGMIFSKSSTRTRVSFEVGMYQLGGYSLFLS 73

Query: 78  GSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQI 137
            +++QLGR E+I DTA VLSRY+D I++RT N S + +L +Y T+PVIN LTD  HPCQI
Sbjct: 74  SNDIQLGRGESIFDTANVLSRYIDGIMIRTFNQSDVEDLAKYGTIPVINGLTDEMHPCQI 133

Query: 138 IADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNW 197
           +AD++T  EH+G ++G   ++ GDGNN+ HSL+ G A+    ++IA+P G E  + Y++ 
Sbjct: 134 LADLLTIYEHKGKLEGLKLAYIGDGNNVAHSLLHGCAKTGMDISIASPKGYECDSRYVDE 193

Query: 198 ARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEF-KAREEHVFQPFQVNLSLMS 252
           A+      G+ V L  D V+A+  A  V+ DTWISM QE  K  + ++F P+Q+N  L +
Sbjct: 194 AKEAAKSIGSKVVLTQDPVEAISKADVVYADTWISMGQEDQKEEKLNIFMPYQINSQLFA 253

Query: 253 MAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG 304
            A  DA+F+HCLPA+RG EV  +++DG QSV+FDEAENRLH QKA++    G
Sbjct: 254 KAKEDAIFLHCLPAYRGYEVTEDIIDGAQSVIFDEAENRLHAQKAVMATLMG 305


>gi|237798766|ref|ZP_04587227.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331021619|gb|EGI01676.1| ornithine carbamoyltransferase [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 306

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 146/298 (48%), Positives = 195/298 (65%), Gaps = 4/298 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +HF  + + +   L  +I    ++K+        +PL  +VL MIFEK STRTR+SFE  
Sbjct: 4   RHFLSMMDYTPDELLGMIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRLSFEAG 63

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M  LGG  IFLS  + QLGR E I D+AKV+SR +DA+++RT  HS L E    + VPVI
Sbjct: 64  MIQLGGQAIFLSHRDTQLGRGEPIADSAKVMSRMLDAVMIRTYAHSNLTEFAANSRVPVI 123

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D+ HPCQ++AD+ TF EHRGS+KGK  +W GDGNN+ +S IE A +F++ L +A P
Sbjct: 124 NGLSDDLHPCQLLADMQTFLEHRGSIKGKTVAWIGDGNNMCNSYIEAAIQFDFQLRVACP 183

Query: 186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-AREEHVFQPF 244
            G EP  ++L  A   G  V +  D   AV GAH V TD W SM QE + AR + +F PF
Sbjct: 184 AGYEPSPQFLALA---GDRVTVVRDPKAAVTGAHLVSTDVWTSMGQEEETARRKALFAPF 240

Query: 245 QVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC 302
           QV  +L+ +A  D LFMHCLPAHRGEE+  ++LD  +SV +D+AENRLH QKA+L + 
Sbjct: 241 QVTRALLDLAASDVLFMHCLPAHRGEEISADLLDDSRSVAWDQAENRLHAQKALLEFL 298


>gi|229492690|ref|ZP_04386491.1| ornithine carbamoyltransferase [Rhodococcus erythropolis SK121]
 gi|229320349|gb|EEN86169.1| ornithine carbamoyltransferase [Rhodococcus erythropolis SK121]
          Length = 313

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 138/307 (44%), Positives = 193/307 (62%), Gaps = 10/307 (3%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSG-KVLAMIFEKPSTRTRVSF 62
             KHF    +++ +  + ++E+A  +K   ++ F  +PL G + + +IFEK STRTR SF
Sbjct: 1   MVKHFLRDDDLTPAQQAEVLELAAILK---KDPFARRPLEGPRGVGVIFEKNSTRTRFSF 57

Query: 63  EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATV 122
           E+ +  +GG  + + G   QLGR ET+ DT +VLSRYVDA+V RT    RL ++   AT+
Sbjct: 58  EMGIAQMGGHAVVVDGRSTQLGREETLADTGRVLSRYVDAVVWRTFGQKRLEQMATGATI 117

Query: 123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLN 181
           P++NAL+D  HPCQ++AD+ T  E +G +KG   ++ GDG NN+ HSL+ G       + 
Sbjct: 118 PIVNALSDEFHPCQVLADLQTLIEQKGELKGLKLTYLGDGANNMAHSLMLGGVTAGIDVT 177

Query: 182 IATPIGSEPRNEYL----NWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-R 236
           IA+P G EP +  +      A   GA++ L  D    V GA  + TDTW SM QE     
Sbjct: 178 IASPAGFEPADWVVAAARKRAEETGATITLTQDPQAGVVGADALVTDTWTSMGQENDGLD 237

Query: 237 EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQK 296
               F+PFQ+N  L++ A P A+ +HCLPAHRGEEV +EVLDGPQSVV+DEAENRLH QK
Sbjct: 238 RVGPFRPFQINKELLAKADPKAVVLHCLPAHRGEEVTDEVLDGPQSVVWDEAENRLHAQK 297

Query: 297 AILLWCF 303
           A+L+W  
Sbjct: 298 ALLVWLL 304


>gi|94266020|ref|ZP_01289741.1| Aspartate carbamoyltransferase [delta proteobacterium MLMS-1]
 gi|93453415|gb|EAT03837.1| Aspartate carbamoyltransferase [delta proteobacteriu