RPSBLAST alignment for GI: 255764473 and conserved domain: PRK13814

>gnl|CDD|139876 PRK13814, pyrB, aspartate carbamoyltransferase catalytic subunit; Provisional. Length = 310
 Score = 69.7 bits (170), Expect = 8e-13
 Identities = 78/310 (25%), Positives = 137/310 (44%), Gaps = 22/310 (7%)

Query: 1   MMTYPKHFADLSNISSSNLSCIIEVAKKI------KNSSENIFENKPLSGKVLAMIFEKP 54
           M   P H  ++ +++  ++  +I+ A         KNS   +FE   L G V+A +F +P
Sbjct: 1   MNELPLHLLNMRSLTRDHIEKLIQRANYFLTQGMEKNS---VFET--LKGHVVANLFFEP 55

Query: 55  STRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRY--VDAIVMRTTNHSR 112
           STRTR SFE+A K LG   +  +     + + ET+ DT K L        IV  + N + 
Sbjct: 56  STRTRNSFEIAAKRLGAMVLNPNLKISAISKGETLFDTIKTLEAMGVYFFIVRHSENETP 115

Query: 113 LLELTEYATVPVINALTDN-THPCQIIADIMTFEEHRGSVKGKLFSWSGD--GNNILHSL 169
                + ++  VINA   N  HP Q + D+MT ++H+        +  GD   + + +SL
Sbjct: 116 EQIAKQLSSGVVINAGDGNHQHPSQALIDLMTIKQHKPHWNKLCVTIIGDIRHSRVANSL 175

Query: 170 IEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM 229
           ++G      L+ +  P         L   +    S+  F +   ++  +  + T      
Sbjct: 176 MDG------LVTMGVPEIRLVGPSSLLPDKVGNDSIKKFTELKPSLLNSDVIVTLRLQKE 229

Query: 230 NQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAE 289
             +     +     F++    +  A PDA+ MH  P +R  E+ ++V D  QSV+  +  
Sbjct: 230 RHDNSVDIDAFRGSFRLTPEKLYSAKPDAIVMHPGPVNREVEINSDVADNQQSVILQQVR 289

Query: 290 NRLHTQKAIL 299
           N +  + A+L
Sbjct: 290 NGVAMRMAVL 299