RPSBLAST alignment for GI: 255764473 and conserved domain: PRK04284

>gnl|CDD|167776 PRK04284, PRK04284, ornithine carbamoyltransferase; Provisional. Length = 332
 Score =  234 bits (598), Expect = 3e-62
 Identities = 112/325 (34%), Positives = 177/325 (54%), Gaps = 26/325 (8%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           + F  L + +   +  ++++++ +K +     E + L GK +A+IFEK STRTR +FEVA
Sbjct: 7   RSFLTLLDFTPKEIEYLLDLSEDLKRAKYAGIEVQKLKGKNIALIFEKDSTRTRCAFEVA 66

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
               G    +L  +  Q+G+ E+  DTA+VL    D I  R  +   +  L EY+ VPV 
Sbjct: 67  AYDQGAHVTYLGPTGSQMGKKESTKDTARVLGGMYDGIEYRGFSQRTVETLAEYSGVPVW 126

Query: 126 NALTDNTHPCQIIADIMTFEEH-RGSVKGKLFSWSGDG-NNILHSLIEGAARFNYLLNIA 183
           N LTD  HP Q++AD +T +EH +   K   F++ GDG NN+ ++L++GAA      ++ 
Sbjct: 127 NGLTDEDHPTQVLADFLTAKEHLKKPYKDIKFTYVGDGRNNVANALMQGAAIMGMDFHLV 186

Query: 184 TPIGSEPRNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEH 239
            P    P +E LN  +      G  + +  D  + VKG+  ++TD W+SM +  +  EE 
Sbjct: 187 CPKELNPDDELLNKCKEIAAETGGKITITDDIDEGVKGSDVIYTDVWVSMGEPDEVWEER 246

Query: 240 V--FQPFQVNLSLMSMA-HPDALFMHCLPA-H----------------RGEEVINEVLDG 279
           +   +P+QVN  +M    +P+A+F HCLP+ H                +  EV +EV + 
Sbjct: 247 IKLLKPYQVNKEMMKKTGNPNAIFEHCLPSFHDLDTKVGKEIFEKYGLKEMEVTDEVFES 306

Query: 280 PQSVVFDEAENRLHTQKAILLWCFG 304
             SVVFDEAENR+HT KA+++   G
Sbjct: 307 KASVVFDEAENRMHTIKAVMVATLG 331