RPSBLAST alignment for GI: 255764473 and conserved domain: PRK08192

>gnl|CDD|169269 PRK08192, PRK08192, aspartate carbamoyltransferase; Provisional. Length = 338
 Score = 79.0 bits (195), Expect = 1e-15
 Identities = 49/129 (37%), Positives = 70/129 (54%), Gaps = 8/129 (6%)

Query: 22  IIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGG---DTIFLSG 78
           I  VA +++  +      + L G +L  +F +PSTRTRVSF  A   LGG   +T  ++ 
Sbjct: 22  IFNVADRMEPYALREKRTRVLEGAILGNLFFEPSTRTRVSFGCAFNLLGGHVRETTGMAS 81

Query: 79  SEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTD--NTHPCQ 136
           S   L + E++ DTA+VLS Y D I MR  +   + E  E + VPVIN   D  N HP Q
Sbjct: 82  S--SLSKGESLYDTARVLSTYSDVIAMRHPDAGSVKEFAEGSRVPVING-GDGSNEHPTQ 138

Query: 137 IIADIMTFE 145
            + D+ T +
Sbjct: 139 ALLDLFTIQ 147