RPSBLAST alignment of GI: 255764473 and protein with PDBid: 3d6n

>3d6n_B Aspartate carbamoyltransferase; reactor, chamber, pores, internal cavity, hydrolase, metal- binding, pyrimidine biosynthesis, zinc; HET: FLC; 2.30A {Aquifex aeolicus} Length = 291
 Score =  261 bits (669), Expect = 1e-70
 Identities = 69/305 (22%), Positives = 124/305 (40%), Gaps = 23/305 (7%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +      +++   +  I++ AK+ K         +        + F +PSTRTR+SFE A
Sbjct: 2   RSLISSLDLTREEVEEILKYAKEFKEG------KEETIKASAVLFFSEPSTRTRLSFEKA 55

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRY-VDAIVMRTTNHSRL-LELTEYATVP 123
            + LG +T  +SGSE    + E+  DT K       D +V R         E+ +   + 
Sbjct: 56  ARELGIETYLVSGSESSTVKGESFFDTLKTFEGLGFDYVVFRVPFVFFPYKEIVKSLNLR 115

Query: 124 VINALTDN-THPCQIIADIMTFEEHRGSVKGKLFSWSGDG--NNILHSLIEGAARFNYLL 180
           ++NA      HP Q + D  T +EH G VK     + GD   + +  S       F   +
Sbjct: 116 LVNAGDGTHQHPSQGLIDFFTIKEHFGEVKDLRVLYVGDIKHSRVFRSGAPLLNMFGAKI 175

Query: 181 NIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQ--EFKAREE 238
            +  P    PR+        +   V +F D  + +  A  V         Q   +   E 
Sbjct: 176 GVCGPKTLIPRDV-------EVFKVDVFDDVDKGIDWADVVIWLRLQKERQKENYIPSES 228

Query: 239 HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAI 298
             F+ F +            L+MH  P +R  ++ +E++   +S++ ++ +N +  +KAI
Sbjct: 229 SYFKQFGLTKERFE---KVKLYMHPGPVNRNVDIDHELVYTEKSLIQEQVKNGIPVRKAI 285

Query: 299 LLWCF 303
             + +
Sbjct: 286 YKFLW 290