BLASTP 2.2.22 [Sep-27-2009]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,
Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005.
Query= gi|255764475|ref|YP_003084341.1| hypothetical protein
CLIBASIA_03592 [Candidatus Liberibacter asiaticus str. psy62]
(59 letters)
Database: nr
14,124,377 sequences; 4,842,793,630 total letters
Searching..................................................done
>gi|255764475|ref|YP_003084341.1| hypothetical protein CLIBASIA_03592 [Candidatus Liberibacter
asiaticus str. psy62]
gi|254547826|gb|ACT66817.1| hypothetical protein CLIBASIA_03592 [Candidatus Liberibacter
asiaticus str. psy62]
Length = 59
Score = 83.4 bits (205), Expect = 9e-15, Method: Composition-based stats.
Identities = 59/59 (100%), Positives = 59/59 (100%)
Query: 1 MVKSIPAIVPNTAILQENNVQISIPFPMPIVAMPAIILWLIITLLRGYCREYIIFLSRL 59
MVKSIPAIVPNTAILQENNVQISIPFPMPIVAMPAIILWLIITLLRGYCREYIIFLSRL
Sbjct: 1 MVKSIPAIVPNTAILQENNVQISIPFPMPIVAMPAIILWLIITLLRGYCREYIIFLSRL 59
Database: nr
Posted date: May 22, 2011 12:22 AM
Number of letters in database: 999,999,966
Number of sequences in database: 2,987,313
Database: /data/usr2/db/fasta/nr.01
Posted date: May 22, 2011 12:30 AM
Number of letters in database: 999,999,796
Number of sequences in database: 2,903,041
Database: /data/usr2/db/fasta/nr.02
Posted date: May 22, 2011 12:36 AM
Number of letters in database: 999,999,281
Number of sequences in database: 2,904,016
Database: /data/usr2/db/fasta/nr.03
Posted date: May 22, 2011 12:41 AM
Number of letters in database: 999,999,960
Number of sequences in database: 2,935,328
Database: /data/usr2/db/fasta/nr.04
Posted date: May 22, 2011 12:46 AM
Number of letters in database: 842,794,627
Number of sequences in database: 2,394,679
Lambda K H
0.332 0.146 0.447
Lambda K H
0.267 0.0464 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 783,591,806
Number of Sequences: 14124377
Number of extensions: 29000476
Number of successful extensions: 88095
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 88094
Number of HSP's gapped (non-prelim): 1
length of query: 59
length of database: 4,842,793,630
effective HSP length: 32
effective length of query: 27
effective length of database: 4,390,813,566
effective search space: 118551966282
effective search space used: 118551966282
T: 11
A: 40
X1: 16 ( 7.7 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (22.0 bits)
S2: 76 (33.7 bits)