BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|255764475|ref|YP_003084341.1| hypothetical protein CLIBASIA_03592 [Candidatus Liberibacter asiaticus str. psy62] (59 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|255764475|ref|YP_003084341.1| hypothetical protein CLIBASIA_03592 [Candidatus Liberibacter asiaticus str. psy62] Length = 59 Score = 116 bits (290), Expect = 7e-29, Method: Compositional matrix adjust. Identities = 59/59 (100%), Positives = 59/59 (100%) Query: 1 MVKSIPAIVPNTAILQENNVQISIPFPMPIVAMPAIILWLIITLLRGYCREYIIFLSRL 59 MVKSIPAIVPNTAILQENNVQISIPFPMPIVAMPAIILWLIITLLRGYCREYIIFLSRL Sbjct: 1 MVKSIPAIVPNTAILQENNVQISIPFPMPIVAMPAIILWLIITLLRGYCREYIIFLSRL 59 >gi|254780661|ref|YP_003065074.1| exonuclease I [Candidatus Liberibacter asiaticus str. psy62] Length = 471 Score = 20.4 bits (41), Expect = 6.1, Method: Composition-based stats. Identities = 7/13 (53%), Positives = 10/13 (76%) Query: 9 VPNTAILQENNVQ 21 VPNT I+ NN++ Sbjct: 88 VPNTCIIGYNNIR 100 >gi|254780673|ref|YP_003065086.1| pyruvate dehydrogenase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 467 Score = 20.0 bits (40), Expect = 7.7, Method: Composition-based stats. Identities = 8/22 (36%), Positives = 11/22 (50%) Query: 10 PNTAILQENNVQISIPFPMPIV 31 PN I EN + F +P+V Sbjct: 301 PNPVIFLENEILYGSSFEVPMV 322 >gi|254780425|ref|YP_003064838.1| apolipoprotein N-acyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 518 Score = 20.0 bits (40), Expect = 8.1, Method: Compositional matrix adjust. Identities = 7/14 (50%), Positives = 10/14 (71%) Query: 24 IPFPMPIVAMPAII 37 +PFP IV P+I+ Sbjct: 290 LPFPFSIVDQPSIL 303 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.332 0.146 0.447 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,714 Number of Sequences: 1233 Number of extensions: 1033 Number of successful extensions: 4 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 59 length of database: 328,796 effective HSP length: 31 effective length of query: 28 effective length of database: 290,573 effective search space: 8136044 effective search space used: 8136044 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (22.0 bits) S2: 31 (16.5 bits)