>TIGR00229 sensory_box PAS domain S-box; InterPro: IPR000014 PAS domains are involved in many signalling proteins where they are used as a signal sensor domain. PAS domains appear in archaea, bacteria and eukaryotes. Several PAS-domain proteins are known to detect their signal by way of an associated cofactor. Haeme, flavin, and a 4-hydroxycinnamyl chromophore are used in different proteins. The PAS domain was named after three proteins that it occurs in: Per- period circadian protein Arnt- Ah receptor nuclear translocator protein Sim- single-minded protein. PAS domains are often associated with PAC domains IPR001610 from INTERPRO. It appears that these domains are directly linked, and that together they form the conserved 3D PAS fold. The division between the PAS and PAC domains is caused by major differences in sequences in the region connecting these two motifs . In human PAS kinase, this region has been shown to be very flexible, and adopts different conformations depending on the bound ligand . Probably the most surprising identification of a PAS domain was that in EAG-like K^+-channels . ; GO: 0004871 signal transducer activity, 0007165 signal transduction.

Probab=98.41 E-value=3.4e-06 Score=60.34 Aligned_cols=115 Identities=18% Similarity=0.263 Sum_probs=70.4 Q ss_pred HHHHHHHHCCCCEEEECCCCEEEEECHHHHHHHCCCHHHHCCCCCHHHHHHHHHHHCCCCHHHH-HHHHHHHCCCCCCCE Q ss_conf 9999996203432899689848864058887828987894389838898877763025611468-899874026544311 Q gi|255764476|r 435 VQGETIDHLSEGVAVFGPDGRIKLSNPAFRSLWKTEENRLSPGTHIRNIAATCSRYYNESDGWD-LFAAIITSFDDERKS 513 (792) Q Consensus 435 ~q~~~ld~l~e~vav~~~dgr~~~~N~a~~~l~g~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~i~~~~~~r~~ 513 (792) T Consensus 6 ~~~~~~e~~~~~~~~~d~~g~~~~~n~~~~~~~Gy~~~e~~g~~~~~-~~~~-----~~~~~~~~~~~~~~~~~~~~~~~ 79 (130) T TIGR00229 6 RYRAIFESSPDAIIVVDLEGNILYVNPAFEELFGYSAEELLGRNVLE-LIPE-----EDREELRERIERLLETGEREPVS 79 (130) T ss_pred HHHHHHHCCCCCEEEEECCCCEEEECHHHHHHHCCCHHHHCCCCCCC-CCCC-----CHHHHHHHHHHHHHCCCCCCCCE T ss_conf 99998622454268870576157503257776178758953875100-0276-----41468999998763267543201 Q ss_pred EEEEE--EECCEEEE--EEEEEECC--CCC---EEEECCCCHHHHHHHHHH Q ss_conf 56899--97250388--89999705--887---663123206899998888 Q gi|255764476|r 514 LQGTL--ELLSDSVL--EYSIIPLP--NAQ---TMLTFVNVTDSVRAERAL 555 (792) Q Consensus 514 ~~~~~--~~~dG~~~--~~~~~pl~--dg~---~l~~~~DIT~~k~~E~aL 555 (792) T Consensus 80 ~~~~~~~~~~~G~~~~~~~~~~~~~~~~g~~~~~~~~~~d~t~~~~~~~~l 130 (130) T TIGR00229 80 EERRVLGRRKDGSEIWVEVSVSPIRDSNGGVLGVLGIVRDITERKEAEEAL 130 (130) T ss_pred EEEEEEEECCCCCEEEEEEECCCCCCCCCCEEEEEEEEECHHHHHHHHHCC T ss_conf 234666443789688998730100001377036776652114789988509

HHsearch alignment for GI: 255764476 and conserved domain: TIGR00229