HHsearch alignment for GI: 255764477 and conserved domain: TIGR00455

>TIGR00455 apsK adenylylsulfate kinase; InterPro: IPR002891 Enzyme that catalyses the phosphorylation of adenylylsulphate to 3'-phosphoadenylylsulphate. This domain contains an ATP binding P-loop motif .; GO: 0005524 ATP binding, 0016301 kinase activity, 0016772 transferase activity transferring phosphorus-containing groups, 0000103 sulfate assimilation.
Probab=97.90  E-value=3.2e-06  Score=59.46  Aligned_cols=148  Identities=22%  Similarity=0.328  Sum_probs=73.1

Q ss_pred             EEEEEECCCCCCHHHHHHHHHH----CC--CEEEEHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHH--HHHHH
Q ss_conf             5999888866678999999997----79--8699904999998500001135665310001222111000111--10012
Q gi|255764477|r    2 LIIGLTGSIGTGKTTVAEFLKK----EK--IPVISSDDIVDKLYHYEAVDIIKKTFPRSIQNNKVNKARLLGI--LQKSP   73 (199)
Q Consensus         2 ~iIgitG~igSGKStv~~~l~~----~G--~~v~~aD~i~~~l~~~~~~~~i~~~fg~~i~~~~i~r~~l~~~--vf~~~   73 (199)
T Consensus        20 ~vlWlTGLSGsGKsTiA~Al~~~L~~~G~~~~~LDGDnvR~gL~~dLGFS~~---------DR~eNIRRigEVa~L~~~~   90 (187)
T TIGR00455        20 VVLWLTGLSGSGKSTIANALEKKLEKKGYRVYVLDGDNVRHGLNKDLGFSEE---------DRKENIRRIGEVAKLLVRN   90 (187)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHCCCEEEEECCCEEECCCCCCCCCCHH---------HHCCCCCEEHHHHHHHHHC
T ss_conf             8985116885635799999999999669749997586342477888888856---------7056883532646777647


Q ss_pred             HHHHHHHHHHHHH--HHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCHHHHHHH------HHHCCC
Q ss_conf             4678887534899--99999976677420247633345643255587564227899952111356888------871798
Q gi|255764477|r   74 AKLEILEKIVHPM--VRMHEKKILHDLSCRGEKIVFFDTPLLFEKRKEYLFDAVVVVTCSFETQRERV------LSRKKH  145 (199)
Q Consensus        74 ~~l~~L~~iiHP~--V~~~~~~~i~~~~~~~~~~vv~e~pLL~E~~~~~~~d~vi~V~a~~~~r~~Rl------~~R~~~  145 (199)
T Consensus        91 -G~i~ltsfISPyR~~R~~vR~~~~~~-----Gl~F~E----------------vfv~~PL~vcE~RDPKGLYkKAR~G-  147 (187)
T TIGR00455        91 -GVIVLTSFISPYRADRQMVRELIEEG-----GLEFIE----------------VFVKCPLEVCEQRDPKGLYKKARNG-  147 (187)
T ss_pred             -CEEEEEEEECCCHHHHHHHHHHHHCC-----CEEEEE----------------EECCCCHHHHCCCCCCCHHHHHHCC-
T ss_conf             -93899842177666789998875405-----736899----------------7217886863268985023886468-


Q ss_pred             CHHHHHHHHHCCCCHHHHHHHCCEEEECCC-CHHHHHHHHH
Q ss_conf             989999999729997899986898998799-9899999999
Q gi|255764477|r  146 TEENFLFILSKQMNEKDKISRADYVINTEG-TIEAIEKETQ  185 (199)
Q Consensus       146 s~e~~~~~~~~Q~~~~~k~~~aD~vI~N~~-s~~~l~~~i~  185 (199)
T Consensus       148 EIk~FTGID~----pYE~P~~Pe~~~~tD~~~~~~~~~~i~  184 (187)
T TIGR00455       148 EIKGFTGIDS----PYEAPENPEVVLDTDQEDVEECVQQII  184 (187)
T ss_pred             CCCCCCCCCC----CCCCCCCCEEEEECCCHHHHHHHHHHH
T ss_conf             8865678788----778699870688377233888999999