HHsearch alignment for GI: 255764477 and conserved domain: cd03114

>cd03114 ArgK-like The function of this protein family is unkown. The protein sequences are similar to the ArgK protein in E. coli. ArgK protein is a membrane ATPase which is required for transporting arginine, ornithine and lysine into the cells by the arginine and ornithine (AO system) and lysine, arginine and ornithine (LAO) transport systems.
Probab=96.20  E-value=0.0043  Score=39.84  Aligned_cols=41  Identities=20%  Similarity=0.184  Sum_probs=27.1

Q ss_pred             HHHHHHHHCCCCCCCCCCC--CCCCCCCCCCCCEEEEEEECCC
Q ss_conf             9766774202476333456--4325558756422789995211
Q gi|255764477|r   92 KKILHDLSCRGEKIVFFDT--PLLFEKRKEYLFDAVVVVTCSF  132 (199)
Q Consensus        92 ~~~i~~~~~~~~~~vv~e~--pLL~E~~~~~~~d~vi~V~a~~  132 (199)
T Consensus        81 ~~~i~~l~~~g~D~IiIETvGvGQse~~i~~~aD~~i~v~~p~  123 (148)
T cd03114          81 PEVIRVLDAAGFDVIIVETVGVGQSEVDIASMADTTVVVMAPG  123 (148)
T ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHCCEEEEEECCC
T ss_conf             9999999975999899974877756026554356699996368