>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others. Members of this class of enzymes include Enterococcus faecium streptogramin A acetyltransferase and Pseudomonas aeruginosa chloramphenicol acetyltransferase. They contain repeated copies of a six-residue hexapeptide repeat sequence motif (X-[STAV]-X-[LIV]-[GAED]-X) and adopt a left-handed parallel beta helix (LbH) structure. The active enzyme is a trimer with CoA and substrate binding sites at the interface of two separate LbH subunits. XATs are implicated in inactivating xenobiotics leading to xenobiotic resistance in patients.

Probab=99.85 E-value=3.2e-21 Score=153.17 Aligned_cols=68 Identities=35% Similarity=0.537 Sum_probs=62.9 Q ss_pred CCCEECCCEEECCCCCCCCCEEEECCCEEECCCCCCCCCCCCCHHHHCCCCCCCCCCCHHHHCCCCHHHHHHHHHH Q ss_conf 5532148606523444336506404743501321122333310001074532334420144428889999999999 Q gi|255764481|r 145 GHVIVDDRVVFGGGSAVHQFTRIGKYAFIGGMTGVVHDVIPYGILNGNPGALRGVNVVAMRRAGFSRDTIHLIRAV 220 (271) Q Consensus 145 G~v~Igd~~~IG~~~~v~~~v~IG~~a~ig~gs~V~kdVpp~~~~~G~pa~~~~~N~~glkR~g~s~e~i~~l~~a 220 (271) T Consensus 72 ~~i~Ig~~vwIG~n~~Il~GV~IG~gavIgAgSvVtkdvp~~~i~~G~PAk~i--------k~Rf~~~~~~~l~~~ 139 (145) T cd03349 72 GDVIIGNDVWIGHGATILPGVTIGDGAVIAAGAVVTKDVPPYAIVGGNPAKVI--------RYRFDEETIERLLAL 139 (145) T ss_pred CCEEECCCEEECCCCEEECCCEECCCCEEECCCEECCCCCCCCEEEEECCEEE--------ECCCCHHHHHHHHHC T ss_conf 99798899699998889588096788689289789704699949983388788--------155999999999876

HHsearch alignment for GI: 255764481 and conserved domain: cd03349