>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase; InterPro: IPR011023 This domain is found in archaeal, bacterial and eukaryotic proteins. In the archaea and bacteria, they are primarily restricted to the euryarchaeota and proteobacteria respectively; where they are either described as either nucleolar protein or tRNA/rRNA cytosine-C5-methylase. They all have the S-adenosyl methionine (SAM) binding domain and are related to bacterial Fmu (16S rRNA m5C 967 methyltransferase) where the structure of the methyl transferase domain has been determined . In the eukaryota, the majority are annotated as being 'nucleolar protein'. None of the eukaryotic members in this family have a the SAM binding signature. Despite this, the yeast Nop2p is a probable RNA m(5)C methyltransferase, essential for processing and maturation of 27S pre-rRNA and large ribosomal subunit biogenesis ; localised to the nucleolus and is essential for viability . Reduced Nop2p expression limits yeast growth and decreases levels of mature 60S ribosomal subunits while altering rRNA processing . There is substantial identity between Nop2p and human p120 (NOL1), which is also called the proliferation-associated nucleolar antigen , . .

Probab=98.73 E-value=7.4e-08 Score=63.55 Aligned_cols=129 Identities=16% Similarity=0.199 Sum_probs=99.1 Q ss_pred CCC--CCCEEEEECCCHHHHHHHHHHHCCC-CEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC Q ss_conf 998--5578999587843899999986799-8899998898999988999998066452225302004442353100001 Q gi|255764482|r 8 NAT--GSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA 84 (225) Q Consensus 8 ~~~--~~~~VLDlGcG~G~~~l~la~r~~~-~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~ 84 (225) T Consensus 72 ~p~Gn~~~~vlD~AAaPGgKTT~is~~m~N~G~i~Ane~~ksR~k~L~~NI~R~G~~n----~~v~~~DgR~f~~~~~~- 146 (284) T TIGR00446 72 EPEGNEKERVLDMAAAPGGKTTQISALMKNEGAIVANEVSKSRTKVLIANINRMGVLN----VAVINVDGRKFGAVVLK- 146 (284) T ss_pred CCCCCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHEE----EEEEECCCCHHHHHHCC- T ss_conf 7787688879997408896489999986588518997376341066786555621003----33241376300123144- Q ss_pred CCCCCCCCEEEECCCCCCCCCCCCCCHHH-----HHHHCCCCCCHHHHHHHHHHHCCC----CCEEEEE Q ss_conf 23576520577226544644654788545-----565205668989999999986246----9837870 Q gi|255764482|r 85 GLKNNFYDHVIMNPPFNERIGTMTPDKIK-----EEAHVMLEDSFEKWIRTACAIMRS----SGQLSLI 144 (225) Q Consensus 85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~~-----~~a~~~~~~~~~~~~~~a~~lLkp----gG~~~~i 144 (225) T Consensus 147 --~eifFD~iLLDAPCSG~GvI-~KD~~~~~~~~~eD~~~~s~lQkeL~~~A~d~lk~nskhGGv~VYS 212 (284) T TIGR00446 147 --MEIFFDRILLDAPCSGEGVI-RKDPSRKKNRSEEDILEISKLQKELILAAFDALKPNSKHGGVLVYS 212 (284) T ss_pred --CEEEEEEEEECCCCCCCCEE-EECHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEE T ss_conf --30343214525787988337-6572331147724577646767999999987504456668888985

HHsearch alignment for GI: 255764482 and conserved domain: TIGR00446