RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|255764482|ref|YP_003065169.2| methyltransferase protein [Candidatus Liberibacter asiaticus str. psy62] (225 letters) >gnl|CDD|33880 COG4123, COG4123, Predicted O-methyltransferase [General function prediction only]. Length = 248 Score = 168 bits (427), Expect = 1e-42 Identities = 57/223 (25%), Positives = 109/223 (48%), Gaps = 10/223 (4%) Query: 1 MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60 ++LA+ + DLGAG GA GL +A R +A+I+ E A A++ +AL Sbjct: 34 ILLAAFAPVPKKGRILDLGAGNGALGLLLAQRTEKAKIVGVEIQEEAAEMAQRNVAL--- 90 Query: 61 AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120 + +RI +IE D+ + +D +I NPP+ ++ + + ++ A + Sbjct: 91 NPLEERIQVIEADIKEFLKAL-----VFASFDLIICNPPYFKQGSRLNENPLRAIARHEI 145 Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASR 179 E IR A +++ G+L+ + RP+ L +I+ + I ++P+ G+ A+R Sbjct: 146 TLDLEDLIRAAAKLLKPGGRLAFVHRPERLAEIIELLKSYNLEPKRIQFVYPKIGKAANR 205 Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSL 222 +LV KG + L+ P+++H +G+ Y+ V ++ G Sbjct: 206 VLVEAIKGGKSGLKVLPPLIIHDEDGE-YTEEVKEIYQGFYLK 247 >gnl|CDD|147386 pfam05175, MTS, Methyltransferase small domain. This domain is found in ribosomal RNA small subunit methyltransferase C as well as other methyltransferases . Length = 170 Score = 49.5 bits (119), Expect = 7e-07 Identities = 32/144 (22%), Positives = 56/144 (38%), Gaps = 25/144 (17%) Query: 2 ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANA 61 +L S + + DLG G G G A+A R + ++ + + + AR LA AN Sbjct: 22 LLLSHLPKPLGGKVLDLGCGYGVLGAALAKRSPDLEVTMVDINARALESARANLA--ANG 79 Query: 62 QISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLE 121 + + D+ + ++ +D +I NPPF G T + A Sbjct: 80 --LENGEVFWSDL--------YSAVEPGKFDLIISNPPF--HAGKATDYDV---AQRF-- 122 Query: 122 DSFEKWIRTACAIMRSSGQLSLIA 145 I A ++ G+L ++A Sbjct: 123 ------IAGAARHLKPGGELWIVA 140 >gnl|CDD|32642 COG2813, RsmC, 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis]. Length = 300 Score = 42.6 bits (100), Expect = 9e-05 Identities = 27/132 (20%), Positives = 51/132 (38%), Gaps = 26/132 (19%) Query: 14 HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73 + DLG G G GL +A + +A++ L + + ARK LA + + + Sbjct: 161 KVLDLGCGYGVLGLVLAKKSPQAKLTLVDVNARAVESARKNLAANG----VENTEVWASN 216 Query: 74 VTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACA 133 + E + +D +I NPPF+ + ++ I A Sbjct: 217 LYEPVEGK---------FDLIISNPPFHAGKAV-------------VHSLAQEIIAAAAR 254 Query: 134 IMRSSGQLSLIA 145 ++ G+L ++A Sbjct: 255 HLKPGGELWIVA 266 >gnl|CDD|32715 COG2890, HemK, Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis]. Length = 280 Score = 41.1 bits (96), Expect = 2e-04 Identities = 38/185 (20%), Positives = 73/185 (39%), Gaps = 22/185 (11%) Query: 12 SFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIE 71 + DLG G+GA +A+A +A+++ + SP AR+ NA+ + + ++ Sbjct: 111 DKRILDLGTGSGAIAIALAKEGPDAEVIAVDISPDALALARE------NAERNGLVRVLV 164 Query: 72 VDVTLVGENRNLAGLKNNFYDHVIMNPPF-NERIGTMTPDKIKEEAHVML------EDSF 124 V L L+ F D ++ NPP+ + P+ ++ E + L + + Sbjct: 165 VQSDL------FEPLRGKF-DLIVSNPPYIPAEDPELLPEVVRYEPLLALVGGGDGLEVY 217 Query: 125 EKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTG 184 + + A I++ G L L + V A G EI R+++ Sbjct: 218 RRILGEAPDILKPGGVLILEIGLTQG-EAVKALFEDTGFFEIVETLKDLFG-RDRVVLAK 275 Query: 185 RKGMR 189 + R Sbjct: 276 LRSER 280 >gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy). There are at least five structurally distinct families of AdoMet-MTases, class I being the largest and most diverse. Within this class enzymes can be classified by different substrate specificities (small molecules, lipids, nucleic acids, etc.) and different target atoms for methylation (nitrogen, oxygen, carbon, sulfur, etc.).. Length = 107 Score = 39.0 bits (91), Expect = 0.001 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 11/84 (13%) Query: 17 DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76 DLG G GA LA+AS A++ + SP+ ARK A A ++ + +++ D Sbjct: 4 DLGCGTGALALALASG-PGARVTGVDISPVALELARKAAA----ALLADNVEVLKGDA-- 56 Query: 77 VGENRNLAGLKNNFYDHVIMNPPF 100 L + +D +I +PP Sbjct: 57 ----EELPPEADESFDVIISDPPL 76 >gnl|CDD|30770 COG0421, SpeE, Spermidine synthase [Amino acid transport and metabolism]. Length = 282 Score = 32.2 bits (73), Expect = 0.11 Identities = 18/80 (22%), Positives = 29/80 (36%), Gaps = 6/80 (7%) Query: 18 LGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLV 77 +G G G V L +I + E P + ARK L P+ R+ +I D Sbjct: 83 IGGGDGGTLREVLKHLPVERITMVEIDPAVIELARKYLPEPSGGADDPRVEIIIDDG--- 139 Query: 78 GENRNLAGLKNNFYDHVIMN 97 +D +I++ Sbjct: 140 ---VEFLRDCEEKFDVIIVD 156 >gnl|CDD|38115 KOG2904, KOG2904, KOG2904, Predicted methyltransferase [General function prediction only]. Length = 328 Score = 32.3 bits (73), Expect = 0.11 Identities = 33/148 (22%), Positives = 58/148 (39%), Gaps = 19/148 (12%) Query: 14 HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPA-NAQISKRISLIEV 72 H+ DLG G+GA L++ L + + + S + L NAQ K IEV Sbjct: 151 HILDLGTGSGAISLSLLHGLPQCTVTAIDVSK-------AAIKLAKENAQRLKLSGRIEV 203 Query: 73 -DVTLVGENRNLAGLKNNFYDHVIMNPP--FNERIGTMTPDKIKEEAHVMLE------DS 123 + + + L D ++ NPP + + P+ E + L+ D+ Sbjct: 204 IHNIMESDASDEHPLLEGKIDLLVSNPPYIRKDDNRQLKPEVRLYEPKLALDGGLEGYDN 263 Query: 124 FEKWIRTACAIMRSSG--QLSLIARPQS 149 + A +++ G QL L+ R + Sbjct: 264 LVHYWLLATRMLQPGGFEQLELVERKEH 291 >gnl|CDD|31085 COG0742, COG0742, N6-adenine-specific methylase [DNA replication, recombination, and repair]. Length = 187 Score = 31.4 bits (71), Expect = 0.19 Identities = 22/109 (20%), Positives = 43/109 (39%), Gaps = 8/109 (7%) Query: 14 HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73 + DL AG+GA GL SR A+++ E+ ++ L + ++ D Sbjct: 46 RVLDLFAGSGALGLEALSR-GAARVVFVEKDRKAVKILKENL---KALGLEGEARVLRND 101 Query: 74 VTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED 122 + G + F D V ++PP+ + + + E + L+ Sbjct: 102 ALRALKQ---LGTREPF-DLVFLDPPYAKGLLDKELALLLLEENGWLKP 146 >gnl|CDD|30465 COG0116, COG0116, Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair]. Length = 381 Score = 31.4 bits (71), Expect = 0.20 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 11/49 (22%) Query: 60 NAQISKRISLIEVDVTLVGENRNLAGLKNNF--YDHVIMNPPFNERIGT 106 A + I + D T LK Y VI NPP+ ER+G+ Sbjct: 276 AAGVGDLIEFKQADAT---------DLKEPLEEYGVVISNPPYGERLGS 315 >gnl|CDD|32444 COG2263, COG2263, Predicted RNA methylase [Translation, ribosomal structure and biogenesis]. Length = 198 Score = 29.8 bits (67), Expect = 0.56 Identities = 22/89 (24%), Positives = 34/89 (38%), Gaps = 16/89 (17%) Query: 16 ADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVT 75 DLGAG G + A L +++L + P AR ++ + + DV+ Sbjct: 50 LDLGAGTGILAIGAAL-LGASRVLAVDIDPEALEIARA-----NAEELLGDVEFVVADVS 103 Query: 76 LVGENRNLAGLKNNFYDHVIMNPPFNERI 104 +D VIMNPPF + Sbjct: 104 DF----------RGKFDTVIMNPPFGSQR 122 >gnl|CDD|33834 COG4076, COG4076, Predicted RNA methylase [General function prediction only]. Length = 252 Score = 29.2 bits (65), Expect = 0.97 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Query: 16 ADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQIS 64 ADLGAG+G L+V + +++ E+ P A A + L +P + Sbjct: 37 ADLGAGSGI--LSVVAAHAAERVIAIEKDPKRARLAEENLHVPGDVNWE 83 >gnl|CDD|145672 pfam02636, DUF185, Uncharacterized ACR, COG1565. This family contains several uncharacterized proteins. One member has been described as an ATP synthase beta subunit transcription termination factor rho protein. Length = 240 Score = 28.8 bits (65), Expect = 1.2 Identities = 22/86 (25%), Positives = 32/86 (37%), Gaps = 11/86 (12%) Query: 3 LASLVNATGS---FHLADLGAGAG--------AAGLAVASRLHEAQILLAERSPLMAHYA 51 LA L A GS L ++GAG G A + + L E SP + Sbjct: 6 LAQLWKALGSPPPLRLVEIGAGRGTLAADILRALRKLLPEFYEALEYHLVEISPALRERQ 65 Query: 52 RKTLALPANAQISKRISLIEVDVTLV 77 ++ LA A+ + L E+ V Sbjct: 66 KERLAGSADLLVKWLDELPELPFPGV 91 >gnl|CDD|36452 KOG1238, KOG1238, KOG1238, Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only]. Length = 623 Score = 28.8 bits (64), Expect = 1.3 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 12/47 (25%) Query: 21 GAGAAGLAVASRLHE---AQILLAERS---------PLMAHYARKTL 55 G G AG +A+RL E +LL E PL+A + +L Sbjct: 64 GGGTAGCVLAARLSENPNWSVLLLEAGGDPPLYSDPPLLAANLQLSL 110 >gnl|CDD|145554 pfam02475, Met_10, Met-10+ like-protein. The methionine-10 mutant allele of N. crassa codes for a protein of unknown function. However, homologous proteins have been found in yeast suggesting this protein may be involved in methionine biosynthesis, transport and/or utilisation. Length = 199 Score = 28.8 bits (65), Expect = 1.4 Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 13/84 (15%) Query: 17 DLGAGAGAAGLAVASRLHEAQILLA-ERSPLMAHYARKTLALPANAQISKRISLIEVDVT 75 D+ AG G + +A + +A+ + A E +P Y ++ + L ++ IS I DV Sbjct: 106 DMFAGIGPFSIPIA-KHSKAKRVYAVELNPEAVKYLKENIKL---NKVEGVISPILGDVR 161 Query: 76 LVGENRNLAGLKNNFYDHVIMNPP 99 V + D VIMN P Sbjct: 162 DV--------ILEGVADRVIMNLP 177 >gnl|CDD|32446 COG2265, TrmA, SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis]. Length = 432 Score = 28.0 bits (62), Expect = 2.3 Identities = 25/113 (22%), Positives = 43/113 (38%), Gaps = 17/113 (15%) Query: 7 VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKR 66 + G + DL G G GL +A R ++ E SP A++ NA + Sbjct: 289 LELAGGERVLDLYCGVGTFGLPLAKR--VKKVHGVEISPEAVEAAQE------NAAANG- 339 Query: 67 ISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPP-------FNERIGTMTPDKI 112 I +E E A + D V+++PP +++ + P +I Sbjct: 340 IDNVEFIAGDA-EEFTPAWWEGYKPDVVVVDPPRAGADREVLKQLAKLKPKRI 391 >gnl|CDD|28801 cd00524, SORL, Superoxide reductase-like (SORL) domain; present in a family of mononuclear non-heme iron proteins that includes superoxide reductase and desulfoferrodoxin. Superoxide reductase-like proteins scavenge superoxide anion radicals as a defense mechanism against reactive oxygen species and are found in anaerobic bacteria and archeae, and microaerophilic Treponema pallidum. The SORL domain contains an active iron site, Fe[His4Cys(Glu)], which in the reduced state loses the glutamate ligand. Superoxide reductase (class II) forms a homotetramer with four Fe[His4Cys(Glu)] centers. Desulfoferrodoxin (class I) is a homodimeric protein, with each protomer comprised of two domains, the N-terminal desulforedoxin (DSRD) domain and C-terminal SORL domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].. Length = 86 Score = 27.9 bits (62), Expect = 2.4 Identities = 11/41 (26%), Positives = 18/41 (43%), Gaps = 8/41 (19%) Query: 92 DHVIMNPPFNERIGTMTPDKIK----EEAHVMLEDSFEKWI 128 HV P E+ ++ P +K H M E+ + +WI Sbjct: 3 KHV----PVIEKPDSVEPFDVKVKVGSVPHPMTEEHYIEWI 39 >gnl|CDD|32408 COG2226, UbiE, Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism]. Length = 238 Score = 27.5 bits (61), Expect = 3.0 Identities = 16/83 (19%), Positives = 31/83 (37%), Gaps = 11/83 (13%) Query: 14 HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73 + D+ G G L +A + +++ + S M AR+ L + + + D Sbjct: 54 KVLDVACGTGDMALLLAKSVGTGEVVGLDISESMLEVAREKLKKKGV----QNVEFVVGD 109 Query: 74 VTLVGENRNLAGLKNNFYDHVIM 96 NL +N +D V + Sbjct: 110 AE------NLP-FPDNSFDAVTI 125 >gnl|CDD|38163 KOG2952, KOG2952, KOG2952, Cell cycle control protein [Cell cycle control, cell division, chromosome partitioning, Transcription, Signal transduction mechanisms]. Length = 351 Score = 27.2 bits (60), Expect = 4.3 Identities = 10/45 (22%), Positives = 18/45 (40%) Query: 87 KNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTA 131 + Y+ + PP N + G + + + F W+RTA Sbjct: 211 RKPIYNASGIVPPPNWQKGYPEGGYTDDNIPLSENEDFIVWMRTA 255 >gnl|CDD|35252 KOG0029, KOG0029, KOG0029, Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism]. Length = 501 Score = 26.9 bits (59), Expect = 4.8 Identities = 10/24 (41%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Query: 21 GAGAAGLAVASRLHEA--QILLAE 42 GAG AGL+ A +L + +L+ E Sbjct: 22 GAGLAGLSAARQLQDFGFDVLVLE 45 >gnl|CDD|176144 cd08453, PBP2_IlvR, The C-terminal substrate binding domain of LysR-type transcriptional regulator, IlvR, involved in the biosynthesis of isoleucine, leucine and valine; contains type 2 periplasmic binding fold. The IlvR is an activator of the upstream and divergently transcribed ilvD gene, which encodes dihydroxy acid dehydratase that participates in isoleucine, leucine, and valine biosynthesis. As in the case of other members of the LysR family, the expression of ilvR gene is repressed in the presence of its own gene product. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Length = 200 Score = 26.9 bits (60), Expect = 5.1 Identities = 21/74 (28%), Positives = 25/74 (33%), Gaps = 11/74 (14%) Query: 5 SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERS----PLMAHYARKTLALPAN 60 L AT L L AG AG+ + A LA R PL+ LA+PA Sbjct: 32 QLREATSDVQLEALLAGEIDAGIVIPPPGASAPPALAYRPLLSEPLV-------LAVPAA 84 Query: 61 AQISKRISLIEVDV 74 L V Sbjct: 85 WAAEGGAPLALAAV 98 >gnl|CDD|146532 pfam03949, Malic_M, Malic enzyme, NAD binding domain. Length = 255 Score = 26.8 bits (60), Expect = 5.2 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 7/42 (16%) Query: 1 MILASLVNA---TGSFHLAD---LGAGAGAAGLAVASRLHEA 36 ++LA L+NA TG L+D + GAGAAG+ +A L A Sbjct: 7 VVLAGLLNALKITGKP-LSDQKIVFFGAGAAGIGIAELLVAA 47 >gnl|CDD|38772 KOG3564, KOG3564, KOG3564, GTPase-activating protein [General function prediction only]. Length = 604 Score = 26.5 bits (58), Expect = 6.2 Identities = 23/108 (21%), Positives = 36/108 (33%), Gaps = 15/108 (13%) Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGEC-- 176 ED EKW RT + + L+ +S + + AR EI E +C Sbjct: 36 DFEDFEEKWKRTDAELGKYKDLLAKAETKRSALDVKLKHARNQVDAEIKRRRRAEADCEK 95 Query: 177 -ASRI------LVTGRKG---MRGQLRFRYPIVLHKPNGQPYSRFVTD 214 ++I L G + + +F GQP S + Sbjct: 96 LETQIQLIKDMLKCDISGSIQLSDEQKFAL---AFLNRGQPSSSNAGN 140 >gnl|CDD|29233 cd01460, vWA_midasin, VWA_Midasin: Midasin is a member of the AAA ATPase family. The proteins of this family are unified by their common archetectural organization that is based upon a conserved ATPase domain. The AAA domain of midasin contains six tandem AAA protomers. The AAA domains in midasin is followed by a D/E rich domain that is following by a VWA domain. The members of this subgroup have a conserved MIDAS motif. The function of this domain is not exactly known although it has been speculated to play a crucial role in midasin function.. Length = 266 Score = 26.4 bits (58), Expect = 6.4 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 37 QILLA-ERSPLMAHYARKTLALPANAQISKRISLIEV 72 QIL+A + S M+ K LAL + +SK ++L+EV Sbjct: 62 QILIAIDDSKSMSENNSKKLALESLCLVSKALTLLEV 98 >gnl|CDD|32458 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism]. Length = 542 Score = 26.2 bits (57), Expect = 7.0 Identities = 10/33 (30%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Query: 21 GAGAAGLAVASRLHEA--QILLAERSPLMAHYA 51 G+G+AG +A+RL +A +L+ E Sbjct: 14 GSGSAGSVLAARLSDAGLSVLVLEAGGPDRRPL 46 >gnl|CDD|38630 KOG3420, KOG3420, KOG3420, Predicted RNA methylase [Translation, ribosomal structure and biogenesis]. Length = 185 Score = 26.5 bits (58), Expect = 7.1 Identities = 7/19 (36%), Positives = 11/19 (57%) Query: 86 LKNNFYDHVIMNPPFNERI 104 LK +D ++NPPF + Sbjct: 110 LKGGIFDTAVINPPFGTKK 128 >gnl|CDD|38123 KOG2912, KOG2912, KOG2912, Predicted DNA methylase [Function unknown]. Length = 419 Score = 26.2 bits (57), Expect = 7.1 Identities = 19/89 (21%), Positives = 33/89 (37%), Gaps = 9/89 (10%) Query: 17 DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76 D+G GA + +R + L E + +YA+ + + + K + + L Sbjct: 108 DIGTGASCIYPLLGARQNNWYFLATEIDDMSFNYAKSNVEQNNLSSLIKVVKVEPQKTLL 167 Query: 77 ---VGENRNLAGLKNNFYDHVIMNPPFNE 102 + E YD + NPPF E Sbjct: 168 MDALKEE------SEIIYDFCMCNPPFFE 190 >gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 2 (CDK2) and CDK3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK2/3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK2 is regulated by cyclin E or cyclin A. Upon activation by cyclin E, it phosphorylates the retinoblastoma (pRb) protein which activates E2F mediated transcription and allows cells to move into S phase. The CDK2/cyclin A complex plays a role in regulating DNA replication. CDK2, together with CDK4, also regulates embryonic cell proliferation. Despite these important roles, mice deleted for the cdk2 gene are viable and normal except for being sterile. This may be due to compensation provided by CDK1 (also called Cdc2), which can also bind cyclin E and drive the G1 to S phase transition. CDK3 is regulated by cyclin C and it phosphorylates pRB specifically during the G0/G1 transition. This phosphorylation is required for cells to exit G0 efficiently and enter the G1 phase. Length = 284 Score = 26.3 bits (58), Expect = 7.5 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Query: 6 LVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSP 45 L+N G+ LAD G A A G+ V + HE + L R+P Sbjct: 132 LINTEGAIKLADFGL-ARAFGVPVRTYTHEV-VTLWYRAP 169 >gnl|CDD|146308 pfam03602, Cons_hypoth95, Conserved hypothetical protein 95. Length = 181 Score = 26.1 bits (58), Expect = 8.4 Identities = 29/104 (27%), Positives = 42/104 (40%), Gaps = 18/104 (17%) Query: 2 ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANA 61 ILA G + DL AG+GA GL SR + ++ E+ A TL N Sbjct: 35 ILAPYFELGG-ARVLDLFAGSGALGLEALSR-GASSVVFVEKDKK----AVATLK--ENL 86 Query: 62 QISKRISLIEVDVTLVGEN----RNLAGLKNNFYDHVIMNPPFN 101 + +L L + LAG K +D V ++PP+ Sbjct: 87 E-----ALGLEGAVLRMDAARALLRLAG-KGPPFDLVFLDPPYA 124 >gnl|CDD|30999 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion]. Length = 387 Score = 26.2 bits (57), Expect = 8.5 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Query: 20 AGAGAAGLAVASRLHEA--QILLAERSPLMAHYARKTLALPANA 61 GAG AGLA+A L A + L ER+P + +AL NA Sbjct: 8 VGAGPAGLALALALARAGLDVTLLERAPRELLERGRGIALSPNA 51 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.322 0.136 0.392 Gapped Lambda K H 0.267 0.0796 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,632,404 Number of extensions: 135726 Number of successful extensions: 393 Number of sequences better than 10.0: 1 Number of HSP's gapped: 386 Number of HSP's successfully gapped: 41 Length of query: 225 Length of database: 6,263,737 Length adjustment: 90 Effective length of query: 135 Effective length of database: 4,318,927 Effective search space: 583055145 Effective search space used: 583055145 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 56 (25.2 bits)