RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|255764483|ref|YP_003065151.2| hypothetical protein CLIBASIA_03125 [Candidatus Liberibacter asiaticus str. psy62] (135 letters) >gnl|CDD|177808 PLN00415, PLN00415, 3-ketoacyl-CoA synthase. Length = 466 Score = 26.2 bits (57), Expect = 3.1 Identities = 13/44 (29%), Positives = 21/44 (47%), Gaps = 12/44 (27%) Query: 102 TFANEQSTVRVYTPGTLSFLS------------CTPRCLPSSPP 133 TF N ++YT T+ F++ +PRC+ +SPP Sbjct: 80 TFFNMAKGAQLYTEETIQFMTRILNRSGLGDDTYSPRCMLTSPP 123 >gnl|CDD|149722 pfam08750, CNP1, CNP1-like family. This family of proteins are likely to be lipoproteins. CNP1 (cryptic neisserial protein) has been expressed in E. coli and shown to be localized periplasmicly. Length = 139 Score = 26.1 bits (58), Expect = 3.4 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 7/49 (14%) Query: 28 PEDNSNRIRIAVGQSLILQFDVLPKQVIVGDDKIVDVLALEKEKTVVIT 76 N + V + L+F V K + VG D +V TVVIT Sbjct: 19 APQTENLLPFDVSPATSLRFFVDAKSLSVGTDGVV-------RYTVVIT 60 >gnl|CDD|181263 PRK08166, PRK08166, NADH dehydrogenase subunit G; Validated. Length = 847 Score = 25.7 bits (57), Expect = 4.3 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Query: 59 DKIVDVLALEKEKTVVITGKNLGSTNII 86 D I LA +K ++I+G + GS II Sbjct: 484 DVIAQALA-GAKKPLIISGTSAGSPAII 510 >gnl|CDD|179009 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed. Length = 782 Score = 25.6 bits (57), Expect = 4.3 Identities = 13/39 (33%), Positives = 18/39 (46%), Gaps = 10/39 (25%) Query: 43 LILQFDVLPKQVIVGDDKIVDVLALEKEKTVVITGKNLG 81 L+ V+PK + +G DK +VITG N G Sbjct: 310 LLDGEKVVPKDISLGFDK----------TVLVITGPNTG 338 >gnl|CDD|183516 PRK12416, PRK12416, protoporphyrinogen oxidase; Provisional. Length = 463 Score = 25.2 bits (55), Expect = 6.2 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Query: 5 RQREIKNETVRKKGIPTTASQKTPEDNSNRIRIAVGQSLILQFDVL 50 R E+ ETV KKG TTA K + I A +S+ + VL Sbjct: 231 RLEEVLTETVVKKGAVTTAVSKQG--DRYEISFANHESIQADYVVL 274 >gnl|CDD|178470 PLN02882, PLN02882, aminoacyl-tRNA ligase. Length = 1159 Score = 24.7 bits (54), Expect = 7.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Query: 63 DVLALEKEKTVVITGKNLGSTNIIVL 88 D+L EK V I G L + +I V+ Sbjct: 932 DILEFEKAGEVTIAGHTLKAGDIKVV 957 >gnl|CDD|179178 PRK00950, PRK00950, histidinol-phosphate aminotransferase; Validated. Length = 361 Score = 24.5 bits (54), Expect = 9.0 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Query: 84 NIIVLGHNNDILLDTEIATFANEQSTVRVYTPGTLSF 120 NIIV G D ++DT + TF + V + TP T S+ Sbjct: 88 NIIVGGDGMDEVIDTLMRTFIDPGDEVIIPTP-TFSY 123 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.316 0.133 0.372 Gapped Lambda K H 0.267 0.0631 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,132,915 Number of extensions: 124319 Number of successful extensions: 229 Number of sequences better than 10.0: 1 Number of HSP's gapped: 229 Number of HSP's successfully gapped: 13 Length of query: 135 Length of database: 5,994,473 Length adjustment: 83 Effective length of query: 52 Effective length of database: 4,201,009 Effective search space: 218452468 Effective search space used: 218452468 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.0 bits)