RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|255764483|ref|YP_003065151.2| hypothetical protein CLIBASIA_03125 [Candidatus Liberibacter asiaticus str. psy62] (135 letters) >3kbg_A 30S ribosomal protein S4E; RPS4E, RS4E_theac, TAR28, NESG, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.75A {Thermoplasma acidophilum} (A:82-213) Length = 132 Score = 25.9 bits (57), Expect = 2.0 Identities = 16/80 (20%), Positives = 27/80 (33%), Gaps = 10/80 (12%) Query: 9 IKNETVRKKGIPTTASQKTPEDNSNRIRIAVGQSLILQFDVLPKQVIVGDDKIVDVLALE 68 ++++ + Q D I DVL V V D KI +++ + Sbjct: 9 VRSKVIAPGNRI----QLGTHDGRT---FITDDKSIKVGDVL--AVSVPDXKISEIIKXQ 59 Query: 69 KEKTVVIT-GKNLGSTNIIV 87 IT G ++ T I Sbjct: 60 PGNKAYITAGSHVNQTGTIS 79 >1gml_A CCT-gamma; chaperone, chaperonin, actin, tubulin; 2.2A {Mus musculus} (A:1-28,A:108-178) Length = 99 Score = 25.8 bits (57), Expect = 2.5 Identities = 11/60 (18%), Positives = 26/60 (43%) Query: 29 EDNSNRIRIAVGQSLILQFDVLPKQVIVGDDKIVDVLALEKEKTVVITGKNLGSTNIIVL 88 + ++NRI A G ++ + + L + + ++++ + E IT I+L Sbjct: 30 KTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDPKACTILL 89 >2ww2_A Mannosidase, alpha-1,2-mannosidase; hydrolase, glycoside hydrolase family 92, GH92, BT2199; HET: SWA; 1.90A {Bacteroides thetaiotaomicron} PDB: 2wvy_A* (A:273-296,A:590-737) Length = 172 Score = 24.7 bits (54), Expect = 5.2 Identities = 5/29 (17%), Positives = 12/29 (41%), Gaps = 2/29 (6%) Query: 59 DKIVDVLALEKEKTVVITGKNLGSTNIIV 87 K+ L L + K V++ + + + Sbjct: 95 KKVT--LHLPEGKNFVVSAADNAADRPYI 121 >3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} PDB: 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 2iwe_A* 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A 1e5z_A 1e5y_A 1e67_A ... (A:) Length = 125 Score = 24.6 bits (53), Expect = 5.3 Identities = 6/36 (16%), Positives = 14/36 (38%) Query: 71 KTVVITGKNLGSTNIIVLGHNNDILLDTEIATFANE 106 K + + G+ V+GHN + ++ + Sbjct: 27 KQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTD 62 >3gqq_A Protein UNC-119 homolog A; human retinal protein 4, HRG4, U119A_human, HR3066A, NESG, structural genomics, PSI-2, protein structure initiative; 1.95A {Homo sapiens} (A:) Length = 195 Score = 24.4 bits (53), Expect = 5.6 Identities = 10/35 (28%), Positives = 15/35 (42%) Query: 1 MHRKRQREIKNETVRKKGIPTTASQKTPEDNSNRI 35 H R++ I E V T +PE+N +I Sbjct: 7 HHSHRKQPIGPEDVLGLQRITGDYLCSPEENIYKI 41 >1j6u_A UDP-N-acetylmuramate-alanine ligase MURC; structural genomics, TM0231, JCSG, PSI, protein structure initiative; 2.30A {Thermotoga maritima} (A:309-469) Length = 161 Score = 24.3 bits (52), Expect = 7.2 Identities = 5/46 (10%), Positives = 15/46 (32%), Gaps = 2/46 (4%) Query: 35 IRIAVGQSLILQFDVLPKQVIVGDDK--IVDVLALEKEKTVVITGK 78 G+ + L K+ + + V+++ + + G Sbjct: 87 KNGISGKXIWDSLKSLGKEAYFVEKLPELEKVISVSENTVFLFVGA 132 >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} (A:1-125) Length = 125 Score = 23.7 bits (51), Expect = 9.2 Identities = 5/9 (55%), Positives = 7/9 (77%) Query: 110 VRVYTPGTL 118 ++ TPGTL Sbjct: 113 TQLLTPGTL 121 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.316 0.133 0.372 Gapped Lambda K H 0.267 0.0649 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 972,066 Number of extensions: 39190 Number of successful extensions: 102 Number of sequences better than 10.0: 1 Number of HSP's gapped: 102 Number of HSP's successfully gapped: 11 Length of query: 135 Length of database: 4,956,049 Length adjustment: 79 Effective length of query: 56 Effective length of database: 2,285,454 Effective search space: 127985424 Effective search space used: 127985424 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.2 bits)