HHsearch alignment of GI: 255764487 and MMDB domain: 3a6m_A_116-177

>3a6m_A (A:116-177) Protein GRPE, HSP-70 cofactor; coiled-coil, four-helix bundle, dimer, chaperone, cytoplasm, stress response; 3.23A {Thermus thermophilus HB8}
Probab=99.76  E-value=3.7e-19  Score=142.57  Aligned_cols=60  Identities=27%  Similarity=0.525  Sum_probs=55.6

Q ss_pred             HCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEEEEECCCEEECCEEEECCEEEEECCCCCCCC
Q ss_conf             000136888757005777522434589774599997088177567820002486048888887
Q gi|255764487|r  132 VKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPT  194 (219)
Q Consensus       132 V~~i~~~G~~FDP~~HeAi~~~~~~~~~~~tVi~v~q~GY~l~~rvlRpA~V~Vsk~~~~~~~  194 (219)
                      |++|+++|+.|||++||||+++++   ++|||++|+|+||+|+|||||||+|+||+++.....
T Consensus         1 v~~i~~~G~~FDP~~HeAv~~~~~---~~~~V~~v~~~GY~~~~rvlRpA~V~V~k~~~~~~~   60 (62)
T 3a6m_A            1 VEEVPGEGEAFDPRYHEAVGLLPG---EPGKVAKVFQRGFRMGEALVRPARVAVGEEKREEAD   60 (62)
T ss_dssp             CEECCCTTSBCCTTTEEEEEEEES---STTBEEEEEECCEEETTEEEECEEEEEEECCC----
T ss_pred             EEEECCCCCCCCCCHHEEEEEEEC---CCCEEEEEEECCEEECCEEEECCEEEECCCCCCCCC
T ss_conf             067589999679434204355008---949589997679288999830656897889987777