HHsearch alignment of GI: 255764487 and MMDB domain: 3a6m_A_35-115

>3a6m_A (A:35-115) Protein GRPE, HSP-70 cofactor; coiled-coil, four-helix bundle, dimer, chaperone, cytoplasm, stress response; 3.23A {Thermus thermophilus HB8}
Probab=99.79  E-value=5.8e-20  Score=147.72  Aligned_cols=80  Identities=33%  Similarity=0.545  Sum_probs=75.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             99999999999889999999999999999964243343203157899999972122233210111278998764479999
Q gi|255764487|r   41 EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR  120 (219)
Q Consensus        41 ~elkdk~lR~~AE~eN~rkR~~ke~~~~~~~a~~~~~~~lL~v~D~lerAl~~~~~~~~~~~~~~~~~~~~~~~Gi~mi~  120 (219)
                      .+++++|+|++|||+|||||+++++++++.|++++|+++||||+|||+||+.+++.+           ..++++||.||+
T Consensus         2 ~e~~~~~~r~~Ae~eN~rkR~~ke~e~~~~~a~~~~~~~lLpv~D~lerAl~~~~~~-----------~~~~~~Gi~mi~   70 (81)
T 3a6m_A            2 KGLKDKYLRLLADFDNYRKRMEEELKAREREGVLKALRALLPVLDDLDRALEFAEAS-----------PESIRQGVRAIR   70 (81)
T ss_dssp             SSHHHHHHTTTTTTTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTGGGC-----------HHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-----------CCHHHHHHHHHH
T ss_conf             999999999999999999999999999999989999999988876888887754103-----------210246799999


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999986411
Q gi|255764487|r  121 REMMSTLERYG  131 (219)
Q Consensus       121 k~l~~~L~~~G  131 (219)
                      ++|.++|+++|
T Consensus        71 ~~l~~~l~k~G   81 (81)
T 3a6m_A           71 DGFFRILAGLG   81 (81)
T ss_dssp             HHHHHHHHHTT
T ss_pred             HHHHHHHHHCC
T ss_conf             99999998679