HHsearch results for GI: 255764487 and protein with PDBid: 3a6m_A

>3a6m_A Protein GRPE, HSP-70 cofactor; coiled-coil, four-helix bundle, dimer, chaperone, cytoplasm, stress response; 3.23A {Thermus thermophilus HB8}
Probab=100.00  E-value=1.4e-45  Score=310.43  Aligned_cols=151  Identities=28%  Similarity=0.480  Sum_probs=137.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHCCCCCCCCCCCCHHHH
Q ss_conf             10399999999999999999998899999999999999999642433432031578999999721222332101112789
Q gi|255764487|r   30 INIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVL  109 (219)
Q Consensus        30 ~~~~e~~~~e~~elkdk~lR~~AE~eN~rkR~~ke~~~~~~~a~~~~~~~lL~v~D~lerAl~~~~~~~~~~~~~~~~~~  109 (219)
                      ...+..+.+++.+++++|+|++|||+|||||+++++.+++.|+.++|+++||||+|+|+||+.+...           ..
T Consensus        25 ~~~l~~~~~e~~el~dk~lR~~Ae~eN~rkR~~ke~~~~~~~a~~~~~~~lL~v~D~le~Al~~~~~-----------~~   93 (177)
T 3a6m_A           25 EERLKAAEEELKGLKDKYLRLLADFDNYRKRMEEELKAREREGVLKALRALLPVLDDLDRALEFAEA-----------SP   93 (177)
T ss_dssp             TTSTTGGGGTSSSHHHHHHTTTTTTTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTGGG-----------CH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-----------CC
T ss_conf             9999999999999999999999999999999999999999998999999998887689898776411-----------42


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEEEEECCCEEECCEEEECCEEEEECCC
Q ss_conf             98764479999999999864110001368887570057775224345897745999970881775678200024860488
Q gi|255764487|r  110 KSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK  189 (219)
Q Consensus       110 ~~~~~Gi~mi~k~l~~~L~~~GV~~i~~~G~~FDP~~HeAi~~~~~~~~~~~tVi~v~q~GY~l~~rvlRpA~V~Vsk~~  189 (219)
                      .+|.+||.||+++|.++|+++||++|+++|+.|||++||||+++++   ++|||++|+|+||+|+|||||||+|+||+++
T Consensus        94 ~~~~~gv~~i~~~l~~~L~~~gv~~i~~~G~~FDP~~HeAv~~~~~---~~~~I~~v~~~GY~~~~rvlRpA~V~Vsk~~  170 (177)
T 3a6m_A           94 ESIRQGVRAIRDGFFRILAGLGVEEVPGEGEAFDPRYHEAVGLLPG---EPGKVAKVFQRGFRMGEALVRPARVAVGEEK  170 (177)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTTCEECCCTTSBCCTTTEEEEEEEES---STTBEEEEEECCEEETTEEEECEEEEEEECC
T ss_pred             CHHHHHHHHHHHHHHHHHHHCCCEEECCCCCCCCHHHCEEEEECCC---CCCEEEEEEECCEEECCEEECCCEEEECCCC
T ss_conf             0146689999999999998779367689999678146013344128---9495899965690889998227778978999


Q ss_pred             CCCCC
Q ss_conf             88887
Q gi|255764487|r  190 TQNPT  194 (219)
Q Consensus       190 ~~~~~  194 (219)
                      .+...
T Consensus       171 ~~~~~  175 (177)
T 3a6m_A          171 REEAD  175 (177)
T ss_dssp             C----
T ss_pred             CCCCC
T ss_conf             87777