Query         gi|255764487|ref|YP_003065115.2| heat shock protein [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 219
No_of_seqs    122 out of 2077
Neff          7.2 
Searched_HMMs 23785
Date          Tue May 31 17:27:18 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 255764487.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 1dkg_A Nucleotide exchange fac 100.0       0       0  332.3  14.9  148   35-190    50-197 (197)
  2 3a6m_A Protein GRPE, HSP-70 co 100.0 1.4E-45       0  310.4   8.3  151   30-194    25-175 (177)
  3 2wd5_A Structural maintenance   41.0     9.9 0.00042   17.5   1.7   64   32-95      9-78  (233)
  4 2qee_A BH0493 protein; amidohy  22.1      36  0.0015   13.9   3.0   47  120-169   127-173 (437)
  5 1ep5_B Capsid protein C, coat   19.1      30  0.0013   14.4   1.0   13  172-184    24-36  (157)
  6 2zjr_L 50S ribosomal protein L  18.9      13 0.00054   16.8  -1.0   31  118-177    70-100 (114)
  7 3bbo_Q Ribosomal protein L18;   18.0      15 0.00062   16.4  -0.8   10  168-177   138-147 (161)
  8 1svp_A Sindbis virus capsid pr  17.4      35  0.0015   14.0   1.0   16  170-185    22-39  (161)
  9 2wem_A Glutaredoxin-related pr  17.2      46  0.0019   13.2   2.2   52  120-175    38-89  (118)
 10 1pzq_A Erythronolide synthase;  15.7      51  0.0021   12.9   3.2   32   84-131    14-45  (60)

No 1  
>1dkg_A Nucleotide exchange factor GRPE; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: b.73.1.1 h.1.9.1
Probab=100.00  E-value=0  Score=332.31  Aligned_cols=148  Identities=34%  Similarity=0.608  Sum_probs=137.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             99999999999999999889999999999999999964243343203157899999972122233210111278998764
Q gi|255764487|r   35 ESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIE  114 (219)
Q Consensus        35 ~~~~e~~elkdk~lR~~AE~eN~rkR~~ke~~~~~~~a~~~~~~~lL~v~D~lerAl~~~~~~~~~~~~~~~~~~~~~~~  114 (219)
                      ++.....+++++|+|++|||+|||||++++++++++||+++|+++||||+|+|+||+.+...        .+..+++|++
T Consensus        50 ~l~~~~~~~kd~~lR~~Ae~eN~rkR~~ke~~~~~~~a~~~~~~~lLpv~DnlerAl~~~~~--------~~~~~~~~~~  121 (197)
T 1dkg_A           50 QLAEAQTRERDGILRVKAEMENLRRRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADK--------ANPDMSAMVE  121 (197)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSGGGHHHHSHHHHHHHHHHHHCC--------------CHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCC--------CCHHHHHHHH
T ss_conf             99999999999999999999999999999999999999999999970314599999852101--------1234555652


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEEEEECCCEEECCEEEECCEEEEECCCC
Q ss_conf             4799999999998641100013688875700577752243458977459999708817756782000248604888
Q gi|255764487|r  115 GIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT  190 (219)
Q Consensus       115 Gi~mi~k~l~~~L~~~GV~~i~~~G~~FDP~~HeAi~~~~~~~~~~~tVi~v~q~GY~l~~rvlRpA~V~Vsk~~~  190 (219)
                      ||.||+++|.++|+++||++|+++|++|||++||||++++++++++|||++|+|+||+|||||||||+|+|||+|+
T Consensus       122 Gv~~i~~~l~~~L~~~gv~~i~~~G~~FDP~~HeAv~~~~~~~~~~~~Vv~v~q~GY~l~~rvlRpA~V~Vsk~~~  197 (197)
T 1dkg_A          122 DIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTVAKAKA  197 (197)
T ss_dssp             HHHHHHHHHHHHHTTTTEEEECCCSSBCCTTSEEEEEEEECSSSCTTBEEEEEECEEEETTEEEECEEEEEEECCC
T ss_pred             HHHHHHHHHHHHHHHCCCEEECCCCCCCCCHHHEEEEEECCCCCCCCEEEEEEECCCEECCEECCCCEEEEECCCC
T ss_conf             1999999999999972973313578998925860666753799991958999667908799971175589807999


No 2  
>3a6m_A Protein GRPE, HSP-70 cofactor; coiled-coil, four-helix bundle, dimer, chaperone, cytoplasm, stress response; 3.23A {Thermus thermophilus HB8}
Probab=100.00  E-value=1.4e-45  Score=310.43  Aligned_cols=151  Identities=28%  Similarity=0.480  Sum_probs=137.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHCCCCCCCCCCCCHHHH
Q ss_conf             10399999999999999999998899999999999999999642433432031578999999721222332101112789
Q gi|255764487|r   30 INIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVL  109 (219)
Q Consensus        30 ~~~~e~~~~e~~elkdk~lR~~AE~eN~rkR~~ke~~~~~~~a~~~~~~~lL~v~D~lerAl~~~~~~~~~~~~~~~~~~  109 (219)
                      ...+..+.+++.+++++|+|++|||+|||||+++++.+++.|+.++|+++||||+|+|+||+.+...           ..
T Consensus        25 ~~~l~~~~~e~~el~dk~lR~~Ae~eN~rkR~~ke~~~~~~~a~~~~~~~lL~v~D~le~Al~~~~~-----------~~   93 (177)
T 3a6m_A           25 EERLKAAEEELKGLKDKYLRLLADFDNYRKRMEEELKAREREGVLKALRALLPVLDDLDRALEFAEA-----------SP   93 (177)
T ss_dssp             TTSTTGGGGTSSSHHHHHHTTTTTTTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTGGG-----------CH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-----------CC
T ss_conf             9999999999999999999999999999999999999999998999999998887689898776411-----------42


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEEEEECCCEEECCEEEECCEEEEECCC
Q ss_conf             98764479999999999864110001368887570057775224345897745999970881775678200024860488
Q gi|255764487|r  110 KSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK  189 (219)
Q Consensus       110 ~~~~~Gi~mi~k~l~~~L~~~GV~~i~~~G~~FDP~~HeAi~~~~~~~~~~~tVi~v~q~GY~l~~rvlRpA~V~Vsk~~  189 (219)
                      .+|.+||.||+++|.++|+++||++|+++|+.|||++||||+++++   ++|||++|+|+||+|+|||||||+|+||+++
T Consensus        94 ~~~~~gv~~i~~~l~~~L~~~gv~~i~~~G~~FDP~~HeAv~~~~~---~~~~I~~v~~~GY~~~~rvlRpA~V~Vsk~~  170 (177)
T 3a6m_A           94 ESIRQGVRAIRDGFFRILAGLGVEEVPGEGEAFDPRYHEAVGLLPG---EPGKVAKVFQRGFRMGEALVRPARVAVGEEK  170 (177)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTTCEECCCTTSBCCTTTEEEEEEEES---STTBEEEEEECCEEETTEEEECEEEEEEECC
T ss_pred             CHHHHHHHHHHHHHHHHHHHCCCEEECCCCCCCCHHHCEEEEECCC---CCCEEEEEEECCEEECCEEECCCEEEECCCC
T ss_conf             0146689999999999998779367689999678146013344128---9495899965690889998227778978999


Q ss_pred             CCCCC
Q ss_conf             88887
Q gi|255764487|r  190 TQNPT  194 (219)
Q Consensus       190 ~~~~~  194 (219)
                      .+...
T Consensus       171 ~~~~~  175 (177)
T 3a6m_A          171 REEAD  175 (177)
T ss_dssp             C----
T ss_pred             CCCCC
T ss_conf             87777


No 3  
>2wd5_A Structural maintenance of chromosomes protein 1A; DNA damage, cell cycle, cell division; 2.70A {Mus musculus}
Probab=41.02  E-value=9.9  Score=17.47  Aligned_cols=64  Identities=9%  Similarity=-0.019  Sum_probs=33.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHHCCHHH-HHHHHHHHCC
Q ss_conf             39999999999999999999889999999-----9999999999642433432031578-9999997212
Q gi|255764487|r   32 IPEESLNQSEEFRDKYLRVIAEMENLRRR-----TDREKKDAQSYSIAKFARDMLSVSD-NLSRALDSAP   95 (219)
Q Consensus        32 ~~e~~~~e~~elkdk~lR~~AE~eN~rkR-----~~ke~~~~~~~a~~~~~~~lL~v~D-~lerAl~~~~   95 (219)
                      .+.++..++.+++.++.++.++.+++.++     .-.........++...+-+++.|.| .++.|++++-
T Consensus         9 ~~~el~~~l~~~~~~l~~l~~~~~~~~~~~~~~~~l~~~~~~~~~~v~G~l~dli~v~d~~y~~Ave~~L   78 (233)
T 2wd5_A            9 RIDEINKELNQVMEQLGDARIDRQESSRQQRKAEIMESIKRLYPGSVYGRLIDLCQPTQKKYQIAVTKVL   78 (233)
T ss_dssp             ------------------------------CCHHHHHHHHHHSGGGEEEEHHHHEEESSGGGHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEHHHHCCCCCHHHHHHHHHHH
T ss_conf             9999999999999999999999999987888999999998348887558788836168677999999998


No 4  
>2qee_A BH0493 protein; amidohydrolase, structural genomics, PSI-2, protein structure initiative; 1.65A {Bacillus halodurans c-125} PDB: 3hka_A* 2q6e_A 3hk5_A* 3hk7_A* 3hk8_A* 3hk9_A* 2q08_A* 2pnk_A*
Probab=22.12  E-value=36  Score=13.85  Aligned_cols=47  Identities=13%  Similarity=0.205  Sum_probs=31.4

Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEEEEECC
Q ss_conf             99999998641100013688875700577752243458977459999708
Q gi|255764487|r  120 RREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQD  169 (219)
Q Consensus       120 ~k~l~~~L~~~GV~~i~~~G~~FDP~~HeAi~~~~~~~~~~~tVi~v~q~  169 (219)
                      -..+..+|++++|+.|-+..++||+-.|.+...-   .-.++.|+-.+|+
T Consensus       127 ~~~~~~l~~~~nVe~i~tTddP~D~Le~H~~~~~---~~~~~rv~PtfRP  173 (437)
T 2qee_A          127 EEQVDTVLQLANVSDVVMTNDPFDDNERISWLEG---KQPDSRFHAALRL  173 (437)
T ss_dssp             HHHHHHHHHHTTEEEEECCBCTTSHHHHHHHHTT---CCCCTTEECCEEC
T ss_pred             CHHHHHHHHHHCCEEEEECCCCCCCHHHHHHHCC---CCCCCEEEECCCH
T ss_conf             6238999998397289855997653689998605---8998736444465


No 5  
>1ep5_B Capsid protein C, coat protein C; beta barrel, hydrolase; 2.30A {Venezuelan equine encephalitis virus} SCOP: b.47.1.3 PDB: 1ep6_A
Probab=19.14  E-value=30  Score=14.39  Aligned_cols=13  Identities=23%  Similarity=0.580  Sum_probs=10.3

Q ss_pred             EECCEEEECCEEE
Q ss_conf             7756782000248
Q gi|255764487|r  172 AINERVLRPALVS  184 (219)
Q Consensus       172 ~l~~rvlRpA~V~  184 (219)
                      .+++||++||.|.
T Consensus        24 lvg~kV~KPaHVk   36 (157)
T 1ep5_B           24 VVGGKLFRPMHVE   36 (157)
T ss_dssp             EETTEEEEETTCC
T ss_pred             EECCEEECCCCCC
T ss_conf             9747530232035


No 6  
>2zjr_L 50S ribosomal protein L18; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: c.55.4.1 PDB: 1sm1_M* 2zjp_L* 2zjq_L 1nkw_M 3cf5_L* 3dll_L* 1nwy_M* 1nwx_M* 1xbp_M* 1pnu_M 1pny_M 1vor_P 1vou_P 1vow_P 1voy_P 1vp0_P
Probab=18.91  E-value=13  Score=16.76  Aligned_cols=31  Identities=19%  Similarity=0.475  Sum_probs=21.0

Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEEEEECCCEEECCEE
Q ss_conf             999999999864110001368887570057775224345897745999970881775678
Q gi|255764487|r  118 MTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERV  177 (219)
Q Consensus       118 mi~k~l~~~L~~~GV~~i~~~G~~FDP~~HeAi~~~~~~~~~~~tVi~v~q~GY~l~~rv  177 (219)
                      .+-+.+-..+...||+.+     .||                        +.||+|||||
T Consensus        70 ~vG~~ia~~~~~~gI~~v-----vFD------------------------R~g~~YHGrv  100 (114)
T 2zjr_L           70 AVGKALAAAAAEKGIKQV-----VFD------------------------RGSYKYHGRV  100 (114)
T ss_dssp             HHHHHHHHHHHTTCCCCC-----EEC------------------------CCSSCSCSHH
T ss_pred             HHHHHHHHHHHHCCCCEE-----EEC------------------------CCCCCCCCHH
T ss_conf             999997636888698289-----986------------------------8998410299


No 7  
>3bbo_Q Ribosomal protein L18; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Vitis vinifera}
Probab=18.00  E-value=15  Score=16.37  Aligned_cols=10  Identities=40%  Similarity=0.803  Sum_probs=8.4

Q ss_pred             CCCEEECCEE
Q ss_conf             0881775678
Q gi|255764487|r  168 QDGYAINERV  177 (219)
Q Consensus       168 q~GY~l~~rv  177 (219)
                      +.||+|||||
T Consensus       138 Rgg~~YHGRV  147 (161)
T 3bbo_Q          138 RGGYPYHGRV  147 (161)
T ss_dssp             CSSSCSSSTT
T ss_pred             CCCCCCCCHH
T ss_conf             7997100599


No 8  
>1svp_A Sindbis virus capsid protein; chymotrypsin-like serine, mutant, coat protein, viral protein; 2.00A {Sindbis virus} SCOP: b.47.1.3 PDB: 1kxb_A 1kxa_A 2snw_A 1kxc_A 1kxd_A 1kxe_A 2snv_A 1z8y_Q 1wyk_A
Probab=17.36  E-value=35  Score=13.96  Aligned_cols=16  Identities=31%  Similarity=0.511  Sum_probs=12.2

Q ss_pred             CE--EECCEEEECCEEEE
Q ss_conf             81--77567820002486
Q gi|255764487|r  170 GY--AINERVLRPALVSI  185 (219)
Q Consensus       170 GY--~l~~rvlRpA~V~V  185 (219)
                      ||  .+++||.+||.|+=
T Consensus        22 GyA~~vg~kv~KP~HVkG   39 (161)
T 1svp_A           22 GHALAMEGKVMKPLHVKG   39 (161)
T ss_dssp             EEEEEETTEEEEETTCCS
T ss_pred             EEEEEECCEEECCCCCCC
T ss_conf             788987475302320454


No 9  
>2wem_A Glutaredoxin-related protein 5; chromosome 14 open reading frame 87, Fe/S cluster, oxidoreductase, thioredoxin family, GLRX5, FLB4739, C14ORF87; HET: GTT; 2.40A {Homo sapiens} PDB: 2wul_A*
Probab=17.24  E-value=46  Score=13.18  Aligned_cols=52  Identities=19%  Similarity=0.231  Sum_probs=38.5

Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEEEEECCCEEECC
Q ss_conf             99999998641100013688875700577752243458977459999708817756
Q gi|255764487|r  120 RREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINE  175 (219)
Q Consensus       120 ~k~l~~~L~~~GV~~i~~~G~~FDP~~HeAi~~~~~~~~~~~tVi~v~q~GY~l~~  175 (219)
                      -+++..+|..+|+.++..+.-.-||.+.+++.....    -.||=+++-.|-.+||
T Consensus        38 c~~ak~lL~~~~~~~y~~~dv~~~~~~~~~l~~~tg----~~TvPqIFi~G~~IGG   89 (118)
T 2wem_A           38 SNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSN----WPTIPQVYLNGEFVGG   89 (118)
T ss_dssp             HHHHHHHHHHTTCCCCEEEESSSCHHHHHHHHHHHT----CCSSCEEEETTEEEES
T ss_pred             HHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCC----CCCCCEEEECCEEECC
T ss_conf             999999999839964798744589899999998503----5756637699988778


No 10 
>1pzq_A Erythronolide synthase; four helix bundle, homodimer, transferase; NMR {Saccharopolyspora erythraea} SCOP: a.34.3.1
Probab=15.69  E-value=51  Score=12.94  Aligned_cols=32  Identities=25%  Similarity=0.463  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             789999997212223321011127899876447999999999986411
Q gi|255764487|r   84 SDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG  131 (219)
Q Consensus        84 ~D~lerAl~~~~~~~~~~~~~~~~~~~~~~~Gi~mi~k~l~~~L~~~G  131 (219)
                      +|.|+|||.+.+..                +|-.-+-.-|.+.|.+..
T Consensus        14 ld~le~al~al~~~----------------~gh~dvg~rle~llrrw~   45 (60)
T 1pzq_A           14 LDELEKALEALSAE----------------DGHDDVGQRLESLLRRWN   45 (60)
T ss_dssp             HHHHHHHHHHHTTS----------------SCCHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHCCHH----------------HCCCHHHHHHHHHHHHHH
T ss_conf             88999999836521----------------041079999999999986


Done!