BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|255764487|ref|YP_003065115.2| heat shock protein [Candidatus
Liberibacter asiaticus str. psy62]
         (219 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|255764487|ref|YP_003065115.2| heat shock protein [Candidatus Liberibacter asiaticus str. psy62]
 gi|254547838|gb|ACT57175.2| heat shock protein [Candidatus Liberibacter asiaticus str. psy62]
          Length = 219

 Score =  443 bits (1139), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 219/219 (100%), Positives = 219/219 (100%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR
Sbjct: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR
Sbjct: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP
Sbjct: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180

Query: 181 ALVSISKGKTQNPTEEKKETIEQPSPLDIEERNKTQTKN 219
           ALVSISKGKTQNPTEEKKETIEQPSPLDIEERNKTQTKN
Sbjct: 181 ALVSISKGKTQNPTEEKKETIEQPSPLDIEERNKTQTKN 219


>gi|315121867|ref|YP_004062356.1| heat shock protein [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495269|gb|ADR51868.1| heat shock protein [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 212

 Score =  277 bits (709), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 141/212 (66%), Positives = 173/212 (81%), Gaps = 7/212 (3%)

Query: 11  DKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQS 70
           +KE N SN N  + EEK   N  EE+  ++EEFR+KYLRV+A+MEN+RRRTDRE +DAQS
Sbjct: 3   EKENNHSNTNEDSVEEKINNNPLEEAQAKAEEFREKYLRVLADMENIRRRTDREIQDAQS 62

Query: 71  YSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERY 130
           YSIA FARDMLSVSDNLSRAL+S P+D     + S+S +KSLI+GIEMTRREMMSTLE+Y
Sbjct: 63  YSIAAFARDMLSVSDNLSRALNSVPIDKT---QNSDSEIKSLIDGIEMTRREMMSTLEKY 119

Query: 131 GVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           GVKKIDAK+QKFNPN+HQAMFEE ++T+P+NT+IKVVQDGYAI ER+LRPALV ISKGK 
Sbjct: 120 GVKKIDAKNQKFNPNIHQAMFEESNETIPSNTVIKVVQDGYAIGERILRPALVGISKGKN 179

Query: 191 QNPTE----EKKETIEQPSPLDIEERNKTQTK 218
           +NP E    ++ E  E+ S ++ EE N+TQTK
Sbjct: 180 KNPVEQIPSQENENKEKSSTINKEENNETQTK 211


>gi|15964131|ref|NP_384484.1| heat shock protein [Sinorhizobium meliloti 1021]
 gi|307301276|ref|ZP_07581038.1| GrpE protein [Sinorhizobium meliloti BL225C]
 gi|307317947|ref|ZP_07597384.1| GrpE protein [Sinorhizobium meliloti AK83]
 gi|52782969|sp|Q92SK0|GRPE_RHIME RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|15073307|emb|CAC41815.1| Probable heat shock protein [Sinorhizobium meliloti 1021]
 gi|306896349|gb|EFN27098.1| GrpE protein [Sinorhizobium meliloti AK83]
 gi|306903732|gb|EFN34319.1| GrpE protein [Sinorhizobium meliloti BL225C]
          Length = 208

 Score =  205 bits (522), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 124/158 (78%), Gaps = 3/158 (1%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           +S E RDKYLR+ AEM+NLRRRT+R+ KDA+SYS+A FARDML+VSDNL RALD+ P   
Sbjct: 48  ESAELRDKYLRLAAEMDNLRRRTERDVKDAKSYSVAGFARDMLAVSDNLRRALDAIP--- 104

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
           A++ +  ++ LK+LIEG+EMT R M++ LER+GVK++D   QKF+PN HQAMFE P+  V
Sbjct: 105 ADAREAGDAGLKALIEGVEMTERSMLAALERHGVKQLDPTGQKFDPNFHQAMFEVPNTEV 164

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEE 196
           P NT+++VVQ GY I ERVLRPA+V ++KG  +  T E
Sbjct: 165 PNNTVVQVVQAGYTIGERVLRPAMVGVAKGGPKAATSE 202


>gi|150395240|ref|YP_001325707.1| heat shock protein GrpE [Sinorhizobium medicae WSM419]
 gi|166215285|sp|A6U5E2|GRPE_SINMW RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|150026755|gb|ABR58872.1| Ribulose-phosphate 3-epimerase [Sinorhizobium medicae WSM419]
          Length = 208

 Score =  202 bits (514), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 122/155 (78%), Gaps = 3/155 (1%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E RDKYLR+ AEM+NLRRRT+R+ KDA+SYS+A FARDML+VSDNL RALD+ P   A++
Sbjct: 51  ELRDKYLRLAAEMDNLRRRTERDVKDAKSYSVAGFARDMLAVSDNLRRALDAIP---ADA 107

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
            +  ++ LK+LIEG+EMT R M++ LER+GVK++D   QKF+PN HQAMFE P+  VP N
Sbjct: 108 REAGDAGLKALIEGVEMTERSMLAALERHGVKQLDPTGQKFDPNFHQAMFEVPNPEVPNN 167

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGKTQNPTEE 196
           T+++VVQ GY I ERVLRPA+V ++KG  +  + E
Sbjct: 168 TVVQVVQAGYTIGERVLRPAMVGVAKGGPKAASSE 202


>gi|222147324|ref|YP_002548281.1| heat shock protein GrpE [Agrobacterium vitis S4]
 gi|254799578|sp|B9JZG5|GRPE_AGRVS RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|221734314|gb|ACM35277.1| GRPE protein [Agrobacterium vitis S4]
          Length = 204

 Score =  201 bits (512), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 133/168 (79%), Gaps = 4/168 (2%)

Query: 22  STAEEKSEINIPEESLN-QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDM 80
           STAE+  + N P  +L  ++ E RD++LR+ AEM+NLRRRT+R+ KDA+SY++  FARDM
Sbjct: 28  STAEDAGQDNNPTAALQAENAELRDRFLRLAAEMDNLRRRTERDVKDAKSYAVTAFARDM 87

Query: 81  LSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQ 140
           L+VSDNL RA+D+ P   A +++++++ L +LIEG+EMT R M+STLER+GV+KI+ + Q
Sbjct: 88  LAVSDNLRRAIDAVP---AEAKEEAQAGLTALIEGVEMTERAMLSTLERHGVRKIEPEGQ 144

Query: 141 KFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           KF+PN HQAMFE P+  VP NT+++VVQ GY I +RVLRPA+V ++KG
Sbjct: 145 KFDPNFHQAMFEIPNPQVPNNTVVQVVQPGYTIGDRVLRPAMVGVAKG 192


>gi|325291763|ref|YP_004277627.1| GRPE protein [Agrobacterium sp. H13-3]
 gi|325059616|gb|ADY63307.1| GRPE protein [Agrobacterium sp. H13-3]
          Length = 211

 Score =  201 bits (510), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 104/187 (55%), Positives = 135/187 (72%), Gaps = 12/187 (6%)

Query: 23  TAEEKSEINIPE--ESLN-QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARD 79
           T EE +E   P+  E L  ++ + RDK+LR+ AEM+NLRRRT+RE KDA++YS+A FARD
Sbjct: 24  TGEETAEAAEPDPIELLRAENADLRDKFLRLAAEMDNLRRRTEREVKDAKAYSLAAFARD 83

Query: 80  MLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKD 139
           ML+VSDNL RAL++ P +L   +   E+ L  LIEG+EMT R M+STLER+GVKKIDA+ 
Sbjct: 84  MLAVSDNLRRALEAIPDEL---KTNGEAGLNGLIEGVEMTERSMLSTLERHGVKKIDAEG 140

Query: 140 QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKE 199
           QKF+PN HQAMFE P+  VP NT+++VVQ G+ I +RVLRPA+V +SKG        K E
Sbjct: 141 QKFDPNFHQAMFEIPNTAVPNNTVLQVVQAGFTIGDRVLRPAMVGVSKGGP------KVE 194

Query: 200 TIEQPSP 206
           T   P P
Sbjct: 195 TAAAPEP 201


>gi|116563466|gb|ABJ99755.1| GrpE [Agrobacterium tumefaciens]
          Length = 211

 Score =  197 bits (501), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 93/161 (57%), Positives = 124/161 (77%), Gaps = 3/161 (1%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           ++ + RDK+LR+ AEM+NLRRRT+R+ KDA+SYS+A FARDML+VSDNL RAL++ P +L
Sbjct: 43  ENADLRDKFLRLAAEMDNLRRRTERDVKDAKSYSLAGFARDMLAVSDNLRRALEAIPDEL 102

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
              +   E+ L  LIEG+EMT R M+STLER+GVKKIDA+ QKF+PN HQAMFE P+  V
Sbjct: 103 ---KTNGEAGLNGLIEGVEMTERSMLSTLERHGVKKIDAEGQKFDPNFHQAMFEIPNPAV 159

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKE 199
           P NT+++VVQ G+ I +RVLRPA+V ++KG  +  T    E
Sbjct: 160 PNNTVLQVVQAGFTIGDRVLRPAMVGVAKGGPKAETAASAE 200


>gi|15887680|ref|NP_353361.1| GRPE protein [Agrobacterium tumefaciens str. C58]
 gi|52783612|sp|P63187|GRPE_AGRT5 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|52783613|sp|P63188|GRPE_AGRTU RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|3170207|gb|AAC18053.1| GrpE [Agrobacterium tumefaciens]
 gi|15155235|gb|AAK86146.1| GRPE protein [Agrobacterium tumefaciens str. C58]
          Length = 211

 Score =  196 bits (499), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 89/147 (60%), Positives = 119/147 (80%), Gaps = 3/147 (2%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           + RDK+LR+ AEM+NLRRRT+R+ KDA++YS+A FARDML+VSDNL RAL++ P +L   
Sbjct: 46  DLRDKFLRLAAEMDNLRRRTERDVKDAKAYSLAGFARDMLAVSDNLRRALEAIPDEL--- 102

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
           +   E+ L  LIEG+EMT R M+STLER+GVKKIDA+ QKF+PN HQAMFE P+  VP N
Sbjct: 103 KTNGEAGLNGLIEGVEMTERSMLSTLERHGVKKIDAEGQKFDPNFHQAMFEVPNTAVPNN 162

Query: 162 TIIKVVQDGYAINERVLRPALVSISKG 188
           T+++V+Q G+ I +RVLRPA+V ++KG
Sbjct: 163 TVLQVIQAGFTIGDRVLRPAMVGVAKG 189


>gi|227820599|ref|YP_002824569.1| heat shock protein GrpE [Sinorhizobium fredii NGR234]
 gi|227339598|gb|ACP23816.1| GrpE protein [Sinorhizobium fredii NGR234]
          Length = 222

 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 88/150 (58%), Positives = 119/150 (79%), Gaps = 3/150 (2%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           +S + RDKYLR+ AEM+NLRRRT+R+ KDA+SYS+A FARDML+VSDNL RAL++ P   
Sbjct: 62  ESADLRDKYLRLAAEMDNLRRRTERDVKDAKSYSVAGFARDMLAVSDNLRRALEAIP--- 118

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
           A + +  ++ L +LIEG+EMT R M++ LER+GVK++D   Q+F+PN HQAMFE P+  V
Sbjct: 119 AEARESGDAGLTALIEGVEMTERSMLAALERHGVKQLDPTGQRFDPNFHQAMFEVPNPEV 178

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISKG 188
           P NT+++VVQ GY I ERVLRPA+V ++KG
Sbjct: 179 PNNTVVQVVQAGYTIGERVLRPAMVGVAKG 208


>gi|209547620|ref|YP_002279537.1| heat shock protein GrpE [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|226737162|sp|B5ZMX0|GRPE_RHILW RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|209533376|gb|ACI53311.1| Ribulose-phosphate 3-epimerase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 210

 Score =  194 bits (494), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 88/147 (59%), Positives = 120/147 (81%), Gaps = 3/147 (2%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E RD+YLR+ AEM+NLRRRT+RE KDA+SYS+A FARDML+VSDNL RALD+ P ++ ++
Sbjct: 49  ELRDRYLRLAAEMDNLRRRTEREVKDAKSYSVAGFARDMLAVSDNLRRALDAIPAEVKDA 108

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
              +++ L +LIEG+EMT R M+S LER+GV+K++   QKF+PN HQAMFE P+  VP N
Sbjct: 109 ---ADAGLSTLIEGVEMTERAMLSALERHGVRKLEPVGQKFDPNFHQAMFEVPNPDVPNN 165

Query: 162 TIIKVVQDGYAINERVLRPALVSISKG 188
           T+++VVQ G++I ERVLRPA+V ++KG
Sbjct: 166 TVVQVVQAGFSIGERVLRPAMVGVAKG 192


>gi|241202763|ref|YP_002973859.1| heat shock protein GrpE [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240856653|gb|ACS54320.1| GrpE protein [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 210

 Score =  194 bits (493), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 94/182 (51%), Positives = 134/182 (73%), Gaps = 4/182 (2%)

Query: 20  NSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARD 79
           N +  EE ++ +  E    ++ E RD+YLR+ AEM+NLRRRT+RE KDA+SYS+A FARD
Sbjct: 27  NETAQEEAAQPDALELLKAENGELRDRYLRLAAEMDNLRRRTEREVKDAKSYSVAGFARD 86

Query: 80  MLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKD 139
           ML+VSDNL RALD+ P +   +   +++ L +LIEG+EMT R M+S LER+GV+K++   
Sbjct: 87  MLAVSDNLRRALDAIPPE---TRAAADAGLSTLIEGVEMTERAMLSALERHGVRKLEPVG 143

Query: 140 QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKE 199
           QKF+PN HQAMFE P+  VP NT+++VVQ G++I ERVLRPA+V ++KG  + P E +  
Sbjct: 144 QKFDPNFHQAMFEVPNPDVPNNTVVQVVQAGFSIGERVLRPAMVGVAKGGPK-PAEAETN 202

Query: 200 TI 201
           ++
Sbjct: 203 SV 204


>gi|319781454|ref|YP_004140930.1| GrpE protein [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317167342|gb|ADV10880.1| GrpE protein [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 211

 Score =  194 bits (492), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 91/172 (52%), Positives = 127/172 (73%), Gaps = 6/172 (3%)

Query: 37  LNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPL 96
           L ++EE +D+ LRV AEMENLRRRT R+  DA++Y++A FARDMLSVSDNL RALD+ P 
Sbjct: 39  LKENEELKDRALRVAAEMENLRRRTARDVHDARTYAVANFARDMLSVSDNLRRALDAIP- 97

Query: 97  DLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHD 156
             A ++   ++  K+LIEG+++T R M+S LER+GVKK+  + +KF+PN HQAMFE P+ 
Sbjct: 98  --AEAKASGDAGFKALIEGVDLTERAMLSALERHGVKKLAPEGEKFDPNFHQAMFEVPNP 155

Query: 157 TVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQPSPLD 208
            VPANT+++VVQ GY+I +RVLRPA+V ++KG    P     E   +P P++
Sbjct: 156 DVPANTVVQVVQPGYSIGDRVLRPAMVGVAKG---GPKLAAAEAPVEPGPVN 204


>gi|260460486|ref|ZP_05808737.1| Ribulose-phosphate 3-epimerase [Mesorhizobium opportunistum
           WSM2075]
 gi|259033591|gb|EEW34851.1| Ribulose-phosphate 3-epimerase [Mesorhizobium opportunistum
           WSM2075]
          Length = 210

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 127/172 (73%), Gaps = 7/172 (4%)

Query: 37  LNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPL 96
           L ++EE +D+ LRV AEMENLRRRT R+  DA++Y++A FARDMLSVSDNL RALD+ P 
Sbjct: 39  LKENEELKDRALRVAAEMENLRRRTARDVHDARTYAVANFARDMLSVSDNLRRALDAIP- 97

Query: 97  DLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHD 156
             A ++   ++  K+LIEG+++T R M+S LER+GVKK+  + +KF+PN HQAMFE P+ 
Sbjct: 98  --AEAKASGDAGFKALIEGVDLTERAMLSALERHGVKKLTPEGEKFDPNFHQAMFEVPNP 155

Query: 157 TVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQPSPLD 208
            VPANT+++VVQ GY+I ERVLRPA+V ++KG  +   E   E    P P++
Sbjct: 156 DVPANTVVQVVQPGYSIGERVLRPAMVGVAKGGPKVAAEAPVE----PGPVN 203


>gi|13472808|ref|NP_104375.1| heat shock protein GrpE [Mesorhizobium loti MAFF303099]
 gi|52782973|sp|Q98GQ5|GRPE_RHILO RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|14023555|dbj|BAB50161.1| heat shock protein (HSP-70 cofactor); GrpE [Mesorhizobium loti
           MAFF303099]
          Length = 210

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 127/172 (73%), Gaps = 7/172 (4%)

Query: 37  LNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPL 96
           L ++EE +D+ LRV AEMENLRRRT R+  DA++Y++A FARDMLSVSDNL RALD+ P 
Sbjct: 39  LKENEELKDRALRVAAEMENLRRRTARDVHDARTYAVANFARDMLSVSDNLRRALDAIP- 97

Query: 97  DLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHD 156
             A ++   ++  K+LIEG+++T R M+S LER+GVKK+  + +KF+PN HQAMFE P+ 
Sbjct: 98  --AEAKASGDAGFKALIEGVDLTERAMLSALERHGVKKLAPEGEKFDPNFHQAMFEVPNP 155

Query: 157 TVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQPSPLD 208
            VPANT+++VVQ GY+I ERVLRPA+V ++KG  +   E   E    P P++
Sbjct: 156 DVPANTVVQVVQPGYSIGERVLRPAMVGVAKGGPKIAAEAPVE----PGPVN 203


>gi|222084660|ref|YP_002543189.1| molecular chaperone heat shock protein (hsp-70) [Agrobacterium
           radiobacter K84]
 gi|221722108|gb|ACM25264.1| molecular chaperone heat shock protein (hsp-70) [Agrobacterium
           radiobacter K84]
          Length = 208

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 119/150 (79%), Gaps = 5/150 (3%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           ++ + RD+YLR+ A+M+NLRRRT+RE KDA+SYS+A FARDML+VSDNL R LD+ P   
Sbjct: 43  ENSDLRDRYLRLAADMDNLRRRTEREIKDAKSYSVAGFARDMLAVSDNLRRTLDAIP--- 99

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
             +E + ++ LK+LIEG+EMT R M+S LER+GV++I+   QKF+PN HQAMFE P+  V
Sbjct: 100 --AELRDDAGLKTLIEGVEMTERSMLSALERHGVRQIEPVGQKFDPNFHQAMFEVPNSEV 157

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISKG 188
           P NT+++VVQ G+ I ERVLRPA+V ++KG
Sbjct: 158 PNNTVVQVVQAGFVIGERVLRPAMVGVAKG 187


>gi|328545808|ref|YP_004305917.1| Protein grpE [polymorphum gilvum SL003B-26A1]
 gi|326415548|gb|ADZ72611.1| Protein grpE [Polymorphum gilvum SL003B-26A1]
          Length = 206

 Score =  191 bits (486), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 91/157 (57%), Positives = 123/157 (78%), Gaps = 4/157 (2%)

Query: 33  PEESLN-QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRAL 91
           P E+L  ++ + RD+ LRV+AEMENLRRRT++E KD + ++IA FARDML+VSDNL RAL
Sbjct: 29  PVEALRAENADLRDRTLRVMAEMENLRRRTEKEVKDTRQFAIAGFARDMLAVSDNLRRAL 88

Query: 92  DSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMF 151
           DS P D   + + +++ L +LIEG+EMT RE+++ LE++GVK++D   QKF+PN HQAMF
Sbjct: 89  DSLPED---ARQSADAGLVALIEGVEMTERELLNQLEKHGVKQLDPSGQKFDPNFHQAMF 145

Query: 152 EEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           E P+  VP NT+++VVQ GY I ERVLRPALV +SKG
Sbjct: 146 EIPNTEVPNNTVVQVVQAGYVIGERVLRPALVGVSKG 182


>gi|190890034|ref|YP_001976576.1| molecular chaperone heat shock protein [Rhizobium etli CIAT 652]
 gi|218517180|ref|ZP_03514020.1| molecular chaperone heat shock protein [Rhizobium etli 8C-3]
 gi|226737161|sp|B3PZA4|GRPE_RHIE6 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|190695313|gb|ACE89398.1| molecular chaperone heat shock protein [Rhizobium etli CIAT 652]
          Length = 210

 Score =  191 bits (486), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 93/170 (54%), Positives = 128/170 (75%), Gaps = 5/170 (2%)

Query: 20  NSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARD 79
           N +  EE ++ +  E    ++ E RD+YLR+ AEM+NLRRRT+RE KDA+SYS+A FARD
Sbjct: 27  NDTVQEETAQPDPLELLKAENSELRDRYLRLAAEMDNLRRRTEREVKDAKSYSVAGFARD 86

Query: 80  MLSVSDNLSRALDS-APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
           ML+VSDNL RALD+ +P     ++  +++ L SLIEG+EMT R M+S LER+GV+K++  
Sbjct: 87  MLAVSDNLRRALDAISP----EAKATADAGLTSLIEGVEMTERAMLSALERHGVRKLEPV 142

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
            QKF+PN HQAMFE P+  VP NT+++VVQ G+ I ERVLRPA+V ++KG
Sbjct: 143 GQKFDPNFHQAMFEVPNSEVPNNTVVQVVQAGFTIGERVLRPAMVGVAKG 192


>gi|218462738|ref|ZP_03502829.1| molecular chaperone heat shock protein [Rhizobium etli Kim 5]
          Length = 213

 Score =  191 bits (484), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 89/151 (58%), Positives = 120/151 (79%), Gaps = 5/151 (3%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS-APLD 97
           ++ E RD+YLR+ AEMENLRRRT+RE KDA+SYS+A FARDML+VSDNL RALD+ +P  
Sbjct: 49  ENSELRDRYLRLAAEMENLRRRTEREVKDAKSYSVAGFARDMLAVSDNLRRALDAISP-- 106

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
              ++  +++ L +LIEG+EMT R M+S LER+GV+K++   QKF+PN HQAMFE P+  
Sbjct: 107 --EAKATADAGLTTLIEGVEMTERAMLSALERHGVRKLEPVGQKFDPNFHQAMFEVPNPE 164

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISKG 188
           VP NT+++VVQ G+ I ERVLRPA+V ++KG
Sbjct: 165 VPNNTVVQVVQAGFTIGERVLRPAMVGVAKG 195


>gi|319898245|ref|YP_004158338.1| heat shock protein GrpE [Bartonella clarridgeiae 73]
 gi|319402209|emb|CBI75740.1| heat shock protein GrpE [Bartonella clarridgeiae 73]
          Length = 220

 Score =  191 bits (484), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 92/159 (57%), Positives = 123/159 (77%), Gaps = 4/159 (2%)

Query: 38  NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD 97
           ++++E RD+ LR+ AEMENLRRRT R+  DA++YSIA FARDMLSVSD+L RAL++ P D
Sbjct: 62  DENKELRDQILRLAAEMENLRRRTARDVADAKAYSIANFARDMLSVSDDLHRALEAIPKD 121

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
               E +++S LK+L+EG+EMT R MM+ LER+GVKKID + QKF+P+ HQAMFE P+  
Sbjct: 122 ----EGENDSGLKTLVEGVEMTERAMMAALERHGVKKIDPEGQKFDPHFHQAMFEIPNAD 177

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEE 196
           VP NT+ +VVQ GY I ERVLRPA+V ++KG  +  + E
Sbjct: 178 VPENTVQQVVQAGYIIGERVLRPAIVGVTKGGVKEASVE 216


>gi|86356022|ref|YP_467914.1| molecular chaperone heat shock protein (hsp-70) [Rhizobium etli CFN
           42]
 gi|123738420|sp|Q2KD99|GRPE_RHIEC RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|86280124|gb|ABC89187.1| molecular chaperone heat shock protein (hsp-70) [Rhizobium etli CFN
           42]
          Length = 211

 Score =  190 bits (482), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 118/148 (79%), Gaps = 5/148 (3%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS-APLDLAN 100
           E RD+YLR+ AEM+NLRRRT+RE KDA+SYS+A FARDML+VSDNL RALD+ +P     
Sbjct: 50  ELRDRYLRLAAEMDNLRRRTEREVKDAKSYSVAGFARDMLAVSDNLRRALDAISP----E 105

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
           ++  +++ L +LIEG+EMT R M+S LER+GV+K++   QKF+PN HQAMFE P+  VP 
Sbjct: 106 AKATADAGLTTLIEGVEMTERSMLSALERHGVRKLEPVGQKFDPNFHQAMFEVPNSEVPN 165

Query: 161 NTIIKVVQDGYAINERVLRPALVSISKG 188
           NT+++VVQ G+ I ERVLRPA+V ++KG
Sbjct: 166 NTVVQVVQAGFTIGERVLRPAMVGVAKG 193


>gi|74099845|gb|AAZ99131.1| GrpE [Rhizobium leguminosarum]
          Length = 210

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 90/161 (55%), Positives = 124/161 (77%), Gaps = 6/161 (3%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS-APLDLAN 100
           E RD+YLR+ AEM+NLRRRT+RE KDA+SYS+A FARDML+VSDNL RALD+ +P     
Sbjct: 49  ELRDRYLRLAAEMDNLRRRTEREVKDAKSYSVAGFARDMLAVSDNLRRALDAISP----E 104

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
           ++  +++ L +LIEG+EMT R M+S LER+GV+K++   QKF+PN HQAMFE P+  VP 
Sbjct: 105 TKAAADAGLSTLIEGVEMTERAMLSALERHGVRKLEPVGQKFDPNFHQAMFEVPNPDVPN 164

Query: 161 NTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETI 201
           NT+++VVQ G+ I ERVLRPA+V ++KG  + P E +  ++
Sbjct: 165 NTVVQVVQAGFTIGERVLRPAMVGVAKGGPK-PAEAETNSV 204


>gi|116250151|ref|YP_765989.1| heat shock protein GrpE [Rhizobium leguminosarum bv. viciae 3841]
 gi|122988719|sp|Q1MMC9|GRPE_RHIL3 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|115254799|emb|CAK05873.1| putative GrpE heat shock protein [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 210

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 118/148 (79%), Gaps = 5/148 (3%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS-APLDLAN 100
           E RD+YLR+ AEM+NLRRRT+RE KDA+SYS+A FARDML+VSDNL RALD+ +P     
Sbjct: 49  ELRDRYLRLAAEMDNLRRRTEREVKDAKSYSVAGFARDMLAVSDNLRRALDAISP----E 104

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
           ++  +++ L +LIEG+EMT R M+S LER+GV+K++   QKF+PN HQAMFE P+  VP 
Sbjct: 105 TKATADAGLSTLIEGVEMTERAMLSALERHGVRKLEPVGQKFDPNFHQAMFEVPNPDVPN 164

Query: 161 NTIIKVVQDGYAINERVLRPALVSISKG 188
           NT+++VVQ G+ I ERVLRPA+V ++KG
Sbjct: 165 NTVVQVVQAGFTIGERVLRPAMVGVAKG 192


>gi|49473734|ref|YP_031776.1| heat shock protein (hsp-70 cofactor) grpE [Bartonella quintana str.
           Toulouse]
 gi|52782866|sp|Q6G1E4|GRPE_BARQU RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|49239237|emb|CAF25557.1| Heat shock protein (hsp-70 cofactor) grpE [Bartonella quintana str.
           Toulouse]
          Length = 220

 Score =  188 bits (477), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 94/178 (52%), Positives = 134/178 (75%), Gaps = 6/178 (3%)

Query: 20  NSSTAEEKSEINIPEESL-NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFAR 78
           +S   EE +E++ P  +L ++++E +D+ LR++A+MENLRRRT R+  DA++YSIA FAR
Sbjct: 43  HSEVKEENNEVSDPLAALQDENKELKDQLLRLVADMENLRRRTARDVADAKAYSIANFAR 102

Query: 79  DMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
           DMLSVSDNL+RAL++ P       K++++ LK+L EG+EMT R M++ LER+GV+KI  +
Sbjct: 103 DMLSVSDNLNRALEAIP----EGAKENDAGLKTLAEGVEMTERAMIAALERHGVQKIYPE 158

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQN-PTE 195
            QKF+P+ HQAMFE P+  VP NT+ +VVQ GY I ERVLRPA+V ++KG T+  P E
Sbjct: 159 GQKFDPHFHQAMFEIPNCDVPDNTVQQVVQAGYIIGERVLRPAIVGVAKGGTKGVPVE 216


>gi|319404964|emb|CBI78566.1| heat shock protein GrpE [Bartonella sp. AR 15-3]
          Length = 219

 Score =  188 bits (477), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 119/154 (77%), Gaps = 4/154 (2%)

Query: 38  NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD 97
           ++++E RD+ LR+ A+MENLRRRT R+  DA++YSIA FARDMLSVSD+L RAL++ P D
Sbjct: 61  DENKELRDQILRLAADMENLRRRTARDIADAKTYSIANFARDMLSVSDDLQRALEAIPKD 120

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
              ++      LK+LIEG+EMT R MM+ LER+GVKKID + QKF+P+ HQAMFE P+  
Sbjct: 121 AGENDPG----LKTLIEGVEMTERAMMTALERHGVKKIDPEGQKFDPHFHQAMFEIPNAD 176

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISKGKTQ 191
           VP NT+ +VVQ GY I ERVLRPA+V ++KGK +
Sbjct: 177 VPENTVQQVVQAGYIIGERVLRPAIVGVTKGKVK 210


>gi|170749944|ref|YP_001756204.1| ribulose-phosphate 3-epimerase [Methylobacterium radiotolerans JCM
           2831]
 gi|170656466|gb|ACB25521.1| Ribulose-phosphate 3-epimerase [Methylobacterium radiotolerans JCM
           2831]
          Length = 204

 Score =  187 bits (476), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 89/186 (47%), Positives = 131/186 (70%), Gaps = 9/186 (4%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLN----QSEEFRDKYLRVIAEMENLRRRTD 62
           E      ++P+ A   +  E + ++   E+L     + +E +D+ LR +AEMENLRRRT+
Sbjct: 12  EAGAGAAQDPAPAGQGS--ESATVDPVAEALALLTAERDELKDRTLRTLAEMENLRRRTE 69

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           RE  DA++Y++  FARD+L+V+DN+ RALDS P   A+++  ++  LK LI+GIE+T R+
Sbjct: 70  REVADARAYAVTNFARDVLNVADNIRRALDSVP---ADAKATADGALKGLIDGIELTERD 126

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           +  TLER+GVK ++ + QKF+PN HQAMFE P+  VPA T+++VVQ GY I ERVLRPAL
Sbjct: 127 LAKTLERHGVKIVEPQGQKFDPNRHQAMFEVPNAEVPAGTVVQVVQAGYVIGERVLRPAL 186

Query: 183 VSISKG 188
           V ++KG
Sbjct: 187 VGVAKG 192


>gi|17988060|ref|NP_540694.1| heat shock protein GrpE [Brucella melitensis bv. 1 str. 16M]
 gi|261314616|ref|ZP_05953813.1| heat shock protein GrpE [Brucella pinnipedialis M163/99/10]
 gi|17983809|gb|AAL52958.1| grpe protein [Brucella melitensis bv. 1 str. 16M]
 gi|261303642|gb|EEY07139.1| heat shock protein GrpE [Brucella pinnipedialis M163/99/10]
          Length = 176

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 91/161 (56%), Positives = 119/161 (73%), Gaps = 4/161 (2%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E +D+ LRV AEMENLR+RT R+ +DA++Y+I  FARDMLSVSDNL RALD+ P D    
Sbjct: 17  ELKDQMLRVAAEMENLRKRTQRDVQDARAYAITNFARDMLSVSDNLRRALDAIPAD---- 72

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
             +++S LKSL EG+EMT R M+  LER+GVKK++ + QKF+PN HQAMFE P+  +P N
Sbjct: 73  ALEADSNLKSLSEGVEMTERAMLLALERHGVKKLEPEGQKFDPNFHQAMFEVPNPDLPNN 132

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIE 202
           T+++VVQ GYAI +RVLRPA+V +SKG  +   E    T E
Sbjct: 133 TVVQVVQAGYAIGDRVLRPAMVGVSKGGPKVSAENGASTSE 173


>gi|254707140|ref|ZP_05168968.1| heat shock protein GrpE [Brucella pinnipedialis M163/99/10]
          Length = 186

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 91/161 (56%), Positives = 119/161 (73%), Gaps = 4/161 (2%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E +D+ LRV AEMENLR+RT R+ +DA++Y+I  FARDMLSVSDNL RALD+ P D    
Sbjct: 27  ELKDQMLRVAAEMENLRKRTQRDVQDARAYAITNFARDMLSVSDNLRRALDAIPAD---- 82

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
             +++S LKSL EG+EMT R M+  LER+GVKK++ + QKF+PN HQAMFE P+  +P N
Sbjct: 83  ALEADSNLKSLSEGVEMTERAMLLALERHGVKKLEPEGQKFDPNFHQAMFEVPNPDLPNN 142

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIE 202
           T+++VVQ GYAI +RVLRPA+V +SKG  +   E    T E
Sbjct: 143 TVVQVVQAGYAIGDRVLRPAMVGVSKGGPKVSAENGASTSE 183


>gi|163842440|ref|YP_001626844.1| protein grpE [Brucella suis ATCC 23445]
 gi|189041735|sp|B0CJ30|GRPE_BRUSI RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|163673163|gb|ABY37274.1| Protein grpE [Brucella suis ATCC 23445]
          Length = 230

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 91/161 (56%), Positives = 119/161 (73%), Gaps = 4/161 (2%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E +D+ LRV AEMENLR+RT R+ +DA++Y+I  FARDMLSVSDNL RALD+ P D    
Sbjct: 71  ELKDQMLRVAAEMENLRKRTQRDVQDARAYAITNFARDMLSVSDNLRRALDAIPADAL-- 128

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
             +++S LKSL EG+EMT R M+  LER+GVKK++ + QKF+PN HQAMFE P+  +P N
Sbjct: 129 --EADSNLKSLSEGVEMTERAMLLALERHGVKKLEPEGQKFDPNFHQAMFEVPNPDLPNN 186

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIE 202
           T+++VVQ GYAI +RVLRPA+V +SKG  +   E    T E
Sbjct: 187 TVVQVVQAGYAIGDRVLRPAMVGVSKGGPKVSAENGASTSE 227


>gi|23501082|ref|NP_697209.1| heat shock protein GrpE [Brucella suis 1330]
 gi|161618159|ref|YP_001592046.1| protein grpE [Brucella canis ATCC 23365]
 gi|225626709|ref|ZP_03784748.1| Protein grpE [Brucella ceti str. Cudo]
 gi|225851704|ref|YP_002731937.1| heat shock protein GrpE [Brucella melitensis ATCC 23457]
 gi|254700976|ref|ZP_05162804.1| heat shock protein GrpE [Brucella suis bv. 5 str. 513]
 gi|254705347|ref|ZP_05167175.1| heat shock protein GrpE [Brucella suis bv. 3 str. 686]
 gi|254709317|ref|ZP_05171128.1| heat shock protein GrpE [Brucella pinnipedialis B2/94]
 gi|256030840|ref|ZP_05444454.1| heat shock protein GrpE [Brucella pinnipedialis M292/94/1]
 gi|256060310|ref|ZP_05450483.1| heat shock protein GrpE [Brucella neotomae 5K33]
 gi|256112673|ref|ZP_05453594.1| heat shock protein GrpE [Brucella melitensis bv. 3 str. Ether]
 gi|256158869|ref|ZP_05456723.1| heat shock protein GrpE [Brucella ceti M490/95/1]
 gi|256254246|ref|ZP_05459782.1| heat shock protein GrpE [Brucella ceti B1/94]
 gi|256264786|ref|ZP_05467318.1| protein grpE [Brucella melitensis bv. 2 str. 63/9]
 gi|256368635|ref|YP_003106141.1| heat shock protein GrpE [Brucella microti CCM 4915]
 gi|260169744|ref|ZP_05756555.1| heat shock protein GrpE [Brucella sp. F5/99]
 gi|260567192|ref|ZP_05837662.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|261221397|ref|ZP_05935678.1| protein grpE [Brucella ceti B1/94]
 gi|261316828|ref|ZP_05956025.1| grpE [Brucella pinnipedialis B2/94]
 gi|261324285|ref|ZP_05963482.1| protein grpE [Brucella neotomae 5K33]
 gi|261751497|ref|ZP_05995206.1| protein grpE [Brucella suis bv. 5 str. 513]
 gi|261756060|ref|ZP_05999769.1| protein grpE [Brucella suis bv. 3 str. 686]
 gi|261759285|ref|ZP_06002994.1| protein grpE [Brucella sp. F5/99]
 gi|265987898|ref|ZP_06100455.1| protein grpE [Brucella pinnipedialis M292/94/1]
 gi|265994116|ref|ZP_06106673.1| protein grpE [Brucella melitensis bv. 3 str. Ether]
 gi|265997359|ref|ZP_06109916.1| protein grpE [Brucella ceti M490/95/1]
 gi|294851569|ref|ZP_06792242.1| grpE [Brucella sp. NVSL 07-0026]
 gi|306844438|ref|ZP_07477028.1| heat shock protein GrpE [Brucella sp. BO1]
 gi|52782949|sp|Q8G2Y6|GRPE_BRUSU RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|189041734|sp|A9M7B6|GRPE_BRUC2 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|23346951|gb|AAN29124.1| heat shock protein GrpE [Brucella suis 1330]
 gi|161334970|gb|ABX61275.1| Protein grpE [Brucella canis ATCC 23365]
 gi|225618366|gb|EEH15409.1| Protein grpE [Brucella ceti str. Cudo]
 gi|225640069|gb|ACN99982.1| Protein grpE [Brucella melitensis ATCC 23457]
 gi|255998793|gb|ACU47192.1| heat shock protein GrpE [Brucella microti CCM 4915]
 gi|260156710|gb|EEW91790.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260919981|gb|EEX86634.1| protein grpE [Brucella ceti B1/94]
 gi|261296051|gb|EEX99547.1| grpE [Brucella pinnipedialis B2/94]
 gi|261300265|gb|EEY03762.1| protein grpE [Brucella neotomae 5K33]
 gi|261739269|gb|EEY27265.1| protein grpE [Brucella sp. F5/99]
 gi|261741250|gb|EEY29176.1| protein grpE [Brucella suis bv. 5 str. 513]
 gi|261745813|gb|EEY33739.1| protein grpE [Brucella suis bv. 3 str. 686]
 gi|262551827|gb|EEZ07817.1| protein grpE [Brucella ceti M490/95/1]
 gi|262765097|gb|EEZ11018.1| protein grpE [Brucella melitensis bv. 3 str. Ether]
 gi|263095195|gb|EEZ18864.1| protein grpE [Brucella melitensis bv. 2 str. 63/9]
 gi|264660095|gb|EEZ30356.1| protein grpE [Brucella pinnipedialis M292/94/1]
 gi|294820158|gb|EFG37157.1| grpE [Brucella sp. NVSL 07-0026]
 gi|306275251|gb|EFM57001.1| heat shock protein GrpE [Brucella sp. BO1]
 gi|326408192|gb|ADZ65257.1| heat shock protein GrpE [Brucella melitensis M28]
 gi|326537907|gb|ADZ86122.1| protein grpE [Brucella melitensis M5-90]
          Length = 230

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 91/161 (56%), Positives = 119/161 (73%), Gaps = 4/161 (2%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E +D+ LRV AEMENLR+RT R+ +DA++Y+I  FARDMLSVSDNL RALD+ P D    
Sbjct: 71  ELKDQMLRVAAEMENLRKRTQRDVQDARAYAITNFARDMLSVSDNLRRALDAIPADAL-- 128

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
             +++S LKSL EG+EMT R M+  LER+GVKK++ + QKF+PN HQAMFE P+  +P N
Sbjct: 129 --EADSNLKSLSEGVEMTERAMLLALERHGVKKLEPEGQKFDPNFHQAMFEVPNPDLPNN 186

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIE 202
           T+++VVQ GYAI +RVLRPA+V +SKG  +   E    T E
Sbjct: 187 TVVQVVQAGYAIGDRVLRPAMVGVSKGGPKVSAENGASTSE 227


>gi|306842544|ref|ZP_07475195.1| heat shock protein GrpE [Brucella sp. BO2]
 gi|306287400|gb|EFM58880.1| heat shock protein GrpE [Brucella sp. BO2]
          Length = 234

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 91/161 (56%), Positives = 119/161 (73%), Gaps = 4/161 (2%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E +D+ LRV AEMENLR+RT R+ +DA++Y+I  FARDMLSVSDNL RALD+ P D    
Sbjct: 75  ELKDQMLRVAAEMENLRKRTQRDVQDARAYAITNFARDMLSVSDNLRRALDAIPADAL-- 132

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
             +++S LKSL EG+EMT R M+  LER+GVKK++ + QKF+PN HQAMFE P+  +P N
Sbjct: 133 --EADSNLKSLSEGVEMTERAMLLALERHGVKKLEPEGQKFDPNFHQAMFEVPNPDLPNN 190

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIE 202
           T+++VVQ GYAI +RVLRPA+V +SKG  +   E    T E
Sbjct: 191 TVVQVVQAGYAIGDRVLRPAMVGVSKGGPKVSAENGASTSE 231


>gi|254713262|ref|ZP_05175073.1| heat shock protein GrpE [Brucella ceti M644/93/1]
 gi|254716385|ref|ZP_05178196.1| heat shock protein GrpE [Brucella ceti M13/05/1]
 gi|261218171|ref|ZP_05932452.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261320981|ref|ZP_05960178.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|260923260|gb|EEX89828.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261293671|gb|EEX97167.1| conserved hypothetical protein [Brucella ceti M644/93/1]
          Length = 230

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 91/161 (56%), Positives = 119/161 (73%), Gaps = 4/161 (2%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E +D+ LRV AEMENLR+RT R+ +DA++Y+I  FARDMLSVSDNL RALD+ P D    
Sbjct: 71  ELKDQMLRVAAEMENLRKRTQRDVQDARAYAITNFARDMLSVSDNLRRALDAIPADAL-- 128

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
             +++S LKSL EG+EMT R M+  LER+GVKK++ + QKF+PN HQAMFE P+  +P N
Sbjct: 129 --EADSNLKSLSEGVEMTERAMLLALERHGVKKLEPEGQKFDPNFHQAMFEVPNPDLPNN 186

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIE 202
           T+++VVQ GYAI +RVLRPA+V +SKG  +   E    T E
Sbjct: 187 TVVQVVQAGYAIGDRVLRPAMVGVSKGGPKVSAENGASTSE 227


>gi|62289147|ref|YP_220940.1| heat shock protein GrpE [Brucella abortus bv. 1 str. 9-941]
 gi|82699086|ref|YP_413660.1| heat shock protein GrpE [Brucella melitensis biovar Abortus 2308]
 gi|189023421|ref|YP_001934189.1| heat shock protein GrpE [Brucella abortus S19]
 gi|237814640|ref|ZP_04593638.1| Protein grpE [Brucella abortus str. 2308 A]
 gi|254690472|ref|ZP_05153726.1| heat shock protein GrpE [Brucella abortus bv. 6 str. 870]
 gi|254694961|ref|ZP_05156789.1| heat shock protein GrpE [Brucella abortus bv. 3 str. Tulya]
 gi|254696592|ref|ZP_05158420.1| heat shock protein GrpE [Brucella abortus bv. 2 str. 86/8/59]
 gi|254731505|ref|ZP_05190083.1| heat shock protein GrpE [Brucella abortus bv. 4 str. 292]
 gi|256045960|ref|ZP_05448832.1| heat shock protein GrpE [Brucella melitensis bv. 1 str. Rev.1]
 gi|256258728|ref|ZP_05464264.1| heat shock protein GrpE [Brucella abortus bv. 9 str. C68]
 gi|260546444|ref|ZP_05822184.1| grpE [Brucella abortus NCTC 8038]
 gi|260563243|ref|ZP_05833729.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260756026|ref|ZP_05868374.1| HSP-70 cofactor [Brucella abortus bv. 6 str. 870]
 gi|260759250|ref|ZP_05871598.1| HSP-70 cofactor [Brucella abortus bv. 4 str. 292]
 gi|260760972|ref|ZP_05873315.1| HSP-70 cofactor [Brucella abortus bv. 2 str. 86/8/59]
 gi|260885047|ref|ZP_05896661.1| protein grpE [Brucella abortus bv. 9 str. C68]
 gi|261215303|ref|ZP_05929584.1| HSP-70 cofactor [Brucella abortus bv. 3 str. Tulya]
 gi|265992373|ref|ZP_06104930.1| protein grpE [Brucella melitensis bv. 1 str. Rev.1]
 gi|297247563|ref|ZP_06931281.1| grpE protein [Brucella abortus bv. 5 str. B3196]
 gi|52782965|sp|Q8YEV0|GRPE_BRUME RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|62195279|gb|AAX73579.1| GrpE, heat shock protein [Brucella abortus bv. 1 str. 9-941]
 gi|82615187|emb|CAJ10126.1| GrpE protein [Brucella melitensis biovar Abortus 2308]
 gi|189018993|gb|ACD71715.1| GrpE protein [Brucella abortus S19]
 gi|237789477|gb|EEP63687.1| Protein grpE [Brucella abortus str. 2308 A]
 gi|260096551|gb|EEW80427.1| grpE [Brucella abortus NCTC 8038]
 gi|260153259|gb|EEW88351.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260669568|gb|EEX56508.1| HSP-70 cofactor [Brucella abortus bv. 4 str. 292]
 gi|260671404|gb|EEX58225.1| HSP-70 cofactor [Brucella abortus bv. 2 str. 86/8/59]
 gi|260676134|gb|EEX62955.1| HSP-70 cofactor [Brucella abortus bv. 6 str. 870]
 gi|260874575|gb|EEX81644.1| protein grpE [Brucella abortus bv. 9 str. C68]
 gi|260916910|gb|EEX83771.1| HSP-70 cofactor [Brucella abortus bv. 3 str. Tulya]
 gi|263003439|gb|EEZ15732.1| protein grpE [Brucella melitensis bv. 1 str. Rev.1]
 gi|297174732|gb|EFH34079.1| grpE protein [Brucella abortus bv. 5 str. B3196]
          Length = 226

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 91/161 (56%), Positives = 119/161 (73%), Gaps = 4/161 (2%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E +D+ LRV AEMENLR+RT R+ +DA++Y+I  FARDMLSVSDNL RALD+ P D    
Sbjct: 67  ELKDQMLRVAAEMENLRKRTQRDVQDARAYAITNFARDMLSVSDNLRRALDAIPADAL-- 124

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
             +++S LKSL EG+EMT R M+  LER+GVKK++ + QKF+PN HQAMFE P+  +P N
Sbjct: 125 --EADSNLKSLSEGVEMTERAMLLALERHGVKKLEPEGQKFDPNFHQAMFEVPNPDLPNN 182

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIE 202
           T+++VVQ GYAI +RVLRPA+V +SKG  +   E    T E
Sbjct: 183 TVVQVVQAGYAIGDRVLRPAMVGVSKGGPKVSAENGASTSE 223


>gi|148560678|ref|YP_001258203.1| heat shock protein GrpE [Brucella ovis ATCC 25840]
 gi|166215250|sp|A5VNA6|GRPE_BRUO2 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|148371935|gb|ABQ61914.1| heat shock protein GrpE [Brucella ovis ATCC 25840]
          Length = 230

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 91/161 (56%), Positives = 119/161 (73%), Gaps = 4/161 (2%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E +D+ LRV AEMENLR+RT R+ +DA++Y+I  FARDMLSVSDNL RALD+ P D    
Sbjct: 71  ELKDQMLRVAAEMENLRKRTQRDVQDARAYAITNFARDMLSVSDNLRRALDTIPADAL-- 128

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
             +++S LKSL EG+EMT R M+  LER+GVKK++ + QKF+PN HQAMFE P+  +P N
Sbjct: 129 --EADSNLKSLSEGVEMTERAMLLALERHGVKKLEPEGQKFDPNFHQAMFEVPNPDLPNN 186

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIE 202
           T+++VVQ GYAI +RVLRPA+V +SKG  +   E    T E
Sbjct: 187 TVVQVVQAGYAIGDRVLRPAMVGVSKGGPKVSAENGASTSE 227


>gi|254718385|ref|ZP_05180196.1| heat shock protein GrpE [Brucella sp. 83/13]
 gi|265983349|ref|ZP_06096084.1| grpE [Brucella sp. 83/13]
 gi|306839618|ref|ZP_07472422.1| heat shock protein GrpE [Brucella sp. NF 2653]
 gi|264661941|gb|EEZ32202.1| grpE [Brucella sp. 83/13]
 gi|306405316|gb|EFM61591.1| heat shock protein GrpE [Brucella sp. NF 2653]
          Length = 230

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 91/161 (56%), Positives = 119/161 (73%), Gaps = 4/161 (2%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E +D+ LRV AEMENLR+RT R+ +DA++Y+I  FARDMLSVSDNL RALD+ P D    
Sbjct: 71  ELKDQMLRVAAEMENLRKRTQRDVQDARAYAITNFARDMLSVSDNLRRALDAIPADAL-- 128

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
             +++S LKSL EG+EMT R M+  LER+GVKK++ + QKF+PN HQAMFE P+  +P N
Sbjct: 129 --EADSNLKSLSEGVEMTERAMLLALERHGVKKLEPEGQKFDPNFHQAMFEVPNPDLPNN 186

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIE 202
           T+++VVQ GYAI +RVLRPA+V +SKG  +   E    T E
Sbjct: 187 TVVQVVQAGYAIGDRVLRPAMVGVSKGGPKISAENGASTSE 227


>gi|240849731|ref|YP_002971119.1| heat shock protein GrpE [Bartonella grahamii as4aup]
 gi|240266854|gb|ACS50442.1| heat shock protein GrpE [Bartonella grahamii as4aup]
          Length = 220

 Score =  185 bits (470), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 122/159 (76%), Gaps = 4/159 (2%)

Query: 38  NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD 97
           ++++E +D+ LR++A+MENLRRRT R+  DA++YSIA FARDMLSVSDNL+RAL++ P  
Sbjct: 62  DENKELKDQLLRLVADMENLRRRTMRDVADAKAYSIANFARDMLSVSDNLNRALEAIP-- 119

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
                ++S++ LKSL EG+EMT R MM+ LER+GV+KI  + QKF+P+ HQAMFE P+  
Sbjct: 120 --EGARESDAGLKSLAEGVEMTERAMMAALERHGVQKIHPEGQKFDPHFHQAMFEIPNAD 177

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEE 196
           VP NT+ +VVQ GY I ERVLRPA+V ++KG  +  + E
Sbjct: 178 VPDNTVQQVVQAGYIIGERVLRPAIVGVAKGGAKEASVE 216


>gi|163867358|ref|YP_001608552.1| heat shock protein GrpE [Bartonella tribocorum CIP 105476]
 gi|254799580|sp|A9ILE9|GRPE_BART1 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|161016999|emb|CAK00557.1| heat shock protein GrpE [Bartonella tribocorum CIP 105476]
          Length = 222

 Score =  185 bits (470), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 128/168 (76%), Gaps = 6/168 (3%)

Query: 25  EEKSEINIPEESL-NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSV 83
           EE  E++ P  SL ++++E +++ LR+ A+MENLRRRT R+  DA++YSIA FARDMLSV
Sbjct: 48  EESKEVD-PLASLQDENKELKNQLLRLAADMENLRRRTARDVADARAYSIANFARDMLSV 106

Query: 84  SDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFN 143
           SDNL+RAL++ P       ++S++ LKSL EG+EMT R MM+ LER+GV+KI  + QKF+
Sbjct: 107 SDNLNRALEAIP----EGARESDAGLKSLAEGVEMTERAMMAALERHGVQKIHPEGQKFD 162

Query: 144 PNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQ 191
           P+ HQAMFE P+  VP NT+ +VVQ GY I ERVLRPA+V ++KG T+
Sbjct: 163 PHFHQAMFEIPNADVPDNTVQQVVQAGYIIGERVLRPAIVGVAKGGTK 210


>gi|188579683|ref|YP_001923128.1| GrpE protein [Methylobacterium populi BJ001]
 gi|179343181|gb|ACB78593.1| GrpE protein [Methylobacterium populi BJ001]
          Length = 202

 Score =  185 bits (469), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 113/148 (76%), Gaps = 3/148 (2%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           +EF+D+ LR +AEMENLRRRT+RE  DA++Y++  FARDML+ +DN+ RAL+S P   A+
Sbjct: 43  DEFKDRLLRTLAEMENLRRRTEREVADARTYAVTNFARDMLNAADNIHRALESVP---AD 99

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
           +   +E   K+L+EGIE+T R++  TLER+GVK +D + Q+F+PN HQAMFE P+  VP 
Sbjct: 100 ARASAEGAFKALVEGIELTERDLAKTLERHGVKVVDPQGQRFDPNRHQAMFEVPNTEVPN 159

Query: 161 NTIIKVVQDGYAINERVLRPALVSISKG 188
            T+++VVQ GY I ER LRPALV +SKG
Sbjct: 160 GTVVQVVQTGYVIGERTLRPALVGVSKG 187


>gi|218674689|ref|ZP_03524358.1| molecular chaperone heat shock protein [Rhizobium etli GR56]
          Length = 232

 Score =  185 bits (469), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 93/187 (49%), Positives = 132/187 (70%), Gaps = 12/187 (6%)

Query: 20  NSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARD 79
           N +  EE ++ +  E    ++ E RD+YLR+ AEM+NLRRRT+RE KDA+SYS+A FARD
Sbjct: 27  NDTVQEETAQPDPLELLKAENSELRDRYLRLAAEMDNLRRRTEREVKDAKSYSVAGFARD 86

Query: 80  MLSVSDNLSRALDS-APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
           ML+VSDNL RALD+ +P     ++  +++ L +LIEG+EMT R M+S LER+GV+K++  
Sbjct: 87  MLAVSDNLRRALDAISP----EAKATADAGLTTLIEGVEMTERAMLSALERHGVRKLEPV 142

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG-------KTQ 191
            QKF+PN H AMFE P+  V  NT+++VVQ G+ I ERVLRPA+V ++KG       +TQ
Sbjct: 143 GQKFDPNFHHAMFEVPNPEVANNTVVQVVQAGFTIGERVLRPAMVGVAKGGPKPAEAETQ 202

Query: 192 NPTEEKK 198
            P   ++
Sbjct: 203 FPCSTRR 209


>gi|319406452|emb|CBI80092.1| heat shock protein GrpE [Bartonella sp. 1-1C]
          Length = 220

 Score =  185 bits (469), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 119/154 (77%), Gaps = 4/154 (2%)

Query: 38  NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD 97
           +++++ +DK LR+ A+MENLRRRT R+  DA++YSIA FARDMLSVSD+L RAL + P D
Sbjct: 62  DENKQLKDKILRLAADMENLRRRTARDVADAKAYSIANFARDMLSVSDDLHRALAAIPKD 121

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
                 ++ S LK+L+EG+EMT R MM+ LER+GVKKID + QKF+P+ HQAMFE P+  
Sbjct: 122 AG----ENNSGLKTLVEGVEMTERAMMTALERHGVKKIDPEGQKFDPHFHQAMFEIPNAE 177

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISKGKTQ 191
           VP NT+ +VVQ GY I ERVLRPA+V ++KG+ +
Sbjct: 178 VPENTVQQVVQAGYIIGERVLRPAIVGVTKGEVK 211


>gi|153007525|ref|YP_001368740.1| heat shock protein GrpE [Ochrobactrum anthropi ATCC 49188]
 gi|166215272|sp|A6WVA7|GRPE_OCHA4 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|151559413|gb|ABS12911.1| Ribulose-phosphate 3-epimerase [Ochrobactrum anthropi ATCC 49188]
          Length = 228

 Score =  184 bits (468), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 114/147 (77%), Gaps = 4/147 (2%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E +D+ LR  AEMENLR+RT R+ +DA++Y++  FARDMLSVSDNL RALD+ P D    
Sbjct: 71  ELKDQLLRAAAEMENLRKRTQRDVQDARTYAVTNFARDMLSVSDNLRRALDAIPADAL-- 128

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
              +++ LKSL +G+EMT R M+  LER+GVKK++ + +KF+PN HQAMFE P+  +P N
Sbjct: 129 --ATDASLKSLADGVEMTERAMLQALERHGVKKLEPEGEKFDPNFHQAMFEVPNPDLPNN 186

Query: 162 TIIKVVQDGYAINERVLRPALVSISKG 188
           T+++VVQDGYAI +RVLRPA+V +SKG
Sbjct: 187 TVVQVVQDGYAIGDRVLRPAMVGVSKG 213


>gi|163757819|ref|ZP_02164908.1| probable heat shock protein [Hoeflea phototrophica DFL-43]
 gi|162285321|gb|EDQ35603.1| probable heat shock protein [Hoeflea phototrophica DFL-43]
          Length = 220

 Score =  184 bits (467), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 136/189 (71%), Gaps = 4/189 (2%)

Query: 5   MSEKNIDKEKNPSNANSST-AEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDR 63
           MS+++  +E +   A++S  A+   EI+       + EE +D+ LR+ AEMENLRRRT R
Sbjct: 18  MSDESQGREHDKPEADASVEADSPQEIDPIAALTAEIEELKDQRLRMAAEMENLRRRTAR 77

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           + KDA+SY+I+ FARDML VSDNL RAL + P     ++  +++ LK+LIEG+E+T + M
Sbjct: 78  DVKDAKSYAISGFARDMLQVSDNLERALAAVP---EQADDATDNGLKTLIEGVELTGKAM 134

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
           +S LER+GV+K++ K QKF+PN HQAMFE P+  VP NT+I+VVQ GY I +R+LRPA+V
Sbjct: 135 LSALERHGVRKLEPKGQKFDPNFHQAMFEVPNTEVPNNTVIEVVQPGYVIADRMLRPAMV 194

Query: 184 SISKGKTQN 192
            ++KG  ++
Sbjct: 195 GVAKGGPKD 203


>gi|114706055|ref|ZP_01438958.1| probable heat shock protein [Fulvimarina pelagi HTCC2506]
 gi|114538901|gb|EAU42022.1| probable heat shock protein [Fulvimarina pelagi HTCC2506]
          Length = 229

 Score =  184 bits (467), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 116/147 (78%), Gaps = 3/147 (2%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           + +D+ +R+ A+MENLRRRT+R+ KDA++Y++  FAR+MLSV+DNL RALD+ P +   +
Sbjct: 52  DVKDRLIRLAADMENLRRRTERDVKDARNYAVTNFAREMLSVADNLRRALDAVPEE---A 108

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
               ES L +LIEG+EMT R + +TLE++GVKK+D + QKF+PN HQAMFE P+  VP N
Sbjct: 109 RAGGESGLTALIEGVEMTERGLQATLEKHGVKKLDPEGQKFDPNYHQAMFEVPNPDVPNN 168

Query: 162 TIIKVVQDGYAINERVLRPALVSISKG 188
           T+++VVQ GYAI ERVLRPA+V ++KG
Sbjct: 169 TVVQVVQAGYAIGERVLRPAMVGVAKG 195


>gi|49474880|ref|YP_032921.1| heat shock protein (hsp-70 cofactor) grpE [Bartonella henselae str.
           Houston-1]
 gi|52782867|sp|Q6G563|GRPE_BARHE RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|49237685|emb|CAF26872.1| Heat shock protein (hsp-70 cofactor) grpE [Bartonella henselae str.
           Houston-1]
          Length = 220

 Score =  184 bits (467), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 87/159 (54%), Positives = 122/159 (76%), Gaps = 4/159 (2%)

Query: 38  NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD 97
           ++++E +D+ LR+ A+MENLRRRT R+  DA++YSIA FARDMLSVSDNL+RALD+ P  
Sbjct: 62  DENKELKDQLLRLAADMENLRRRTARDVADAKAYSIANFARDMLSVSDNLNRALDAIP-- 119

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
                K++++ LK+L EG+EMT R M++ LER+GV+KI  + QKF+P+ HQAMFE P+  
Sbjct: 120 --EGAKENDAGLKTLAEGVEMTERAMIAALERHGVQKIHPEGQKFDPHFHQAMFEIPNSD 177

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEE 196
           VP NT+ +VVQ GY I ERVLRPA+V ++KG  ++ + E
Sbjct: 178 VPDNTVQQVVQAGYIIGERVLRPAIVGVAKGGAKDISVE 216


>gi|218528431|ref|YP_002419247.1| ribulose-phosphate 3-epimerase [Methylobacterium chloromethanicum
           CM4]
 gi|218520734|gb|ACK81319.1| Ribulose-phosphate 3-epimerase [Methylobacterium chloromethanicum
           CM4]
          Length = 202

 Score =  183 bits (464), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 88/188 (46%), Positives = 124/188 (65%), Gaps = 6/188 (3%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           ME        + E  P +  S T  +   +     ++ + +EF+D+ LR +AEMENLRRR
Sbjct: 6   MEKHERHDGAEAEVPPQSGASQTGADAEGLAA---AIAERDEFKDRLLRTLAEMENLRRR 62

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+RE  DA++Y++  FARDML+ +DN+ RALDS P +   +   +E   K LIEGI++T 
Sbjct: 63  TEREVADARTYAVTNFARDMLNTADNIRRALDSVPEE---ARAGAEGPFKGLIEGIDLTE 119

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           R++  TLER+GVK +D K Q+F+PN HQAMFE P+  VP  T+++VVQ GY I +R LRP
Sbjct: 120 RDLTKTLERHGVKVVDPKGQRFDPNRHQAMFEVPNTEVPNGTVVQVVQTGYVIGDRTLRP 179

Query: 181 ALVSISKG 188
           ALV +SKG
Sbjct: 180 ALVGVSKG 187


>gi|319403539|emb|CBI77120.1| heat shock protein GrpE [Bartonella rochalimae ATCC BAA-1498]
          Length = 220

 Score =  183 bits (464), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 118/154 (76%), Gaps = 4/154 (2%)

Query: 38  NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD 97
           +++++ +D+ LR+ A+MENLRRRT R+  DA++YSIA FARDMLSVSD+L RAL + P D
Sbjct: 62  DENKQLKDQILRLAADMENLRRRTARDVADAKAYSIANFARDMLSVSDDLHRALAAIPKD 121

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
                 ++ S LK+L+EG+EMT R MM+ LER+GVKKID + QKF+P+ HQAMFE P+  
Sbjct: 122 AG----ENNSGLKTLVEGVEMTERAMMTALERHGVKKIDPEGQKFDPHFHQAMFEIPNAD 177

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISKGKTQ 191
           VP NT+ +VVQ GY I ERVLRPA+V ++KG  +
Sbjct: 178 VPENTVQQVVQAGYIIGERVLRPAIVGVTKGAVK 211


>gi|218509095|ref|ZP_03506973.1| molecular chaperone heat shock protein [Rhizobium etli Brasil 5]
          Length = 205

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 125/170 (73%), Gaps = 5/170 (2%)

Query: 20  NSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARD 79
           N +  EE ++ +  E    ++ E RD+YLR+ AEM+NLRRRT+RE KDA+SYS+A FARD
Sbjct: 27  NDTVQEETAQPDPLELLKAENSELRDRYLRLAAEMDNLRRRTEREVKDAKSYSVAGFARD 86

Query: 80  MLSVSDNLSRALDS-APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
           ML+VSDNL RALD+ +P     ++  +++ L +LIEG+EMT R M+S LER+GV+K++  
Sbjct: 87  MLAVSDNLRRALDAISP----EAKATADAGLTTLIEGVEMTERAMLSALERHGVRKLEPV 142

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
            QKF+PN H AMFE P+  V  NT+++VV  G+ I ERVLRPA+V ++KG
Sbjct: 143 GQKFDPNFHHAMFEVPNPEVANNTVVQVVHAGFTIGERVLRPAMVGVAKG 192


>gi|239831017|ref|ZP_04679346.1| Protein grpE [Ochrobactrum intermedium LMG 3301]
 gi|239823284|gb|EEQ94852.1| Protein grpE [Ochrobactrum intermedium LMG 3301]
          Length = 245

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 114/147 (77%), Gaps = 4/147 (2%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E +D+ LR  AEMENLR+RT R+ +DA++Y++  FARDMLSVSDNL RAL++ P +    
Sbjct: 86  ELKDQLLRAAAEMENLRKRTQRDVQDARTYAVTNFARDMLSVSDNLRRALEAIPAE---- 141

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
              +++ LKSL +G+EMT R M+  LER+GVKK++ + QKF+PN HQAMFE P+  +P N
Sbjct: 142 AMATDASLKSLADGVEMTERAMLHALERHGVKKLEPEGQKFDPNFHQAMFEVPNADLPNN 201

Query: 162 TIIKVVQDGYAINERVLRPALVSISKG 188
           T+++VVQDGYAI +RVLRPA+V +SKG
Sbjct: 202 TVVQVVQDGYAIGDRVLRPAMVGVSKG 228


>gi|240137000|ref|YP_002961469.1| putative heat shock protein (HSP-70 COFACTOR), grpE
           [Methylobacterium extorquens AM1]
 gi|240006966|gb|ACS38192.1| putative heat shock protein (HSP-70 COFACTOR), grpE
           [Methylobacterium extorquens AM1]
          Length = 202

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 82/153 (53%), Positives = 114/153 (74%), Gaps = 3/153 (1%)

Query: 36  SLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAP 95
           ++ + +EF+D+ LR +AEMENLRRRT+RE  DA++Y++  FARDML+ +DN+ RALDS P
Sbjct: 38  AIAERDEFKDRLLRTLAEMENLRRRTEREVADARTYAVTNFARDMLNTADNIRRALDSVP 97

Query: 96  LDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPH 155
            +   +   +E   K LIEGI++T R++  TLER+GVK +D K Q+F+PN HQAMFE P+
Sbjct: 98  EE---ARAGAEGPFKGLIEGIDLTERDLTKTLERHGVKVVDPKGQRFDPNRHQAMFEVPN 154

Query: 156 DTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
             VP  T+++VVQ GY I +R LRPALV +SKG
Sbjct: 155 TEVPNGTVVQVVQTGYVIGDRTLRPALVGVSKG 187


>gi|163849788|ref|YP_001637831.1| ribulose-phosphate 3-epimerase [Methylobacterium extorquens PA1]
 gi|163661393|gb|ABY28760.1| Ribulose-phosphate 3-epimerase [Methylobacterium extorquens PA1]
          Length = 202

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 82/153 (53%), Positives = 114/153 (74%), Gaps = 3/153 (1%)

Query: 36  SLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAP 95
           ++ + +EF+D+ LR +AEMENLRRRT+RE  DA++Y++  FARDML+ +DN+ RALDS P
Sbjct: 38  AIAERDEFKDRLLRTLAEMENLRRRTEREVADARTYAVTNFARDMLNTADNIRRALDSVP 97

Query: 96  LDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPH 155
            +   +   +E   K LIEGI++T R++  TLER+GVK +D K Q+F+PN HQAMFE P+
Sbjct: 98  EE---ARAGAEGPFKGLIEGIDLTERDLTKTLERHGVKVVDPKGQRFDPNRHQAMFEVPN 154

Query: 156 DTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
             VP  T+++VVQ GY I +R LRPALV +SKG
Sbjct: 155 TEVPNGTVVQVVQTGYVIGDRTLRPALVGVSKG 187


>gi|316931689|ref|YP_004106671.1| GrpE protein [Rhodopseudomonas palustris DX-1]
 gi|315599403|gb|ADU41938.1| GrpE protein [Rhodopseudomonas palustris DX-1]
          Length = 207

 Score =  182 bits (462), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 92/196 (46%), Positives = 130/196 (66%), Gaps = 12/196 (6%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINI----PEESLNQS-----EEFRDKYLRVIAEME 55
           M+E +  K+ N   A ++     S+  I    PEE  N++      + RDK LR +AEME
Sbjct: 1   MTETDGQKDNNQDTAQAAADPVVSKPYIMPDDPEEGSNEALVREAADARDKMLRTLAEME 60

Query: 56  NLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEG 115
           NLRRRT +E  DA++Y +  FARD+L ++DNL RALD+ P   A++   +E  LK+LIEG
Sbjct: 61  NLRRRTQKEVADARTYGVTSFARDVLDIADNLQRALDAVP---ADARANAEPGLKALIEG 117

Query: 116 IEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINE 175
           +E+T R +++ LE+ GVKK D K QKF+PN  QAM+E P  +VPA T+++VVQ G+ I E
Sbjct: 118 VELTERSLLNALEKNGVKKFDPKGQKFDPNFQQAMYEVPDPSVPAGTVVQVVQAGFTIGE 177

Query: 176 RVLRPALVSISKGKTQ 191
           RVLRPALV ++KG  +
Sbjct: 178 RVLRPALVGVAKGGAK 193


>gi|118593733|ref|ZP_01551102.1| GRPE protein [Stappia aggregata IAM 12614]
 gi|118433643|gb|EAV40306.1| GRPE protein [Stappia aggregata IAM 12614]
          Length = 207

 Score =  182 bits (462), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 85/164 (51%), Positives = 125/164 (76%), Gaps = 5/164 (3%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           + +D+ LRV+AEMENLRRRT++E KDA+ Y+++ FARDML+VSDNL RAL++ P D    
Sbjct: 45  DLKDRALRVMAEMENLRRRTEKEVKDARQYAVSGFARDMLTVSDNLRRALEALPED---D 101

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
            K +++ + SLIEG+EM  R++++ LE+ GVKK+D + QKF+PN HQAMFE P+  VP N
Sbjct: 102 RKNADAGVASLIEGVEMIERDLLNQLEKNGVKKLDPEGQKFDPNFHQAMFEVPNTEVPNN 161

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGKTQN--PTEEKKETIEQ 203
           T+++V+Q GY I +RVLRPA+V +SKG  ++   T E  +T+++
Sbjct: 162 TVVQVMQAGYVIGDRVLRPAMVGVSKGGPKDVAATAEAGQTVDK 205


>gi|23012592|ref|ZP_00052639.1| COG0576: Molecular chaperone GrpE (heat shock protein)
           [Magnetospirillum magnetotacticum MS-1]
          Length = 208

 Score =  182 bits (461), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 82/153 (53%), Positives = 113/153 (73%), Gaps = 3/153 (1%)

Query: 36  SLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAP 95
           ++ + +EF+D+ LR +AEMENLRRRT+RE  DA++Y++  FARDML+ +DN+ RAL+S P
Sbjct: 41  TIAERDEFKDRLLRTLAEMENLRRRTEREVADARTYAVTSFARDMLNAADNIRRALESVP 100

Query: 96  LDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPH 155
            D   +   +E   K LIEGIE+T R++  TLER+GVK +D   Q+F+PN HQAMFE P+
Sbjct: 101 ED---ARAGAEGAFKGLIEGIELTERDLAKTLERHGVKVVDPNGQRFDPNRHQAMFEVPN 157

Query: 156 DTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
             VP  T+++VVQ GY I +R LRPALV +SKG
Sbjct: 158 TEVPNGTVVQVVQTGYIIGDRTLRPALVGVSKG 190


>gi|254558852|ref|YP_003065947.1| heat shock protein [Methylobacterium extorquens DM4]
 gi|254266130|emb|CAX21882.1| putative heat shock protein (HSP-70 COFACTOR), grpE
           [Methylobacterium extorquens DM4]
          Length = 202

 Score =  182 bits (461), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 82/153 (53%), Positives = 114/153 (74%), Gaps = 3/153 (1%)

Query: 36  SLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAP 95
           ++ + +EF+D+ LR +AEMENLRRRT+RE  DA++Y++  FARDML+ +DN+ RALDS P
Sbjct: 38  AIAERDEFKDRLLRTLAEMENLRRRTEREVADARTYAVTNFARDMLNTADNIRRALDSVP 97

Query: 96  LDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPH 155
            +   +   +E   K LIEGI++T R++  TLER+GVK +D K Q+F+PN HQAMFE P+
Sbjct: 98  EE---ARAGAEGPFKDLIEGIDLTERDLTKTLERHGVKVVDPKGQRFDPNRHQAMFEVPN 154

Query: 156 DTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
             VP  T+++VVQ GY I +R LRPALV +SKG
Sbjct: 155 TEVPNGTVVQVVQTGYVIGDRTLRPALVGVSKG 187


>gi|254503184|ref|ZP_05115335.1| co-chaperone GrpE [Labrenzia alexandrii DFL-11]
 gi|222439255|gb|EEE45934.1| co-chaperone GrpE [Labrenzia alexandrii DFL-11]
          Length = 211

 Score =  181 bits (460), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 119/155 (76%), Gaps = 3/155 (1%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           E  + ++ E +D+ LR +AEMENLRRRT++E KDA+ Y+++ FARDML+VSDNLSRAL++
Sbjct: 38  EALMAENAELKDRALRTMAEMENLRRRTEKEVKDARQYAVSGFARDMLTVSDNLSRALEA 97

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
            P D     K +++ + SLIEG+EM  R++++ LE+ GV K++ + QKF+PN HQAMFE 
Sbjct: 98  LPED---DRKNADAGVASLIEGVEMIERDLLNQLEKNGVSKLEPEGQKFDPNFHQAMFEV 154

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           P+  VP NT+++VVQ GY I ERVLRPA+V +SKG
Sbjct: 155 PNTEVPNNTVVQVVQAGYVIGERVLRPAMVGVSKG 189


>gi|254470696|ref|ZP_05084099.1| co-chaperone GrpE [Pseudovibrio sp. JE062]
 gi|211959838|gb|EEA95035.1| co-chaperone GrpE [Pseudovibrio sp. JE062]
          Length = 216

 Score =  181 bits (459), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 89/190 (46%), Positives = 136/190 (71%), Gaps = 8/190 (4%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINI---PEESLN-QSEEFRDKYLRVIAEMENLR 58
           T  +E+ ++ E     A S+   E++E  +   P E+L  ++   +D+ LR +AEMENLR
Sbjct: 9   TPQAEEQMNPEAVVEEAASANGAEQAEAAVEVDPIEALQAENAALKDRALRTMAEMENLR 68

Query: 59  RRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEM 118
           RRT++E KDA++Y++A FARDML V+DNL RA+++ P D     ++++  LK+L+EG+E+
Sbjct: 69  RRTEKEVKDAKAYAVASFARDMLVVNDNLGRAIEALPDDA----RENDDNLKALVEGVEL 124

Query: 119 TRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVL 178
             REM++ LE++GVK++  + +KFNP+ HQAMFE P+  VP NT+++VVQ GY I ERVL
Sbjct: 125 VEREMLNHLEKHGVKRLSPEGEKFNPHFHQAMFEVPNTEVPNNTVVQVVQAGYVIGERVL 184

Query: 179 RPALVSISKG 188
           RPA+V +SKG
Sbjct: 185 RPAMVGVSKG 194


>gi|39933408|ref|NP_945684.1| heat shock protein GrpE [Rhodopseudomonas palustris CGA009]
 gi|39647254|emb|CAE25775.1| possible heat shock protein (HSP-70 COFACTOR), grpE
           [Rhodopseudomonas palustris CGA009]
          Length = 208

 Score =  181 bits (459), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 93/207 (44%), Positives = 135/207 (65%), Gaps = 13/207 (6%)

Query: 4   FMSEKNIDKEKNPSNANSSTAEEKSEINI----PEESLNQS-----EEFRDKYLRVIAEM 54
            M+E +  K+ N   A ++     S+  I    PEE  N++      + RDK LR +AEM
Sbjct: 1   MMTETDGQKDNNQDTAQAAADPVVSKPYIMPDDPEEGSNEALVREAADARDKMLRTLAEM 60

Query: 55  ENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIE 114
           ENLR+RT +E  DA++Y +  FARD+L ++DNL RALD+ P   A++   +E  LK+LIE
Sbjct: 61  ENLRKRTQKEVADARTYGVTSFARDVLDIADNLQRALDAVP---ADARANAEPGLKALIE 117

Query: 115 GIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAIN 174
           G+E+T R +++ LE+ GVKK D K QKF+PN  QAM+E P  +VPA T+++VVQ G+ I 
Sbjct: 118 GVELTERSLLNALEKNGVKKFDPKGQKFDPNFQQAMYEVPDPSVPAGTVVQVVQAGFTIG 177

Query: 175 ERVLRPALVSISKGKTQ-NPTEEKKET 200
           +RVLRPALV ++KG  +  P++   ET
Sbjct: 178 DRVLRPALVGVAKGGAKAAPSDGGGET 204


>gi|52782879|sp|Q6NCY6|GRPE_RHOPA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
          Length = 207

 Score =  181 bits (458), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 135/206 (65%), Gaps = 13/206 (6%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINI----PEESLNQS-----EEFRDKYLRVIAEME 55
           M+E +  K+ N   A ++     S+  I    PEE  N++      + RDK LR +AEME
Sbjct: 1   MTETDGQKDNNQDTAQAAADPVVSKPYIMPDDPEEGSNEALVREAADARDKMLRTLAEME 60

Query: 56  NLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEG 115
           NLR+RT +E  DA++Y +  FARD+L ++DNL RALD+ P   A++   +E  LK+LIEG
Sbjct: 61  NLRKRTQKEVADARTYGVTSFARDVLDIADNLQRALDAVP---ADARANAEPGLKALIEG 117

Query: 116 IEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINE 175
           +E+T R +++ LE+ GVKK D K QKF+PN  QAM+E P  +VPA T+++VVQ G+ I +
Sbjct: 118 VELTERSLLNALEKNGVKKFDPKGQKFDPNFQQAMYEVPDPSVPAGTVVQVVQAGFTIGD 177

Query: 176 RVLRPALVSISKGKTQ-NPTEEKKET 200
           RVLRPALV ++KG  +  P++   ET
Sbjct: 178 RVLRPALVGVAKGGAKAAPSDGGGET 203


>gi|110636343|ref|YP_676551.1| GrpE protein [Mesorhizobium sp. BNC1]
 gi|123352919|sp|Q11B39|GRPE_MESSB RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|110287327|gb|ABG65386.1| GrpE protein [Chelativorans sp. BNC1]
          Length = 222

 Score =  181 bits (458), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 123/168 (73%), Gaps = 5/168 (2%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           ++E+ +++ LR+ AEMENLR+RT R+  DA+ Y IA FARDML+VSDNL RAL +   + 
Sbjct: 55  ENEDLKERALRLTAEMENLRKRTQRDVADARVYGIANFARDMLTVSDNLQRALQAVSEE- 113

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
             +  +++S LK+L+EG+EMT R M++TLER+GVK++D   +KF+P+ HQAMFE P+  V
Sbjct: 114 --ARAQADSGLKALVEGVEMTERAMLATLERHGVKRVDPNGEKFDPHFHQAMFEVPNADV 171

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISKG--KTQNPTEEKKETIEQP 204
           P NT+++VVQ GY I +RVLRPA+V ++KG  K + P    ++  + P
Sbjct: 172 PNNTVVQVVQPGYVIGDRVLRPAMVGVAKGGPKAETPAATSEQAAQGP 219


>gi|121602522|ref|YP_989582.1| co-chaperone GrpE [Bartonella bacilliformis KC583]
 gi|254799579|sp|A1UUC9|GRPE_BARBK RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|120614699|gb|ABM45300.1| co-chaperone GrpE [Bartonella bacilliformis KC583]
          Length = 222

 Score =  180 bits (457), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 90/159 (56%), Positives = 120/159 (75%), Gaps = 5/159 (3%)

Query: 38  NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD 97
           ++++E +D++LR+ A+MENLRRRT R+  DA+ YSIA FARDMLSVSDNL+RAL++ P D
Sbjct: 64  DENKELKDQFLRLAADMENLRRRTIRDVADAKIYSIANFARDMLSVSDNLNRALEAIPAD 123

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
                ++S++ LK L EG+EMT R MM+ LE +GVKKI  + QKF+PN HQAMFE  +  
Sbjct: 124 ----ARESDTNLKMLAEGVEMTERAMMAALEHHGVKKICPEGQKFDPNFHQAMFEISNSD 179

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISKGK-TQNPTE 195
           VP NT+ +VVQ GY I ERVLRPA+V ++KG   +N TE
Sbjct: 180 VPDNTVQQVVQAGYIIGERVLRPAMVGVAKGGPKENSTE 218


>gi|170740424|ref|YP_001769079.1| ribulose-phosphate 3-epimerase [Methylobacterium sp. 4-46]
 gi|168194698|gb|ACA16645.1| Ribulose-phosphate 3-epimerase [Methylobacterium sp. 4-46]
          Length = 207

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 113/147 (76%), Gaps = 3/147 (2%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           + +DK LR +A+MENLRRRT+RE  DA++Y++  FARDML+V+DN+ RALDS P   A +
Sbjct: 51  DLKDKLLRTLADMENLRRRTEREVADARTYAVTNFARDMLNVADNVRRALDSVP---AEA 107

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
              +E   K+L++GI++T R++  TLER+GV+ +D + Q+F+PN+HQAMFE P+  V + 
Sbjct: 108 RAAAEGPFKALLDGIDLTGRDLAKTLERHGVRPVDPQGQRFDPNLHQAMFEVPNPDVASG 167

Query: 162 TIIKVVQDGYAINERVLRPALVSISKG 188
           T+++VVQ GY I ERVLRPALV ++KG
Sbjct: 168 TVVQVVQTGYVIGERVLRPALVGVAKG 194


>gi|192288765|ref|YP_001989370.1| heat shock protein GrpE [Rhodopseudomonas palustris TIE-1]
 gi|226737163|sp|B3Q970|GRPE_RHOPT RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|192282514|gb|ACE98894.1| Ribulose-phosphate 3-epimerase [Rhodopseudomonas palustris TIE-1]
          Length = 207

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 134/206 (65%), Gaps = 13/206 (6%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINI----PEESLNQS-----EEFRDKYLRVIAEME 55
           M+E +  K+ N   A ++     S+  I    PEE  N++      + RDK LR +AEME
Sbjct: 1   MTETDGQKDNNQDTAQAAADPVVSKPYIMPDDPEEGSNEALVREAADARDKMLRTLAEME 60

Query: 56  NLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEG 115
           NLR+RT +E  DA++Y +  FARD+L ++DNL RALD+ P   A +   +E  LK+LIEG
Sbjct: 61  NLRKRTQKEVADARTYGVTSFARDVLDIADNLQRALDAVP---AEARANAEPGLKALIEG 117

Query: 116 IEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINE 175
           +E+T R +++ LE+ GVKK D K QKF+PN  QAM+E P  +VPA T+++VVQ G+ I +
Sbjct: 118 VELTERSLLNALEKNGVKKFDPKGQKFDPNFQQAMYEVPDPSVPAGTVVQVVQAGFTIGD 177

Query: 176 RVLRPALVSISKGKTQ-NPTEEKKET 200
           RVLRPALV ++KG  +  P++   ET
Sbjct: 178 RVLRPALVGVAKGGAKAAPSDGGSET 203


>gi|319407925|emb|CBI81579.1| heat shock protein GrpE [Bartonella schoenbuchensis R1]
          Length = 224

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 116/151 (76%), Gaps = 4/151 (2%)

Query: 38  NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD 97
           N+++E +++ LR  A+MENLRRRT R+  DA++Y+IA FARDMLSVSDNL+RAL++ P  
Sbjct: 62  NENKELKNQLLRFAADMENLRRRTTRDVADARAYAIANFARDMLSVSDNLNRALEAIP-- 119

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
                +++++ LK L EG+EMT R MM+ LER+GVKKI  + QKF+P+ HQAMFE P+  
Sbjct: 120 --EGARENDTGLKMLAEGVEMTERAMMTALERHGVKKIHPEGQKFDPHFHQAMFEIPNTD 177

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISKG 188
           VP NT+ +VVQ GY I ERVLRPA+V ++KG
Sbjct: 178 VPDNTVQQVVQAGYIIGERVLRPAMVGVAKG 208


>gi|307942844|ref|ZP_07658189.1| co-chaperone GrpE [Roseibium sp. TrichSKD4]
 gi|307773640|gb|EFO32856.1| co-chaperone GrpE [Roseibium sp. TrichSKD4]
          Length = 209

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 129/188 (68%), Gaps = 7/188 (3%)

Query: 5   MSEKNIDKEK----NPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           MS+ NI  E+    N +    + AE ++  N  E  + ++ E +DK LR +AEMENLRRR
Sbjct: 1   MSDDNIKTEEQMEANEAAHAPNEAEAEAGGNPVEALMAENAELKDKVLRTMAEMENLRRR 60

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+++  DA+ Y+++ FARDML+V DNL RALDS P +       + + L  LIEG+EMT 
Sbjct: 61  TEKQVSDAKQYAVSTFARDMLTVGDNLRRALDSLPEE---ERAGAAAGLVGLIEGVEMTE 117

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           RE+++ L + GVKK++ + QKF+PN HQAMFE P+  VP NT+++VVQ GY I ERVLRP
Sbjct: 118 RELLNQLCKNGVKKLEPEGQKFDPNFHQAMFEVPNPDVPNNTVVQVVQAGYVIGERVLRP 177

Query: 181 ALVSISKG 188
           A+V ++KG
Sbjct: 178 AMVGVAKG 185


>gi|90420648|ref|ZP_01228554.1| grpE chaperone protein [Aurantimonas manganoxydans SI85-9A1]
 gi|90334939|gb|EAS48700.1| grpE chaperone protein [Aurantimonas manganoxydans SI85-9A1]
          Length = 242

 Score =  179 bits (454), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 115/147 (78%), Gaps = 3/147 (2%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           + +D+ LR+ A+MENLRRRT+RE KDA++Y++  FAR++LSV+DNL RAL++ P   A +
Sbjct: 77  DVKDRLLRLAADMENLRRRTEREVKDARTYAVTGFAREILSVADNLRRALEAVP---AEA 133

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
           +   E  L  LI+G+E+T R ++STLE++GV+K+D + Q+F+PN HQAMFE P+  VP  
Sbjct: 134 KADGEGGLAGLIDGVEVTERSLISTLEKHGVRKLDPEGQRFDPNFHQAMFEIPNTEVPNG 193

Query: 162 TIIKVVQDGYAINERVLRPALVSISKG 188
           T+++VVQ GYAI ERVLRPA+V +SKG
Sbjct: 194 TVLQVVQAGYAIGERVLRPAMVGVSKG 220


>gi|220921154|ref|YP_002496455.1| GrpE protein [Methylobacterium nodulans ORS 2060]
 gi|254799599|sp|B8IJD7|GRPE_METNO RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|219945760|gb|ACL56152.1| GrpE protein [Methylobacterium nodulans ORS 2060]
          Length = 226

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 119/165 (72%), Gaps = 4/165 (2%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           + ++K LR +A+MENLRRRT+RE  DA++Y++  FARDML+V+DN+ RALDS P++    
Sbjct: 49  DLKNKLLRALADMENLRRRTEREVADARTYAVTNFARDMLNVADNVRRALDSVPVE---D 105

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
              ++  LK+L++GIE+T R++  TLER+GV+ ++ + Q+F+PN+HQAMFE P+  V   
Sbjct: 106 RAAADGALKALLDGIELTGRDLAKTLERHGVRAVEPQGQRFDPNLHQAMFEVPNPDVANG 165

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQPSP 206
           T+++VVQ GY I +RVLRPALV +SKG  +   E  K   E P P
Sbjct: 166 TVVQVVQTGYVIGDRVLRPALVGVSKGGPKA-AEASKPAGEAPKP 209


>gi|158425910|ref|YP_001527202.1| putative heat shock protein [Azorhizobium caulinodans ORS 571]
 gi|158332799|dbj|BAF90284.1| putative heat shock protein [Azorhizobium caulinodans ORS 571]
          Length = 210

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 80/151 (52%), Positives = 113/151 (74%), Gaps = 3/151 (1%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
           F+DKYLR  AE EN+RRR DRE  DA+ Y IA FARD+L+V+D+L+RAL  A +D A ++
Sbjct: 48  FKDKYLRAFAEAENIRRRADREIADAKVYGIASFARDVLNVADDLARAL--ATVD-AETK 104

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
             +E  LK LI+GIE+T R ++  LE++GV+K++   +KF+PN+HQAMFE P  +V A T
Sbjct: 105 ANAEGALKGLIDGIELTERGLLKNLEKHGVRKVEPVGEKFDPNLHQAMFEVPDPSVAAGT 164

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKTQNP 193
           +++VVQ GY I +RVLRPALV +++G  + P
Sbjct: 165 VVQVVQSGYVIGDRVLRPALVGVARGGPKAP 195


>gi|90421851|ref|YP_530221.1| GrpE protein [Rhodopseudomonas palustris BisB18]
 gi|90103865|gb|ABD85902.1| GrpE protein [Rhodopseudomonas palustris BisB18]
          Length = 205

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 83/163 (50%), Positives = 116/163 (71%), Gaps = 3/163 (1%)

Query: 29  EINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLS 88
           E+   E    ++ E RDK LR +AEMENLR+RT RE  DA++Y IA FARD+L ++DNL 
Sbjct: 34  EVGSTEALAKEAAESRDKMLRTLAEMENLRKRTAREVADARTYGIAGFARDVLDIADNLQ 93

Query: 89  RALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQ 148
           RALD+ P   A++   +E  LK+LIEG+E+T R M++ LE+ GVKK D   +KF+PN  Q
Sbjct: 94  RALDAVP---ADARATAEPGLKALIEGVELTERSMLNALEKNGVKKFDPIGEKFDPNFQQ 150

Query: 149 AMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQ 191
           AM+E P  +V A T+++VVQ G+ + +RVLRPALV++SKG  +
Sbjct: 151 AMYEVPDSSVAAGTVVQVVQAGFTLGDRVLRPALVAVSKGGAK 193


>gi|86747553|ref|YP_484049.1| GrpE protein [Rhodopseudomonas palustris HaA2]
 gi|123409016|sp|Q2J322|GRPE_RHOP2 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|86570581|gb|ABD05138.1| GrpE protein [Rhodopseudomonas palustris HaA2]
          Length = 206

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 88/196 (44%), Positives = 129/196 (65%), Gaps = 12/196 (6%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINI----PEESLNQS-----EEFRDKYLRVIAEME 55
           M++ N  K+ N   A ++     S+  I    PE+  N++      E RDK LR +AEME
Sbjct: 1   MTDSNGPKDNNQDQAQAAADPVVSKPYIMPDDPEDGANEALIKEAAEARDKMLRTLAEME 60

Query: 56  NLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEG 115
           NLRRRT +E  DA++Y ++ FARD+L ++DNL RALD+ P   A +   +++ LK LIEG
Sbjct: 61  NLRRRTQKEVADARTYGVSAFARDVLEIADNLQRALDAVP---AEARANADAGLKGLIEG 117

Query: 116 IEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINE 175
           +E+T R +++ LE+ GV+K D   +KF+PN  QAM+E P  +VPA T+++VVQ G+ I E
Sbjct: 118 VELTERSLINALEKNGVRKFDPSGEKFDPNFQQAMYEVPDPSVPAGTVVQVVQAGFMIGE 177

Query: 176 RVLRPALVSISKGKTQ 191
           RVLRPALV ++KG  +
Sbjct: 178 RVLRPALVGVAKGGAK 193


>gi|148251806|ref|YP_001236391.1| heat shock protein GrpE [Bradyrhizobium sp. BTAi1]
 gi|146403979|gb|ABQ32485.1| protein grpE (HSP-70 cofactor) [Bradyrhizobium sp. BTAi1]
          Length = 206

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 81/153 (52%), Positives = 111/153 (72%), Gaps = 3/153 (1%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           ++ + RDK LR +AEMENLR+RT RE  DA+ Y I  FARD+L ++DNL RALD+ P   
Sbjct: 43  EAADARDKMLRTLAEMENLRKRTAREVADARIYGITGFARDVLDIADNLQRALDAVP--- 99

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
           A +   ++  LK+LIEG+E+T R +++TLE+ GVKK D   QKF+PN  QAM+E P  +V
Sbjct: 100 AETRANADPGLKALIEGVELTERSLLNTLEKNGVKKFDPTGQKFDPNFQQAMYEVPDASV 159

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISKGKTQ 191
           P+ T+++VVQ G+ I ERVLRPALV +SKG  +
Sbjct: 160 PSGTVVQVVQAGFMIGERVLRPALVGVSKGGAK 192


>gi|91974873|ref|YP_567532.1| GrpE protein [Rhodopseudomonas palustris BisB5]
 gi|123763125|sp|Q13E58|GRPE_RHOPS RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|91681329|gb|ABE37631.1| GrpE protein [Rhodopseudomonas palustris BisB5]
          Length = 206

 Score =  174 bits (441), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 82/159 (51%), Positives = 114/159 (71%), Gaps = 8/159 (5%)

Query: 33  PEESLNQS-----EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNL 87
           PEE  N++      E RDK LR +AEMENLRRRT +E  DA++Y ++ FARD+L ++DNL
Sbjct: 32  PEEGTNEALVREAAEARDKMLRTLAEMENLRRRTAKEVADARTYGVSAFARDVLEIADNL 91

Query: 88  SRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMH 147
            RALD+ P   A +   +++ LK LIEG+E+T R +++ LE+ GVKK D + +KF+PN  
Sbjct: 92  QRALDAVP---AEARANADAGLKGLIEGVELTERSLINALEKNGVKKFDPQGEKFDPNFQ 148

Query: 148 QAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           QAM+E P  +VPA T+++VVQ G+ I ERVLRPALV +S
Sbjct: 149 QAMYEVPDPSVPAGTVVQVVQAGFMIGERVLRPALVGVS 187


>gi|217978934|ref|YP_002363081.1| GrpE protein [Methylocella silvestris BL2]
 gi|254799600|sp|B8ET77|GRPE_METSB RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|217504310|gb|ACK51719.1| GrpE protein [Methylocella silvestris BL2]
          Length = 187

 Score =  174 bits (440), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 123/183 (67%), Gaps = 6/183 (3%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
           +E   D+   P  A S   +E     + E    ++   +DK LR +A+MENLRRRT++E 
Sbjct: 7   AENGPDEADTPQGAPS---QEPDPFVVLENLQAENTSLKDKLLRTLADMENLRRRTEKEV 63

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
            DA++Y +  FARDML+ +DNL RAL + P   A +  K+E  +++LIEG+++T R+  S
Sbjct: 64  ADAKTYGVTSFARDMLTFADNLHRALANVP---AEARAKAEPAVQTLIEGLQLTERDFAS 120

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
            LER+GVKKID   QKF+PN+H+A+FE+P ++VP  T+ +V++ GY I ERVLRPA V +
Sbjct: 121 RLERFGVKKIDPAGQKFDPNLHEALFEQPDESVPNGTVTQVIEPGYVIGERVLRPAKVGV 180

Query: 186 SKG 188
           S+G
Sbjct: 181 SRG 183


>gi|146337339|ref|YP_001202387.1| heat shock protein GrpE [Bradyrhizobium sp. ORS278]
 gi|166215249|sp|A4YJR1|GRPE_BRASO RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|146190145|emb|CAL74137.1| Protein grpE (HSP-70 cofactor) [Bradyrhizobium sp. ORS278]
          Length = 206

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 80/143 (55%), Positives = 106/143 (74%), Gaps = 3/143 (2%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RDK LR +AEMENLR+RT RE  DA+ Y I  FARD+L ++DNL RALD+ P   A +  
Sbjct: 48  RDKMLRTLAEMENLRKRTAREVADARMYGITGFARDVLDIADNLQRALDAVP---AETRA 104

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
            +++ LKSLIEG+E+T R +++TLE+ GVKK D   QKF+PN  QAM+E P  +VP+ T+
Sbjct: 105 NADAGLKSLIEGVELTERSLLNTLEKNGVKKFDPTGQKFDPNFQQAMYEVPDPSVPSGTV 164

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
           ++VVQ G+ I ERVLRPALV +S
Sbjct: 165 VQVVQAGFMIGERVLRPALVGVS 187


>gi|218658828|ref|ZP_03514758.1| molecular chaperone heat shock protein [Rhizobium etli IE4771]
          Length = 150

 Score =  172 bits (435), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 114/149 (76%), Gaps = 6/149 (4%)

Query: 54  MENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS-APLDLANSEKKSESVLKSL 112
           M+NLRRRT+RE KDA+SYS+A FARDML+VSDNL RALD+ +P     ++  +++ L +L
Sbjct: 1   MDNLRRRTEREVKDAKSYSVAGFARDMLAVSDNLRRALDAISP----EAKATADAGLTTL 56

Query: 113 IEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYA 172
           IEG+EMT R M+S LER+GV+K++   QKF+PN HQAMFE P+  VP NT+++VVQ G+ 
Sbjct: 57  IEGVEMTERAMLSALERHGVRKLEPVGQKFDPNFHQAMFEVPNPEVPNNTVVQVVQAGFT 116

Query: 173 INERVLRPALVSISKGKTQNPTEEKKETI 201
           I ERVLRPA+V ++KG  + P E +  ++
Sbjct: 117 IGERVLRPAMVGVAKGGPK-PAEAETNSV 144


>gi|115522379|ref|YP_779290.1| GrpE protein [Rhodopseudomonas palustris BisA53]
 gi|122297941|sp|Q07US4|GRPE_RHOP5 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|115516326|gb|ABJ04310.1| GrpE protein [Rhodopseudomonas palustris BisA53]
          Length = 207

 Score =  170 bits (430), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 78/148 (52%), Positives = 107/148 (72%), Gaps = 3/148 (2%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           ++ E RDK LR +AEMENLR+RT RE  DA+ Y +  FARD+L ++DNL RALD+ P   
Sbjct: 43  EAAEARDKMLRTLAEMENLRKRTTREVADARIYGVTAFARDVLEIADNLQRALDAVP--- 99

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
           A +   +E  LK+LI+G+E+T R +++ LE+ GVKK D   QKF+PN  QAM+E P  +V
Sbjct: 100 AEARANAEPGLKALIDGVELTERSLINALEKNGVKKFDPSGQKFDPNFQQAMYEVPDASV 159

Query: 159 PANTIIKVVQDGYAINERVLRPALVSIS 186
           PA T+++VVQ G+ + ERVLRPALV +S
Sbjct: 160 PAGTVVQVVQAGFMLGERVLRPALVGVS 187


>gi|299133263|ref|ZP_07026458.1| GrpE protein [Afipia sp. 1NLS2]
 gi|298593400|gb|EFI53600.1| GrpE protein [Afipia sp. 1NLS2]
          Length = 199

 Score =  169 bits (428), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 79/156 (50%), Positives = 114/156 (73%), Gaps = 4/156 (2%)

Query: 33  PEESL-NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRAL 91
           P E+L  ++ E +DK LR +AEMENLR+RT RE  DA++Y IA FARD+L ++DNL RAL
Sbjct: 40  PSEALVKEAAEAKDKMLRTLAEMENLRKRTQREVADARAYGIAGFARDILEIADNLQRAL 99

Query: 92  DSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMF 151
           D+ P   A +   +++ L +LIEG+E+T R +  +LE+ GVKK D   +KF+PN+HQAM+
Sbjct: 100 DAVP---AEARATADAGLTALIEGVELTERSLHRSLEKNGVKKFDPMGEKFDPNVHQAMY 156

Query: 152 EEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           E P ++V   T+++V+Q GY I +R+LRPALV +SK
Sbjct: 157 EVPDNSVAPGTVVQVIQTGYMIGDRMLRPALVGVSK 192


>gi|209883569|ref|YP_002287426.1| co-chaperone GrpE [Oligotropha carboxidovorans OM5]
 gi|226737152|sp|B6JCI1|GRPE_OLICO RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|209871765|gb|ACI91561.1| co-chaperone GrpE [Oligotropha carboxidovorans OM5]
          Length = 200

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 81/156 (51%), Positives = 114/156 (73%), Gaps = 4/156 (2%)

Query: 33  PEESL-NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRAL 91
           P E+L  ++ E +D+ LR +AEMENLR+RT RE  DA++Y IA FARD+L ++DNL RAL
Sbjct: 41  PSEALVKEAAEAKDRMLRTLAEMENLRKRTQREVADARAYGIAGFARDVLEIADNLQRAL 100

Query: 92  DSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMF 151
           D+     A +   ++  L +LIEG+E+T R +   LE+ GVKK+DA  +KF+PN+HQAMF
Sbjct: 101 DAV---PAEARAAADPGLTALIEGVELTERSLHRALEKNGVKKLDAAGEKFDPNIHQAMF 157

Query: 152 EEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           E P ++VP  T+++V+Q GY I +RVLRPALV +SK
Sbjct: 158 EVPDNSVPPGTVVQVIQTGYMIGDRVLRPALVGVSK 193


>gi|154246474|ref|YP_001417432.1| ribulose-phosphate 3-epimerase [Xanthobacter autotrophicus Py2]
 gi|154160559|gb|ABS67775.1| Ribulose-phosphate 3-epimerase [Xanthobacter autotrophicus Py2]
          Length = 217

 Score =  167 bits (423), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 70/146 (47%), Positives = 111/146 (76%), Gaps = 3/146 (2%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            +DK+LR  AE EN+RRR ++E  DA++Y IA FARD+L+V+D+L+RAL +   +   ++
Sbjct: 58  LKDKFLRAFAEAENIRRRAEKEVVDAKTYGIASFARDVLNVADDLARALGTVDEE---AK 114

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
             ++  +K L+EG+E+T R ++  LE++G++KI+ K +KF+PN+HQAMFE P  +VP+ T
Sbjct: 115 ATADGAVKGLLEGLELTERGLVKALEKHGIRKIEPKGEKFDPNLHQAMFEVPDPSVPSGT 174

Query: 163 IIKVVQDGYAINERVLRPALVSISKG 188
           +++VVQ GY I ERVLRPA+V +++G
Sbjct: 175 VVQVVQSGYVIGERVLRPAMVGVARG 200


>gi|85714059|ref|ZP_01045048.1| GrpE protein [Nitrobacter sp. Nb-311A]
 gi|85699185|gb|EAQ37053.1| GrpE protein [Nitrobacter sp. Nb-311A]
          Length = 197

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 110/155 (70%), Gaps = 3/155 (1%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E +D+ LR +AEMENLRRRT RE  DA++Y I+ FARD+L ++DNL RALD+     A +
Sbjct: 46  EAKDRTLRTLAEMENLRRRTAREVSDARTYGISGFARDVLEIADNLQRALDAV---SAEA 102

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
              ++  LK+LIEG+E+T R + + LE++GVKK D   +KF+PN+HQAM+E P  ++P  
Sbjct: 103 RAAADPGLKALIEGVELTERSLHNALEKHGVKKFDPAGEKFDPNVHQAMYEVPDPSIPVG 162

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGKTQNPTEE 196
           T+ +V+Q GY I ERVLRPALV ++KG  +    E
Sbjct: 163 TVAQVIQAGYMIGERVLRPALVGVAKGGAKAAVPE 197


>gi|75674394|ref|YP_316815.1| GrpE protein [Nitrobacter winogradskyi Nb-255]
 gi|123732163|sp|Q3SW78|GRPE_NITWN RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|74419264|gb|ABA03463.1| GrpE protein [Nitrobacter winogradskyi Nb-255]
          Length = 197

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 77/149 (51%), Positives = 109/149 (73%), Gaps = 4/149 (2%)

Query: 35  ESLN-QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           ++LN Q  E +D+ LR +AEMENLR+RT RE  DA++Y I+ FARD+L ++DNL RALD+
Sbjct: 38  DALNKQLAEAKDRTLRTLAEMENLRKRTAREVSDARTYGISGFARDVLEIADNLQRALDA 97

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
            P   A++    +  LK+LIEG+E+T R + + LE++GVKK D   +KF+PN+HQAM+E 
Sbjct: 98  VP---ADARAAPDPGLKALIEGVELTERSLHNALEKHGVKKFDPAGEKFDPNVHQAMYEV 154

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPAL 182
           P  ++P  T+ +V+Q GY I ERVLRPAL
Sbjct: 155 PDPSIPVGTVAQVIQAGYMIGERVLRPAL 183


>gi|92115785|ref|YP_575514.1| GrpE protein [Nitrobacter hamburgensis X14]
 gi|91798679|gb|ABE61054.1| GrpE protein [Nitrobacter hamburgensis X14]
          Length = 203

 Score =  164 bits (415), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 104/141 (73%), Gaps = 3/141 (2%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E +D+ LR +AEMENLR+RT RE  DA++Y I+ FARD+L ++DNL RALD+ P +   +
Sbjct: 52  EAKDRMLRTLAEMENLRKRTAREVSDARTYGISGFARDVLDIADNLQRALDAVPTE---A 108

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
              ++  LK+LIEG+E+T R + + LE++GVKK D   +KF+PN+HQAM+E P  +VP  
Sbjct: 109 RAAADPGLKALIEGVELTERSLHNALEKHGVKKFDPAGEKFDPNVHQAMYEIPDPSVPVG 168

Query: 162 TIIKVVQDGYAINERVLRPAL 182
           TI +V+Q GY I ERVLRPAL
Sbjct: 169 TIAQVIQAGYTIGERVLRPAL 189


>gi|27375787|ref|NP_767316.1| heat shock protein GrpE [Bradyrhizobium japonicum USDA 110]
 gi|52782895|sp|Q79V15|GRPE_BRAJA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|6433783|emb|CAB60665.1| GrpE protein [Bradyrhizobium japonicum]
 gi|27348925|dbj|BAC45941.1| heat shock protein [Bradyrhizobium japonicum USDA 110]
          Length = 201

 Score =  163 bits (412), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 106/147 (72%), Gaps = 3/147 (2%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           ++ E RD+ LR +AEMENLR+RT +E  DA+ Y I  FARD+L ++DNL RALD+     
Sbjct: 41  EAAEARDRMLRTLAEMENLRKRTTKEVADARLYGITGFARDVLDIADNLQRALDAV---P 97

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
           A +   ++  L SLIEG+E+T R +++ LE++GVKK D + QKF+PN  QAMFE P  +V
Sbjct: 98  AEARAAADPGLTSLIEGVELTERSLLNALEKHGVKKFDPQGQKFDPNFQQAMFEVPDASV 157

Query: 159 PANTIIKVVQDGYAINERVLRPALVSI 185
           PA T+++V+Q GY I ERVLRPALV +
Sbjct: 158 PAGTVVQVMQAGYTIGERVLRPALVGV 184


>gi|304392744|ref|ZP_07374684.1| co-chaperone GrpE [Ahrensia sp. R2A130]
 gi|303295374|gb|EFL89734.1| co-chaperone GrpE [Ahrensia sp. R2A130]
          Length = 232

 Score =  162 bits (411), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 87/210 (41%), Positives = 132/210 (62%), Gaps = 20/210 (9%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLN-------QSEEFRDKYLRVIAEMENLRRRT 61
           N ++E NP+       E  ++ N PE+ L+       ++EE +D+ LR +AEM+NLR+RT
Sbjct: 34  NAEEEANPT----PRRERAADPNDPEQILSILDKLKAENEELKDRTLRTVAEMDNLRKRT 89

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
            RE  +A+SY++A FARD+L V DNL RA+ + P D  +S        K+LIEG+E+T R
Sbjct: 90  AREITEARSYAVANFARDLLGVGDNLQRAIQAVPDDKRDS---GSDEFKALIEGVELTER 146

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           E++  +    ++K D   +KF+PN HQAMFE P+  +P N++ +VVQ+GY I ERVLR A
Sbjct: 147 ELLKAMNNAKIEKFDPTGEKFDPNFHQAMFEIPNPELPNNSVAQVVQEGYRIGERVLRAA 206

Query: 182 LVSISKGKTQNPTEEKKETIEQPSPLDIEE 211
           +V ++KG        K E + QP P++ +E
Sbjct: 207 MVGVAKGGP------KFEDVVQPEPVETQE 230


>gi|296448432|ref|ZP_06890316.1| GrpE protein [Methylosinus trichosporium OB3b]
 gi|296254056|gb|EFH01199.1| GrpE protein [Methylosinus trichosporium OB3b]
          Length = 192

 Score =  162 bits (410), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 113/154 (73%), Gaps = 3/154 (1%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           ++   +DK LR +A+MEN+RRRT++E  DA+ Y +A FAR+ML+ +DNL RA++S P+  
Sbjct: 42  EAAGLKDKLLRTLADMENMRRRTEKEVADAKVYGVANFAREMLTFADNLRRAVESVPV-- 99

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
              E   +SV+ +LIEG+E+T R+ +S L R+GVK+I+AK Q+F+PN H+A+FE P ++V
Sbjct: 100 GARETLDQSVV-TLIEGMELTERDFLSRLGRFGVKRIEAKGQRFDPNQHEALFEIPDESV 158

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISKGKTQN 192
           P  T+ +VV+ GY I ERVLRPA V +++G  + 
Sbjct: 159 PNGTVAQVVEPGYLIGERVLRPAKVGVARGGPKG 192


>gi|298293786|ref|YP_003695725.1| GrpE protein [Starkeya novella DSM 506]
 gi|296930297|gb|ADH91106.1| GrpE protein [Starkeya novella DSM 506]
          Length = 206

 Score =  161 bits (407), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 71/146 (48%), Positives = 107/146 (73%), Gaps = 3/146 (2%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            +DK+LR  AE +N+RRR +RE  DA+ Y I  FARD+L+V+D+  RAL +     A + 
Sbjct: 50  LKDKFLRAFAEADNVRRRAEREVADAKVYGITGFARDILTVADDFERALGAVD---AEAR 106

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
           +K+E  LK++++GI++T R +  TL ++GV +I+A+  KF+PN+HQAMFE P+  +P+ T
Sbjct: 107 EKAEGPLKTVLDGIDITARALTQTLAKHGVARIEAEGAKFDPNLHQAMFEVPNTELPSGT 166

Query: 163 IIKVVQDGYAINERVLRPALVSISKG 188
           +++V+Q GY I ERVLRPALV +SKG
Sbjct: 167 VVQVIQPGYKIGERVLRPALVGVSKG 192


>gi|182677334|ref|YP_001831480.1| GrpE protein [Beijerinckia indica subsp. indica ATCC 9039]
 gi|254799581|sp|B2IDD9|GRPE_BEII9 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|182633217|gb|ACB93991.1| GrpE protein [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 201

 Score =  160 bits (406), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 107/146 (73%), Gaps = 3/146 (2%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            +DK LR  A+MENLRRR+++E  DA+ Y +  FARDML+ +DNL RA++S P   A ++
Sbjct: 55  LKDKVLRTYADMENLRRRSEKEVADAKLYGVTSFARDMLTFADNLHRAIESLP---AEAK 111

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
           +  +  LK+ +EGIE+T R+ +S L +YGVKKI+    KF+PN+H+A+FE P ++V + T
Sbjct: 112 QAVDGPLKTFVEGIELTERDFLSRLAKYGVKKIEPLGNKFDPNLHEALFEIPDESVVSGT 171

Query: 163 IIKVVQDGYAINERVLRPALVSISKG 188
           + +VV+DGY I ERVLRPA V +S+G
Sbjct: 172 VKQVVEDGYVIGERVLRPAKVGVSRG 197


>gi|222081543|ref|YP_002540907.1| molecular chaperone heat shock protein (hsp-70) [Agrobacterium
           radiobacter K84]
 gi|221726222|gb|ACM29311.1| molecular chaperone heat shock protein (hsp-70) [Agrobacterium
           radiobacter K84]
          Length = 240

 Score =  156 bits (395), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 106/151 (70%), Gaps = 4/151 (2%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           + +D+ LR +AE+EN+RRR DR+  D + Y++AKFA DML V+DN+ RA+ S P +    
Sbjct: 82  DLKDRLLRALAEVENVRRRADRDLNDTRQYAVAKFAGDMLRVADNMERAIASIPAEAL-- 139

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
             K E   K+LIEGIE+T +EM+ +LE++GVKK++   ++F+PN H+A+FE P  +VP  
Sbjct: 140 --KDEGAFKTLIEGIELTEKEMLRSLEKHGVKKLNPMGERFDPNFHEALFELPDPSVPNG 197

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGKTQN 192
           T+ +VV+ GY +  R LRPA V I++G  Q+
Sbjct: 198 TVTQVVEPGYVLGSRPLRPAKVGIARGGVQS 228


>gi|323137183|ref|ZP_08072262.1| GrpE protein [Methylocystis sp. ATCC 49242]
 gi|322397541|gb|EFY00064.1| GrpE protein [Methylocystis sp. ATCC 49242]
          Length = 198

 Score =  151 bits (382), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 80/182 (43%), Positives = 118/182 (64%), Gaps = 12/182 (6%)

Query: 16  PSNANSSTAEE---KSEINIPE-----ESL-NQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           P  A +S+  +   +S IN PE     E+L  ++   +DK LR +A+ EN+RRR ++E  
Sbjct: 16  PEQAGASSLSQPSAESNINEPEPFTELENLYAENAGLKDKLLRALADAENVRRRAEKEVS 75

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
           DA+ Y  A FAR+MLS  DNL RA++S P D        + V  SL+EG+E+  R+ +S 
Sbjct: 76  DAKLYGAANFAREMLSFVDNLRRAVESVPQD---KRGGLDPVAASLLEGVELMERDFLSR 132

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           L R+GVKKI+A+  +F+PN H+A+FE P ++ PA T+ +VV+ GY I ERVLRPA V ++
Sbjct: 133 LGRFGVKKIEAQGARFDPNQHEALFEIPDESQPAGTVAQVVEQGYMIGERVLRPAKVGVT 192

Query: 187 KG 188
           +G
Sbjct: 193 RG 194


>gi|163797071|ref|ZP_02191026.1| GrpE protein [alpha proteobacterium BAL199]
 gi|159177587|gb|EDP62140.1| GrpE protein [alpha proteobacterium BAL199]
          Length = 205

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 111/150 (74%), Gaps = 4/150 (2%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           QS ++RD+ LR +AE EN+RRRT+R+K+  + Y+ A FA+D+L+  DNL RALD+AP D 
Sbjct: 46  QSAQYRDQALRALAESENVRRRTERDKEQTRLYAAAGFAKDLLNAVDNLRRALDAAPKD- 104

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
              ++ ++  +K+LI G+E+T RE+++  E+ G+K+I+   ++F+PN+HQAMFE  +   
Sbjct: 105 ---QEATDEAVKNLIVGVELTERELLNAFEKNGIKRIEPLGERFDPNLHQAMFEVENSGK 161

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISKG 188
           PA T+++++  GY +++R+LR A+V ++KG
Sbjct: 162 PAGTVVQLLAPGYVLHDRLLRAAMVGVAKG 191


>gi|144897370|emb|CAM74234.1| GrpE protein [Magnetospirillum gryphiswaldense MSR-1]
          Length = 196

 Score =  144 bits (364), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 64/158 (40%), Positives = 108/158 (68%), Gaps = 4/158 (2%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            + + L   A+ EN+RRR +++ +D   ++++ FA+D+LSV+DNL RALD+ P     + 
Sbjct: 41  LKSEVLYARADTENVRRRLEQQAEDRGKFAVSNFAKDVLSVADNLRRALDAVP----PTA 96

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
           ++   +  +L  G+E+T REM++ LERYG+++I A  Q+F+PN+HQAM E    + P  T
Sbjct: 97  REGNDIANTLTVGVELTEREMLAALERYGIRQIQALGQRFDPNLHQAMMEMEDASQPEGT 156

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKET 200
           ++ V+Q GY ++ER+LRPALV+++KG  + P  E+ +T
Sbjct: 157 VVMVMQQGYQLHERLLRPALVAVAKGGPKTPPGEQVDT 194


>gi|295691342|ref|YP_003595035.1| GrpE protein [Caulobacter segnis ATCC 21756]
 gi|295433245|gb|ADG12417.1| GrpE protein [Caulobacter segnis ATCC 21756]
          Length = 207

 Score =  144 bits (363), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 104/153 (67%), Gaps = 7/153 (4%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            +++ LR  AE EN +RR +RE  DA++Y+I KFARD+L  +DNL+RA   +P D A+  
Sbjct: 32  LKEQALRYAAEAENTKRRAEREMNDARAYAIQKFARDLLGAADNLARATAHSPRDSAD-- 89

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKID-AKDQKFNPNMHQAMFEEPHDTVPAN 161
                V+K+ + G+EMT +E+++  ER G+KKID AK +KF+P++HQAM E+P D V A 
Sbjct: 90  ----PVVKNFVIGVEMTEKELLTAFERNGLKKIDPAKGEKFDPHLHQAMMEQPSDEVAAG 145

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGKTQNPT 194
            ++ V+Q GY +  R++RPA+V+++   +  P 
Sbjct: 146 GVVAVLQAGYELMGRLVRPAMVAVAAKGSTGPA 178


>gi|304320409|ref|YP_003854052.1| GrpE, heat shock protein [Parvularcula bermudensis HTCC2503]
 gi|303299311|gb|ADM08910.1| GrpE, heat shock protein [Parvularcula bermudensis HTCC2503]
          Length = 209

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 118/190 (62%), Gaps = 17/190 (8%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           + + ++++ +D     S A +  AE ++EI+  +E L          LRV AE+EN RRR
Sbjct: 31  IPSHLTDEALDGAHIKSLAEARIAEMQAEIDAQKEQL----------LRVAAELENTRRR 80

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD--LANSEKKSESVLKSLIEGIEM 118
            +RE++DA  Y I KFA D+LSV+DN SRAL+ AP D  LA+ ++     +  LI GI M
Sbjct: 81  AERERQDAAKYGITKFAGDLLSVADNFSRALELAPSDPSLASPDQ-----ISGLINGIRM 135

Query: 119 TRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVL 178
           T +E+++  ER G+ +ID K ++F+PN HQA+ + P +  P + ++ V   G+ I ERV+
Sbjct: 136 TEKELLTVFERNGISRIDPKGERFDPNQHQAIAQVPGNGEPKDHVVDVAAPGFIIGERVI 195

Query: 179 RPALVSISKG 188
           R A+V++S G
Sbjct: 196 RAAMVTVSTG 205


>gi|83945051|ref|ZP_00957417.1| hypothetical protein OA2633_10489 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851833|gb|EAP89688.1| hypothetical protein OA2633_10489 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 205

 Score =  142 bits (358), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 75/161 (46%), Positives = 105/161 (65%), Gaps = 10/161 (6%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            RD+ LR +AEMEN ++R +RE KD ++Y+++ FARDML V+DNLSRAL S      + E
Sbjct: 44  LRDQLLRALAEMENTKKRAEREVKDTRAYAVSGFARDMLDVADNLSRALSS-----ISDE 98

Query: 103 KKSES--VLKSLIEGIEMTRREMMSTLERYGVKKID-AKDQKFNPNMHQAMFEEPHDTVP 159
            K+++   L++L+EG+EMT R + STLER+GVKK++ A     +PN+HQA  + P D  P
Sbjct: 99  AKAQAGEALQTLLEGVEMTERRLHSTLERHGVKKVEPAPGDPLDPNLHQAAAQIPADQ-P 157

Query: 160 ANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKET 200
              I  V+Q GY I +R LR A+V +S G    P E   ET
Sbjct: 158 KGAIAHVMQPGYKIGDRTLRAAMVVVSAGPAA-PPESGGET 197


>gi|332188371|ref|ZP_08390096.1| grpE family protein [Sphingomonas sp. S17]
 gi|332011600|gb|EGI53680.1| grpE family protein [Sphingomonas sp. S17]
          Length = 181

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 70/150 (46%), Positives = 99/150 (66%), Gaps = 6/150 (4%)

Query: 38  NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD 97
           NQ  E + +YL   AE++N+RRR +++  DA++Y+   FARD+LSV+DNL RAL + P D
Sbjct: 35  NQLAEAKQQYLYAQAEIQNIRRRAEKDASDARNYAATSFARDVLSVADNLQRALATIPAD 94

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
           L   +K      K L+ G++ T REM S L R+G+ KI+A  Q  +PN HQAM E P D 
Sbjct: 95  LRTDDK-----WKGLVTGLDATGREMESVLGRHGITKIEAMGQTLDPNKHQAMIELPSDQ 149

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISK 187
            P  TI++ +Q GY I +R+LRPALV ++K
Sbjct: 150 EP-GTIVQEMQSGYMIKDRLLRPALVGVAK 178


>gi|56550912|ref|YP_161751.1| GrpE protein [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241762324|ref|ZP_04760404.1| GrpE protein [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|260753396|ref|YP_003226289.1| GrpE protein [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|81677266|sp|Q5NRL4|GRPE_ZYMMO RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|56542486|gb|AAV88640.1| GrpE protein [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241373118|gb|EER62757.1| GrpE protein [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|258552759|gb|ACV75705.1| GrpE protein [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 190

 Score =  141 bits (355), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 121/179 (67%), Gaps = 11/179 (6%)

Query: 12  KEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
           K +NP  A++    EKSE N  E+   ++E+ +   L   AE +N RRR ++EK +A +Y
Sbjct: 17  KSENPEEASA----EKSE-NGVEDLQAENEKLKKDLLYSKAEAQNTRRRLEKEKSEAIAY 71

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
           S+  FARDMLSV+DN+ RAL + P D+   EK     +K+L+ GIEMT +E+++ L+R+G
Sbjct: 72  SVTGFARDMLSVADNMERALAAIPDDIKQDEK-----IKNLVTGIEMTGKELLNILQRHG 126

Query: 132 VKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           +K++++  QK +PN+HQAM E   +  P  T+++ +Q GY I++R+LRPA+V ++K ++
Sbjct: 127 IKRVESVGQKLDPNLHQAMIEIESEK-PEGTVVQEMQAGYTIHDRLLRPAMVGVAKAQS 184


>gi|154254009|ref|YP_001414833.1| GrpE protein [Parvibaculum lavamentivorans DS-1]
 gi|254799605|sp|A7HZ43|GRPE_PARL1 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|154157959|gb|ABS65176.1| GrpE protein [Parvibaculum lavamentivorans DS-1]
          Length = 213

 Score =  140 bits (354), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 72/161 (44%), Positives = 108/161 (67%), Gaps = 4/161 (2%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           + R++ LR  A+MEN R+R +REK+DAQ Y+ A FARDML VSDNL RA+  A L     
Sbjct: 55  DLRNRLLRAAADMENNRKRAEREKQDAQRYAAANFARDMLEVSDNLRRAI--ATLKEDER 112

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPA 160
            + +ESV K++IEG+EMT R++++  ER+G+++I  +  ++F+PN+H+AMFE P    PA
Sbjct: 113 AEAAESV-KAMIEGVEMTDRQLVTIFERHGIREITPQPGERFDPNLHEAMFEVPGTDQPA 171

Query: 161 NTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETI 201
            T++ V+  GY I +R+LR A V ++K         K +TI
Sbjct: 172 GTVVHVLGAGYMIGDRLLRAARVGVAKADDGAAKGGKVDTI 212


>gi|117923823|ref|YP_864440.1| GrpE protein [Magnetococcus sp. MC-1]
 gi|117607579|gb|ABK43034.1| GrpE protein [Magnetococcus sp. MC-1]
          Length = 210

 Score =  139 bits (349), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 62/153 (40%), Positives = 109/153 (71%), Gaps = 6/153 (3%)

Query: 36  SLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAP 95
           +L+++EE +  YLR +A+M+NLR+R  RE + A+ +++  FARDMLSV+DNL RA+    
Sbjct: 63  ALDKAEEQQKNYLRSMADMDNLRKRNAREMEQARKFAVEGFARDMLSVADNLERAMSHM- 121

Query: 96  LDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPH 155
               + E  +E + K++++G++M   E+  +LE++G+K+I+A  Q F+PN+HQA+ +   
Sbjct: 122 ----DQESDNEQI-KAIVDGVKMVNSELAKSLEKHGIKRIEAMGQMFDPNLHQAVMQVAD 176

Query: 156 DTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           D VP +T+++ +Q GY +NER+LRP++V ++K 
Sbjct: 177 DRVPPDTVVQEMQAGYTLNERLLRPSMVGVAKA 209


>gi|148554174|ref|YP_001261756.1| GrpE protein [Sphingomonas wittichii RW1]
 gi|254799610|sp|A5V5Q2|GRPE_SPHWW RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|148499364|gb|ABQ67618.1| GrpE protein [Sphingomonas wittichii RW1]
          Length = 181

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 114/184 (61%), Gaps = 8/184 (4%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESL-NQSEEFRDKYLRVIAEMENLRRRTDR 63
           MSE+NI + +  +     +AE  +E+  P   L  + E+ R++ L   AE +N+RRR ++
Sbjct: 1   MSEENIGENEVETPETEPSAE--AEVESPFAKLEGELEKLRNEVLYAQAETQNVRRRLEK 58

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           EK DA +Y+   FARDMLSV+DNL RAL + P +L   ++     + SL+ GIEMT +E+
Sbjct: 59  EKADASAYAATGFARDMLSVADNLGRALAAIPAELREDDR-----IGSLLTGIEMTAKEL 113

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
            +  +R G+ KI+A   K +PN HQAM E P       T+I+ +Q GY I +R+LRPALV
Sbjct: 114 ENVFQRNGISKIEALGAKLDPNRHQAMVELPSADAEPGTVIQEMQAGYMIKDRLLRPALV 173

Query: 184 SISK 187
            ++K
Sbjct: 174 GVAK 177


>gi|83313595|ref|YP_423859.1| molecular chaperone GrpE [Magnetospirillum magneticum AMB-1]
 gi|123767878|sp|Q2VYM5|GRPE_MAGSA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|82948436|dbj|BAE53300.1| Molecular chaperone GrpE [Magnetospirillum magneticum AMB-1]
          Length = 203

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 65/146 (44%), Positives = 102/146 (69%), Gaps = 4/146 (2%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            ++  L   AE EN RRR +++ +D   Y+I+  A+D+LSV+DNL RALDS P   A++ 
Sbjct: 49  LKNDVLYAKAETENTRRRLEQQAEDRGRYAISNIAKDVLSVADNLRRALDSVP---ASAR 105

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
           + +ES L +L  G+EMT RE+++T ERYG+K + A+ ++F+PN+HQAM E    +    T
Sbjct: 106 EGNES-LTALTTGVEMTERELLATFERYGIKLVAAQGERFDPNLHQAMMEMEDPSQIEGT 164

Query: 163 IIKVVQDGYAINERVLRPALVSISKG 188
           ++ V+Q GY +++R+LRPALV ++KG
Sbjct: 165 VVLVMQAGYTLHDRLLRPALVGVAKG 190


>gi|288959666|ref|YP_003450007.1| molecular chaperone [Azospirillum sp. B510]
 gi|288911974|dbj|BAI73463.1| molecular chaperone [Azospirillum sp. B510]
          Length = 205

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 99/146 (67%), Gaps = 4/146 (2%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            +D+ LR +AE EN RRR  R+++DA  ++++ FA++++SV+DNL RALD+ P +     
Sbjct: 52  LKDQLLRAMAETENTRRRAQRDREDATKFAVSSFAKELVSVADNLRRALDAVPAE----G 107

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
           ++ + +LK L  G+E T R++ +  +R G+KK+D   + F+PN HQ MFE  +    A T
Sbjct: 108 RERDEMLKGLAVGVEATERQLFAAFDRAGIKKLDPAGEPFDPNFHQVMFEIENTGKAAGT 167

Query: 163 IIKVVQDGYAINERVLRPALVSISKG 188
           +++V+Q GY I+ R+LR A+V ++KG
Sbjct: 168 VVQVLQPGYTIHGRLLREAMVGVAKG 193


>gi|300024888|ref|YP_003757499.1| GrpE protein [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526709|gb|ADJ25178.1| GrpE protein [Hyphomicrobium denitrificans ATCC 51888]
          Length = 205

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 103/163 (63%), Gaps = 8/163 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D YLR +AE EN+RRR ++EK++   Y+I+KFA+D+L+V DN  RA+ + P D      
Sbjct: 49  QDAYLRAVAETENVRRRLEKEKEETAKYAISKFAKDILTVGDNFQRAIAAVPKDAL---- 104

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           + +  L +L++G+ +  R+    LER+G+   D   Q FNP+ HQA+ E+ +  VP+ T+
Sbjct: 105 EGDPALSALLDGVVLAERDYRGALERHGIVVDDPVGQPFNPHHHQAVMEQENPDVPSGTV 164

Query: 164 IKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQPSP 206
           ++V Q GY I +R LRPA+V +SKG  +      K+ + +P P
Sbjct: 165 LQVFQVGYLIEDRCLRPAMVVVSKGGPKV----AKQDVNEPPP 203


>gi|254418657|ref|ZP_05032381.1| co-chaperone GrpE [Brevundimonas sp. BAL3]
 gi|196184834|gb|EDX79810.1| co-chaperone GrpE [Brevundimonas sp. BAL3]
          Length = 211

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 102/147 (69%), Gaps = 8/147 (5%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           +E++D+ LRV AEMENL+RR + ++ DA++++I +FA+D+L V+DNL RAL +AP     
Sbjct: 45  DEWKDRALRVAAEMENLKRRAETQQNDARAFAIQRFAKDLLGVADNLERALMAAP----- 99

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVP 159
             K ++    +L+ G+EMT++ ++   E  G+K++  +  + FNP++HQAM E+P DTVP
Sbjct: 100 --KDTDGPTVALVTGLEMTQKALLQAFETNGLKRVAPEAGEAFNPHLHQAMIEQPSDTVP 157

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
              +++ +Q G+ +  R +RPA+V ++
Sbjct: 158 GGAVLQTMQSGFELFGRTIRPAMVVVA 184


>gi|167644137|ref|YP_001681800.1| heat shock protein GrpE [Caulobacter sp. K31]
 gi|254799586|sp|B0T367|GRPE_CAUSK RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|167346567|gb|ABZ69302.1| GrpE protein [Caulobacter sp. K31]
          Length = 205

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 100/150 (66%), Gaps = 8/150 (5%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            +D+ LR  AE EN +RR +RE  DA++Y+I KFARD+L  +DNLSRA   +P D     
Sbjct: 32  LKDQALRYAAEAENTKRRAERESNDARAYAIQKFARDLLGAADNLSRATAMSPRD----- 86

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKID-AKDQKFNPNMHQAMFEEPHDTVPAN 161
              +  + + I G+EMT +E+    ER G+KKID AK +KF+P++HQA+ E+P   V A 
Sbjct: 87  -SQDPAVTNYIIGVEMTEKELQGAFERNGLKKIDPAKGEKFDPHLHQAVMEQPSTEVAAG 145

Query: 162 TIIKVVQDGYAINERVLRPALVSI-SKGKT 190
            +++V+Q GY +  R++RPA+V++ +KG T
Sbjct: 146 GVLQVLQAGYELMGRLVRPAMVAVAAKGST 175


>gi|194757703|ref|XP_001961102.1| GF13703 [Drosophila ananassae]
 gi|190622400|gb|EDV37924.1| GF13703 [Drosophila ananassae]
          Length = 224

 Score =  135 bits (339), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 74/196 (37%), Positives = 116/196 (59%), Gaps = 17/196 (8%)

Query: 4   FMSEKNIDKEKNPSNANSSTAEEKSEINI--PE-ESLN--------QSEEFRDKYLRVIA 52
             S++    EK P  A   TAE+K+      PE E L         Q+ E  DKY R +A
Sbjct: 33  LASQRLYTTEKQPEEATGQTAEQKAPAGAASPEVEKLTKDLAAAKEQNAELLDKYKRALA 92

Query: 53  EMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESV-LKS 111
           + EN+R R +++  DA+ + I  F +D+L V+D L  A  + P      EK S +  LK+
Sbjct: 93  DSENMRNRLNKQISDAKIFGIQSFCKDLLEVADTLGHATQAVP-----KEKLSGNADLKN 147

Query: 112 LIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGY 171
           L EG+ MTR  ++   +R+G++ +D  +QKF+PN+H+A+F++   TV ANT+++V + GY
Sbjct: 148 LYEGLSMTRASLLQVFKRHGLEPLDPINQKFDPNLHEALFQKEDKTVEANTVVEVTKLGY 207

Query: 172 AINERVLRPALVSISK 187
            ++ER +RPALV +SK
Sbjct: 208 KLHERCIRPALVGVSK 223


>gi|125809037|ref|XP_001360966.1| GA19397 [Drosophila pseudoobscura pseudoobscura]
 gi|54636139|gb|EAL25542.1| GA19397 [Drosophila pseudoobscura pseudoobscura]
          Length = 227

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 99/150 (66%), Gaps = 6/150 (4%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           Q  E  DKY R +AE EN+R R +++  DA+ + I  F +D+L V+D L  A  + P D 
Sbjct: 82  QKSELMDKYKRALAESENMRTRLNKQISDAKIFGIQSFCKDLLEVADTLGHATQAVPKD- 140

Query: 99  ANSEKKSESV-LKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
               K S++  LKSL EG+ MTR  ++   +R+G++ +D  +QKF+PN+H+A+F++   T
Sbjct: 141 ----KLSDNADLKSLYEGLTMTRASLLQVFKRHGLEAVDPLNQKFDPNLHEALFQKEDKT 196

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISK 187
           V ANT+++V + GY ++ER +RPALV +SK
Sbjct: 197 VEANTVVEVTKLGYKLHERCIRPALVGVSK 226


>gi|195124878|ref|XP_002006910.1| GI18336 [Drosophila mojavensis]
 gi|193911978|gb|EDW10845.1| GI18336 [Drosophila mojavensis]
          Length = 216

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 98/149 (65%), Gaps = 4/149 (2%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           Q+ E  DKY R +A+ EN+R R +++  DA+ + I  F +D+L V+D L  A  + P + 
Sbjct: 72  QNNELLDKYKRALADSENMRTRLNKQISDAKIFGIQSFCKDLLEVADTLGHATQAVPKEK 131

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
            N      S LK+L EG+ MTR  ++   +R+G++ ID  ++KFNPNMH+A+F++   TV
Sbjct: 132 LNDN----SDLKNLFEGLSMTRASLLQVFKRHGLEPIDPINEKFNPNMHEALFQKEDSTV 187

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISK 187
            ANT+I+V + GY ++ER +RPALV +SK
Sbjct: 188 EANTVIEVTKLGYKLHERCIRPALVGVSK 216


>gi|84514909|ref|ZP_01002272.1| co-chaperone GrpE [Loktanella vestfoldensis SKA53]
 gi|84511068|gb|EAQ07522.1| co-chaperone GrpE [Loktanella vestfoldensis SKA53]
          Length = 184

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 102/147 (69%), Gaps = 8/147 (5%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           +EFRDK++R +A+ EN R+R DR++++A++Y  A+FARDML + DNL RAL SA      
Sbjct: 40  DEFRDKFMRALADAENTRKRADRDRREAENYGSARFARDMLPIYDNLRRALMSA------ 93

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVP 159
            ++  + + K+L+EG+E+T RE++S  +++G+  I  +   +F+P +HQAMFE P     
Sbjct: 94  -DEAEQDINKALLEGVELTMRELISVFKKHGIDPIVPQVGDRFDPQLHQAMFEAPLPGTK 152

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
           A  II+V  +G+ +++R+LRPA V +S
Sbjct: 153 AGDIIQVAAEGFMLHDRLLRPAQVGVS 179


>gi|221233092|ref|YP_002515528.1| heat shock protein GrpE [Caulobacter crescentus NA1000]
 gi|239977310|sp|B8GXP4|GRPE_CAUCN RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|239977311|sp|P0CAV1|GRPE_CAUCR RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|220962264|gb|ACL93620.1| GrpE protein [Caulobacter crescentus NA1000]
          Length = 208

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 66/151 (43%), Positives = 101/151 (66%), Gaps = 8/151 (5%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           + +++ LR  AE EN +RR +RE  DA++Y+I KFARD+L  +DNL RA   +P D    
Sbjct: 31  QLKEQALRYAAEAENTKRRAEREMNDARAYAIQKFARDLLGAADNLGRATAHSPKD---- 86

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID-AKDQKFNPNMHQAMFEEPHDTVPA 160
              ++  +K+ I G+EMT +E+ S  ER G+KKID AK  KF+P++HQA+ E+P   V A
Sbjct: 87  --STDPAVKNFIIGVEMTEKELQSAFERNGLKKIDPAKGDKFDPHLHQAVTEQPSTEVAA 144

Query: 161 NTIIKVVQDGYAINERVLRPALVSI-SKGKT 190
             ++ V+Q GY +  R++RPA+V++ +KG T
Sbjct: 145 GGVLMVMQAGYELMGRLVRPAMVAVAAKGST 175


>gi|16124409|ref|NP_418973.1| grpE protein [Caulobacter crescentus CB15]
 gi|992695|gb|AAB01516.1| GrpE [Caulobacter crescentus CB15]
 gi|13421267|gb|AAK22141.1| grpE protein [Caulobacter crescentus CB15]
          Length = 198

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 66/151 (43%), Positives = 101/151 (66%), Gaps = 8/151 (5%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           + +++ LR  AE EN +RR +RE  DA++Y+I KFARD+L  +DNL RA   +P D    
Sbjct: 21  QLKEQALRYAAEAENTKRRAEREMNDARAYAIQKFARDLLGAADNLGRATAHSPKD---- 76

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID-AKDQKFNPNMHQAMFEEPHDTVPA 160
              ++  +K+ I G+EMT +E+ S  ER G+KKID AK  KF+P++HQA+ E+P   V A
Sbjct: 77  --STDPAVKNFIIGVEMTEKELQSAFERNGLKKIDPAKGDKFDPHLHQAVTEQPSTEVAA 134

Query: 161 NTIIKVVQDGYAINERVLRPALVSI-SKGKT 190
             ++ V+Q GY +  R++RPA+V++ +KG T
Sbjct: 135 GGVLMVMQAGYELMGRLVRPAMVAVAAKGST 165


>gi|197106930|ref|YP_002132307.1| Heat-shock protein GrpE(HSP-70 cofactor) [Phenylobacterium zucineum
           HLK1]
 gi|196480350|gb|ACG79878.1| Heat-shock protein GrpE(HSP-70 cofactor) [Phenylobacterium zucineum
           HLK1]
          Length = 211

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 69/169 (40%), Positives = 104/169 (61%), Gaps = 22/169 (13%)

Query: 28  SEINIPEESLNQSEEF---------------RDKYLRVIAEMENLRRRTDREKKDAQSYS 72
           SE N P E  +++ +F               +D+ LR  AE EN +RR +RE  DA++Y+
Sbjct: 2   SEENTPPEGGDEAFDFGGEDVAALKAEIQALKDQVLRYAAEAENTKRRAEREANDARAYA 61

Query: 73  IAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGV 132
           I KFARD+L V+DNL RA+ +AP D A+      + +K+ + G+EMT +E++   ER G+
Sbjct: 62  IQKFARDLLGVADNLDRAMTAAPADHAD------TAVKNFVVGVEMTAKELLGAFERNGL 115

Query: 133 KKID-AKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           KKID  K +KF+P+ HQAM E+P   V    +I+V+Q GY +  R++RP
Sbjct: 116 KKIDPPKGEKFDPHKHQAMMEQPGSDVAPGGVIQVLQPGYELLGRLVRP 164


>gi|126734417|ref|ZP_01750164.1| GrpE protein HSP-70 cofactor, putative [Roseobacter sp. CCS2]
 gi|126717283|gb|EBA14147.1| GrpE protein HSP-70 cofactor, putative [Roseobacter sp. CCS2]
          Length = 185

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 63/147 (42%), Positives = 101/147 (68%), Gaps = 8/147 (5%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           +E+RDK++R +A+ ENLR+R+DR++++A+ Y  +K ARDML V DN+ RAL S       
Sbjct: 41  DEYRDKFMRALADTENLRKRSDRDRREAEDYGGSKLARDMLPVYDNMRRALQS------- 93

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVP 159
           S +  + V K+L+EG+E+T RE++S  +++G+  I  +   KF+P +HQAMFE P     
Sbjct: 94  SAEAEQDVNKALLEGVELTMRELISVFKKHGIDPITPEVGDKFDPKLHQAMFEAPLPDTK 153

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
           A  II+V  +G+ +++R+LRPA V +S
Sbjct: 154 AGDIIQVAAEGFMLHDRLLRPAQVGVS 180


>gi|195153945|ref|XP_002017884.1| GL17413 [Drosophila persimilis]
 gi|194113680|gb|EDW35723.1| GL17413 [Drosophila persimilis]
          Length = 227

 Score =  132 bits (333), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 61/149 (40%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           Q  E  DKY R +AE EN+R R +++  DA+ + I  F +D+L V+D L  A  + P D 
Sbjct: 82  QKSELMDKYKRALAESENMRTRLNKQISDAKIFGIQSFCKDLLEVADTLGHATQAVPKD- 140

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
              +    + LKSL EG+ MTR  ++   +R+G++ +D  +QKF+PN+H+A+F++   TV
Sbjct: 141 ---KLGDNADLKSLYEGLTMTRASLLQVFKRHGLEAVDPLNQKFDPNLHEALFQKEDKTV 197

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISK 187
            ANT+++V + GY ++ER +RPALV +SK
Sbjct: 198 EANTVVEVTKLGYKLHERCIRPALVGVSK 226


>gi|195058370|ref|XP_001995438.1| GH23157 [Drosophila grimshawi]
 gi|193899644|gb|EDV98510.1| GH23157 [Drosophila grimshawi]
          Length = 215

 Score =  132 bits (331), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 96/149 (64%), Gaps = 4/149 (2%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           Q+ E  DKY R +A+ EN+R R +++  DA+ + I  F +D+L V+D L  A  + P D 
Sbjct: 70  QNRELLDKYKRALADGENMRTRLNKQISDAKIFGIQSFCKDLLEVADTLGHATQAVPKDK 129

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
            N        LK+L EG+ MTR  ++   +R+G++ +D  + KF+PNMH+A+F++   TV
Sbjct: 130 LNGNAD----LKNLFEGLCMTRASLLQAFKRHGLEPVDPINTKFDPNMHEALFQKEDTTV 185

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISK 187
            ANT+++V + GY ++ER +RPALV +SK
Sbjct: 186 EANTVVEVTKLGYKLHERCIRPALVGVSK 214


>gi|218681508|ref|ZP_03529395.1| putative GrpE heat shock protein [Rhizobium etli CIAT 894]
          Length = 225

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 63/111 (56%), Positives = 86/111 (77%), Gaps = 5/111 (4%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS-APLDLAN 100
           + RD+YLR+ AEM+NLRRRT+RE KDA+SYS+A FARDML+VSDNL RALD+ +P     
Sbjct: 49  DLRDRYLRLAAEMDNLRRRTEREVKDAKSYSVAGFARDMLAVSDNLRRALDAISP----E 104

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMF 151
           ++  +++ L +LIEG+EMT R M+S LER+GV+K++   QKF+PN   AM 
Sbjct: 105 TKAAADAGLTTLIEGVEMTERAMLSALERHGVRKLEPVGQKFDPNFPSAML 155


>gi|23015825|ref|ZP_00055591.1| COG0576: Molecular chaperone GrpE (heat shock protein)
           [Magnetospirillum magnetotacticum MS-1]
          Length = 203

 Score =  131 bits (329), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 60/144 (41%), Positives = 95/144 (65%), Gaps = 4/144 (2%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            ++  L   AE EN RRR +++ +D   Y+I+  A+D+L V+DNL RALDS P     + 
Sbjct: 49  LKNDVLYAKAETENTRRRLEQQAEDRGKYAISNIAKDVLGVADNLRRALDSVP----QAA 104

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
           ++    L +L  G+EMT RE+++T ERYG+K ++A+  KF+PN+HQAM E    +    T
Sbjct: 105 REGNESLTALTTGVEMTERELLATFERYGIKMVEAQGAKFDPNLHQAMMEMEDPSQIEGT 164

Query: 163 IIKVVQDGYAINERVLRPALVSIS 186
           ++ V+Q GY +++R+LRPALV ++
Sbjct: 165 VVLVMQAGYTLHDRLLRPALVGVA 188


>gi|240012492|gb|ACS43717.1| hypothetical protein; RMQ06983 [Methylobacterium extorquens AM1]
          Length = 215

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 95/146 (65%), Gaps = 4/146 (2%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            +D+ LR +AE EN+RRR +R+  D + Y+I KFA D+L V+DNL RAL S P       
Sbjct: 68  LKDRLLRALAETENVRRRGERDLNDMRQYAIGKFAEDLLPVADNLQRALASLP----TEA 123

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
           +     ++ L++GI +T +E++  L+++G+K++    ++F+P++H+A+FE     VP   
Sbjct: 124 QLDGGAVRGLVDGIALTEKELLRVLQKHGIKRLSPLGERFDPHIHEALFEVSDPAVPDGV 183

Query: 163 IIKVVQDGYAINERVLRPALVSISKG 188
           + +VV+ GY+I  R LRPA V +++G
Sbjct: 184 VTQVVEPGYSIGARPLRPAKVGVARG 209


>gi|194883305|ref|XP_001975743.1| GG20391 [Drosophila erecta]
 gi|190658930|gb|EDV56143.1| GG20391 [Drosophila erecta]
          Length = 215

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 113/184 (61%), Gaps = 15/184 (8%)

Query: 13  EKNPSNANSSTAEEKSEINIPE-ESLN--------QSEEFRDKYLRVIAEMENLRRRTDR 63
           EK P    ++TAE+K+  + PE E L         Q+ E  DKY R +A+ EN+R R ++
Sbjct: 37  EKQPEE--TATAEQKATESSPEVEKLTKELAAAKEQNAELLDKYKRSLADSENMRNRLNK 94

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           +  DA+ + I  F +D+L V+D L  A  + P D    +    + LK+L EG+ MTR  +
Sbjct: 95  QISDAKIFGIQSFCKDLLEVADTLGHATQAVPKD----KLSGNADLKNLYEGLSMTRASL 150

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
           +   +R+G++ +D  +QKF+PN H+A+F++   TV ANT+++V + GY ++ER +RPALV
Sbjct: 151 LQVFKRHGLEPLDPINQKFDPNQHEALFQKEDKTVEANTVVEVTKLGYKLHERCIRPALV 210

Query: 184 SISK 187
            +SK
Sbjct: 211 GVSK 214


>gi|195431968|ref|XP_002063999.1| GK15968 [Drosophila willistoni]
 gi|194160084|gb|EDW74985.1| GK15968 [Drosophila willistoni]
          Length = 209

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 61/154 (39%), Positives = 101/154 (65%), Gaps = 6/154 (3%)

Query: 35  ESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSA 94
           E+  Q  E  DKY R +A+ EN+R R +++  DA+ + I  F +D+L V+D L  A  + 
Sbjct: 61  EAKEQHSELLDKYKRSLADSENMRTRLNKQIADAKIFGIQSFCKDLLEVADTLGHATQAV 120

Query: 95  PLDLANSEKKSESV-LKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
           P      EK +++  LK+L EG+ MT+  ++   +R+G++ +D  +QKFNPN+H+A+F++
Sbjct: 121 P-----KEKLADNPDLKNLFEGLSMTKASLLQVFKRHGLEPLDPINQKFNPNLHEALFQK 175

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
              TV ANT+++V + GY ++ER +RPALV +SK
Sbjct: 176 EDKTVDANTVVEVTKLGYTLHERCIRPALVGVSK 209


>gi|195400557|ref|XP_002058883.1| GJ19762 [Drosophila virilis]
 gi|194156234|gb|EDW71418.1| GJ19762 [Drosophila virilis]
          Length = 202

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 59/149 (39%), Positives = 97/149 (65%), Gaps = 4/149 (2%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           Q+ E  DKY R +A+ EN+R R +++  DA+ + I  F +D+L V+D L  A  + P + 
Sbjct: 57  QNSELLDKYKRALADSENMRTRLNKQINDAKIFGIQSFCKDLLEVADTLGHATQAVPKEK 116

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
            N        LK+L EG+ MTR  ++   +R+G++ +D  +QKF+PN+H+A+F++   TV
Sbjct: 117 LNGNAD----LKNLYEGLTMTRAALLQVFKRHGLEPLDPINQKFDPNLHEALFQKDDATV 172

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISK 187
            ANT+++V + GY ++ER +RPALV +SK
Sbjct: 173 EANTVVEVTKLGYKLHERCIRPALVGVSK 201


>gi|330830464|ref|YP_004393416.1| protein grpE [Aeromonas veronii B565]
 gi|328805600|gb|AEB50799.1| Protein grpE [Aeromonas veronii B565]
          Length = 191

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 66/155 (42%), Positives = 102/155 (65%), Gaps = 8/155 (5%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           E ++ ++ E R++ LR  AEMENLRRRT+ + + A  +++ KFA ++L V DNL RA++ 
Sbjct: 43  ETAIQKAAEERERALRTAAEMENLRRRTELDVEKAHKFALEKFANELLPVLDNLERAIE- 101

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
               LA+ E ++   LK +IEG+E+T + M S + ++G+  +D  +Q F+PN HQAM   
Sbjct: 102 ----LADKENEA---LKPMIEGVELTLKSMQSGVAKFGLVALDPINQPFDPNAHQAMSMV 154

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           P   V  NT+I V+Q GY +N RV+RPA+V I+K 
Sbjct: 155 PSADVAPNTVIAVMQKGYDLNGRVIRPAMVMIAKA 189


>gi|312116139|ref|YP_004013735.1| GrpE protein [Rhodomicrobium vannielii ATCC 17100]
 gi|311221268|gb|ADP72636.1| GrpE protein [Rhodomicrobium vannielii ATCC 17100]
          Length = 288

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 103/154 (66%), Gaps = 4/154 (2%)

Query: 35  ESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSA 94
           +S  ++ E RD++LR+ AEMEN RRR++REK +   Y+ ++F +D + ++DNL RA+++A
Sbjct: 42  DSRAENAELRDRHLRIAAEMENYRRRSEREKIETAKYASSEFGKDAIVIADNLRRAIEAA 101

Query: 95  PLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEP 154
             +  +        L +L++G+E+T RE++   ER+G+ + +   +KF+P+  +AM +  
Sbjct: 102 QKEATDQT----PALNTLLQGVEVTERELLKVFERHGITRFEPLGEKFDPHTSEAMIKVD 157

Query: 155 HDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
              VPA+ +++V+Q GY I ERVLRPA V ++KG
Sbjct: 158 VPNVPADVVVQVLQAGYKIGERVLRPAAVIVAKG 191


>gi|296114320|ref|ZP_06832974.1| chaperone binding protein [Gluconacetobacter hansenii ATCC 23769]
 gi|295979081|gb|EFG85805.1| chaperone binding protein [Gluconacetobacter hansenii ATCC 23769]
          Length = 209

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 63/147 (42%), Positives = 98/147 (66%), Gaps = 4/147 (2%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            R+K++R  AEM+NLR RT RE +DA+ Y+  KFARD++  ++NL RAL S P   A +E
Sbjct: 66  MREKWVRAEAEMQNLRTRTKREIEDARQYATQKFARDVVEAAENLKRALASLP---APTE 122

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
            + + ++KS+ EGIE T R  +  LER G+  +DA+ + F+ N HQAM E+  D  PA T
Sbjct: 123 DE-DGIIKSMREGIESTERSFIGILERNGIVAVDAQGKPFDANQHQAMAEQHSDEHPAGT 181

Query: 163 IIKVVQDGYAINERVLRPALVSISKGK 189
           +++     + ++ R+L+PA+V +SKG+
Sbjct: 182 VMQAWTPAWTLHGRLLKPAMVVVSKGQ 208


>gi|195583100|ref|XP_002081362.1| GD10974 [Drosophila simulans]
 gi|194193371|gb|EDX06947.1| GD10974 [Drosophila simulans]
          Length = 213

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 67/174 (38%), Positives = 108/174 (62%), Gaps = 13/174 (7%)

Query: 23  TAEEKSEINIPE-ESLN--------QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
           TAE+K+  + PE E L         Q+ E  DKY R +A+ EN+R R +++  DA+ + I
Sbjct: 43  TAEQKATESSPEVEKLTKELAAAKEQNAELLDKYKRSLADSENMRNRLNKQISDAKIFGI 102

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
             F +D+L V+D L  A  + P D    +    + LK+L EG+ MTR  ++   +R+G++
Sbjct: 103 QSFCKDLLEVADTLGHATQAVPKD----KLSGNADLKNLYEGLTMTRASLLQVFKRHGLE 158

Query: 134 KIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            +D  +QKF+PN H+A+F++   TV ANT+++V + GY ++ER +RPALV +SK
Sbjct: 159 PLDPINQKFDPNQHEALFQKEDKTVEANTVVEVTKLGYKLHERCIRPALVGVSK 212


>gi|195484937|ref|XP_002090884.1| GE12552 [Drosophila yakuba]
 gi|194176985|gb|EDW90596.1| GE12552 [Drosophila yakuba]
          Length = 215

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 72/185 (38%), Positives = 112/185 (60%), Gaps = 17/185 (9%)

Query: 13  EKNPSNANSSTAEEKSEINIPE-ESLN--------QSEEFRDKYLRVIAEMENLRRRTDR 63
           EK P  A  +T E+K+    PE E L         Q+ E  DKY R +A+ EN+R R ++
Sbjct: 37  EKQPEEA--ATTEQKASEASPEVEKLTKELAAAKEQNAELLDKYKRSLADSENMRNRLNK 94

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESV-LKSLIEGIEMTRRE 122
           +  DA+ + I  F +D+L V+D L  A  + P      EK S +  LK+L EG+ MTR  
Sbjct: 95  QISDAKIFGIQSFCKDLLEVADTLGHATQAVP-----KEKLSGNADLKNLYEGLSMTRAS 149

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           ++   +R+G++ +D  +QKF+PN H+A+F++   TV ANT+++V + GY ++ER +RPAL
Sbjct: 150 LLQVFKRHGLEPLDPINQKFDPNQHEALFQKEDKTVEANTVVEVTKLGYKLHERCIRPAL 209

Query: 183 VSISK 187
           V +SK
Sbjct: 210 VGVSK 214


>gi|220934147|ref|YP_002513046.1| GrpE protein [Thioalkalivibrio sp. HL-EbGR7]
 gi|254799621|sp|B8GNX0|GRPE_THISH RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|219995457|gb|ACL72059.1| GrpE protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 187

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 105/155 (67%), Gaps = 9/155 (5%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           EE+  Q++E  DK LR  AEMENLR+RT R+ ++A+ +++ KFA ++L+V D+L   LD+
Sbjct: 38  EEAQAQAQEHFDKALRTQAEMENLRKRTARDVENARKFALEKFAGELLAVRDSLEMGLDA 97

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
           A         + E+ ++ + EG E+T + +   +E++GV+ +D + Q+F+P+ HQAM  +
Sbjct: 98  A---------RGETDVEKIREGTELTLKMLAQVMEKFGVEAVDPQGQRFDPDRHQAMSMQ 148

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           P+  +  NT++ V+Q GY +N+R+LRPA+V +SK 
Sbjct: 149 PNAELEPNTVMAVLQKGYLLNDRLLRPAMVVVSKA 183


>gi|89067433|ref|ZP_01154946.1| co-chaperone GrpE [Oceanicola granulosus HTCC2516]
 gi|89047002|gb|EAR53056.1| co-chaperone GrpE [Oceanicola granulosus HTCC2516]
          Length = 206

 Score =  128 bits (321), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 60/147 (40%), Positives = 105/147 (71%), Gaps = 8/147 (5%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           ++ +D+++R +A+ EN R+R +R++++A++Y  +K ARDML V DNLSRAL++A      
Sbjct: 62  DDLKDRFVRALADAENTRKRAERDRREAETYGGSKLARDMLPVYDNLSRALETA------ 115

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVP 159
           +E++ E + K+L+EG+E+T RE+++  +++G++ I  +   KF+P MHQAMFE P     
Sbjct: 116 TEEQKE-ISKALLEGVELTMRELLNVFKKHGIEPISPEVGDKFDPQMHQAMFEAPVPDTK 174

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
           A  II+V+  G+ +++R+LRPA V +S
Sbjct: 175 AGDIIQVMATGFLLHDRLLRPAQVGVS 201


>gi|114571543|ref|YP_758223.1| GrpE protein [Maricaulis maris MCS10]
 gi|114342005|gb|ABI67285.1| GrpE protein [Maricaulis maris MCS10]
          Length = 210

 Score =  127 bits (320), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 67/147 (45%), Positives = 100/147 (68%), Gaps = 5/147 (3%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           +  RDK LR +AE EN RRR +R+  DA+SY+++ FA+DML VSDNLSRA+ S  +D A 
Sbjct: 46  DSMRDKLLRALAEAENTRRRAERDVADARSYAVSSFAKDMLDVSDNLSRAVGS--VDEAA 103

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVP 159
                ++V K+++EG+ MT + ++S +ER+GVKK+D +    F+P+ HQA+ + P D   
Sbjct: 104 LADVPDAV-KNVVEGVAMTEKALISKMERHGVKKVDPQPGDTFDPHKHQAVAQIPSDQ-G 161

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
           A  I  V+Q G+ I ER LR A+V++S
Sbjct: 162 AGKIAAVMQTGFVIGERTLRAAMVAVS 188


>gi|56460095|ref|YP_155376.1| molecular chaperone GrpE (heat shock protein) [Idiomarina
           loihiensis L2TR]
 gi|56179105|gb|AAV81827.1| Molecular chaperone GrpE (heat shock protein) [Idiomarina
           loihiensis L2TR]
          Length = 221

 Score =  127 bits (320), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 96/144 (66%), Gaps = 8/144 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LR  AEMEN+RRR  ++ + A  +++ KFA ++L+  DNL RAL      LA+ E 
Sbjct: 76  RDSVLRTQAEMENVRRRASQDVEKAHKFALEKFANEILTSVDNLERALQ-----LADKED 130

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           ++    K+ +EGIE+T + + STLE++GVK I A+ + FNP+ HQAM  +  D  P NTI
Sbjct: 131 EAN---KNFVEGIELTYKNLTSTLEKFGVKAIGAEGEAFNPDQHQAMSMQESDEHPNNTI 187

Query: 164 IKVVQDGYAINERVLRPALVSISK 187
           + V+Q GY +N R+LRPA+V +++
Sbjct: 188 MAVMQKGYELNGRLLRPAMVMVAR 211


>gi|20151765|gb|AAM11242.1| RE56495p [Drosophila melanogaster]
          Length = 213

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 59/149 (39%), Positives = 96/149 (64%), Gaps = 4/149 (2%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           Q+ E  DKY R +A+ EN+R R +++  DA+ + I  F +D+L V+D L  A  + P D 
Sbjct: 68  QNAELMDKYKRSLADSENMRNRLNKQISDAKIFGIQSFCKDLLEVADTLGHATQAVPKD- 126

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
              +    + LK+L EG+ MTR  ++   +R+G+K +D  +QKF+PN H+A+F++   TV
Sbjct: 127 ---KLSGNADLKNLYEGLTMTRASLLQVFKRHGLKPLDPINQKFDPNQHEALFQKEDKTV 183

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISK 187
             NT+++V + GY ++ER +RPALV +SK
Sbjct: 184 EPNTVVEVTKLGYKLHERCIRPALVGVSK 212


>gi|126173594|ref|YP_001049743.1| heat shock protein GrpE [Shewanella baltica OS155]
 gi|152999874|ref|YP_001365555.1| heat shock protein GrpE [Shewanella baltica OS185]
 gi|160874497|ref|YP_001553813.1| heat shock protein GrpE [Shewanella baltica OS195]
 gi|217974163|ref|YP_002358914.1| heat shock protein GrpE [Shewanella baltica OS223]
 gi|304409465|ref|ZP_07391085.1| GrpE protein [Shewanella baltica OS183]
 gi|307303823|ref|ZP_07583576.1| GrpE protein [Shewanella baltica BA175]
 gi|226737174|sp|A3D2B1|GRPE_SHEB5 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737175|sp|A6WL03|GRPE_SHEB8 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737176|sp|A9KTL2|GRPE_SHEB9 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|254799609|sp|B8EAU9|GRPE_SHEB2 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|125996799|gb|ABN60874.1| GrpE protein [Shewanella baltica OS155]
 gi|151364492|gb|ABS07492.1| GrpE protein [Shewanella baltica OS185]
 gi|160860019|gb|ABX48553.1| GrpE protein [Shewanella baltica OS195]
 gi|217499298|gb|ACK47491.1| GrpE protein [Shewanella baltica OS223]
 gi|304351983|gb|EFM16381.1| GrpE protein [Shewanella baltica OS183]
 gi|306912721|gb|EFN43144.1| GrpE protein [Shewanella baltica BA175]
 gi|315266736|gb|ADT93589.1| GrpE protein [Shewanella baltica OS678]
          Length = 206

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 102/155 (65%), Gaps = 10/155 (6%)

Query: 35  ESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRAL-DS 93
           E+L + EE +D  +R  AE++N+RRR   + + A  +++ KFA ++L V DN+ RAL  +
Sbjct: 48  EALAKVEEQKDSVIRAAAEVDNIRRRAAMDVEKANKFALEKFANELLPVLDNMERALMGT 107

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
            P D A          KS+ +G+E+T++ +++ + ++GVK+ID + Q FNP+ HQA+  +
Sbjct: 108 NPEDEAT---------KSIYQGVELTQKSLLTAVAKFGVKQIDPQGQSFNPDQHQAIGMQ 158

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           P    PANT++ V+Q GY +N R+LRPA+V +S+G
Sbjct: 159 PSAEFPANTVMLVMQKGYELNSRLLRPAMVMVSQG 193


>gi|103485747|ref|YP_615308.1| GrpE protein [Sphingopyxis alaskensis RB2256]
 gi|98975824|gb|ABF51975.1| GrpE protein [Sphingopyxis alaskensis RB2256]
          Length = 181

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 93/136 (68%), Gaps = 6/136 (4%)

Query: 52  AEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKS 111
           AE +N+RRR ++E  DA +Y+  +FARD+LSV+DNL RAL +      + E++++  +K 
Sbjct: 49  AETQNVRRRAEKEVADAHAYAATRFARDILSVADNLGRALAAL-----SDEQRADEAIKP 103

Query: 112 LIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGY 171
           L+ G+E T RE+M+  ER+G+ +I A     +PN HQAM E P D  P  TI++ +Q GY
Sbjct: 104 LVTGLEATERELMAVFERHGITRIAAIGLPLDPNQHQAMLEIPSDKEP-GTIVQEMQAGY 162

Query: 172 AINERVLRPALVSISK 187
            + +R+LRPA+V+++K
Sbjct: 163 MMKDRLLRPAMVAVAK 178


>gi|114769784|ref|ZP_01447394.1| putative chaperone protein GrpE (heat shock protein) [alpha
           proteobacterium HTCC2255]
 gi|114549489|gb|EAU52371.1| putative chaperone protein GrpE (heat shock protein) [alpha
           proteobacterium HTCC2255]
          Length = 198

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 108/165 (65%), Gaps = 8/165 (4%)

Query: 25  EEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVS 84
           EE  EIN  +E   ++ E  D+ +R +AE EN R+R +R+++DA+ Y   K ARD+LSV 
Sbjct: 40  EESDEINEVDELRAENAELNDRLMRALAEAENQRKRGERDRRDAEVYGGRKLARDLLSVY 99

Query: 85  DNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFN 143
           DN+ RA      ++A  E++  +  KSL EGI++T+RE+++T  ++ +  I  +   KF+
Sbjct: 100 DNMKRA-----SEMATDEQREAN--KSLFEGIDLTQRELINTFAKHNIVPIAPEVGDKFD 152

Query: 144 PNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           P +HQAMFE P  TV A  I++V+ +G+ I++R+LRPA V +S G
Sbjct: 153 PELHQAMFEAPMPTVKAGHILQVLDEGFMISDRLLRPANVGVSSG 197


>gi|195334115|ref|XP_002033730.1| GM21478 [Drosophila sechellia]
 gi|194125700|gb|EDW47743.1| GM21478 [Drosophila sechellia]
          Length = 213

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 66/174 (37%), Positives = 108/174 (62%), Gaps = 13/174 (7%)

Query: 23  TAEEKSEINIPE-ESLN--------QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
           TAE+K+  + PE E L         Q+ E  DKY R +A+ EN+R R +++  DA+ + I
Sbjct: 43  TAEQKATESSPEVEKLTKELAAAKEQNAELLDKYKRSLADSENMRNRLNKQISDAKIFGI 102

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
             F +D+L V+D L  A  + P D    +    + LK+L +G+ MTR  ++   +R+G++
Sbjct: 103 QSFCKDLLEVADTLGHATQAVPKD----KLSGNADLKNLYDGLTMTRASLLQVFKRHGLE 158

Query: 134 KIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            +D  +QKF+PN H+A+F++   TV ANT+++V + GY ++ER +RPALV +SK
Sbjct: 159 PLDPINQKFDPNQHEALFQKEDKTVEANTVVEVTKLGYKLHERCIRPALVGVSK 212


>gi|161170280|gb|ABX59250.1| molecular chaperone GrpE [uncultured marine bacterium EB000_55B11]
 gi|297183808|gb|ADI19931.1| hypothetical protein [uncultured marine bacterium EB000_55B11]
          Length = 198

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 108/165 (65%), Gaps = 8/165 (4%)

Query: 25  EEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVS 84
           EE  EIN  +E   ++ E  D+ +R +AE EN R+R +R+++DA+ Y   K ARD+LSV 
Sbjct: 40  EESDEINEVDELRAENAELNDRLMRALAEAENQRKRGERDRRDAEVYGGRKLARDLLSVY 99

Query: 85  DNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFN 143
           DN+ RA      ++A  E++  +  KSL EGI++T+RE+++T  ++ +  I  +   KF+
Sbjct: 100 DNMKRA-----SEMATDEQREAN--KSLFEGIDLTQRELINTFAKHNIVPIAPEVGDKFD 152

Query: 144 PNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           P +HQAMFE P  TV A  I++V+ +G+ I++R+LRPA V +S G
Sbjct: 153 PELHQAMFEAPMPTVKAGHILQVLDEGFMISDRLLRPANVGVSSG 197


>gi|296284096|ref|ZP_06862094.1| molecular chaperone GrpE [Citromicrobium bathyomarinum JL354]
          Length = 207

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 64/147 (43%), Positives = 94/147 (63%), Gaps = 5/147 (3%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           E  R + L   AE +N+RRR +++  D ++YS   FARD+LSVSDNLSRA+DS P +L  
Sbjct: 63  ETARQEVLYARAETQNVRRRMEKDIADTRAYSATGFARDILSVSDNLSRAIDSIPEEL-- 120

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
              + +   K LI GIE T+RE+     ++GV ++ A     +PN+HQAM E P+D    
Sbjct: 121 ---REDGKFKGLIAGIEATQRELDRVFGQHGVTRVAAMGLPLDPNVHQAMMEIPNDEAEP 177

Query: 161 NTIIKVVQDGYAINERVLRPALVSISK 187
            T+++ +Q GY I +R+LRPALV ++K
Sbjct: 178 GTVVQEMQAGYLIRDRLLRPALVGVAK 204


>gi|159046005|ref|YP_001534799.1| protein GrpE [Dinoroseobacter shibae DFL 12]
 gi|157913765|gb|ABV95198.1| protein GrpE [Dinoroseobacter shibae DFL 12]
          Length = 197

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 98/154 (63%), Gaps = 8/154 (5%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           E  + + +E +D+ +R +AE EN+R+R +R++++A+ +  +K ARDML V DNL RALD 
Sbjct: 46  EAIIAERDELKDRLIRALAEAENIRKRGERDRREAEQFGGSKLARDMLPVFDNLRRALDV 105

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFE 152
                   +     +   LIEG+E+T RE+++   ++G+  I  +    F+P +HQAMFE
Sbjct: 106 V-------DDNQREIAGGLIEGVELTLREILNVFGKHGITPIAPEVGDPFDPQLHQAMFE 158

Query: 153 EPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
            P   VPA  II+V+ +G+ +++R+LRPA V +S
Sbjct: 159 APVPNVPAGGIIQVMSEGFLLHDRLLRPAHVGVS 192


>gi|226498360|ref|NP_001140622.1| hypothetical protein LOC100272696 [Zea mays]
 gi|194700212|gb|ACF84190.1| unknown [Zea mays]
          Length = 309

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 108/161 (67%), Gaps = 9/161 (5%)

Query: 34  EESL-NQSEEFRD---KYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSR 89
           +ESL ++ EEF+D   K LR  AEMEN+  RT RE ++ + Y+I  F++ +L V+DNLSR
Sbjct: 137 DESLKSKDEEFKDMKDKVLRSYAEMENVLARTKRESENTKKYAIQSFSKSLLDVADNLSR 196

Query: 90  A-----LDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNP 144
           A        + +D +N   ++ ++LK+L+EG+EMT +++    +++GV+K D  ++KF+P
Sbjct: 197 ASSVVKASFSKIDSSNDSDEAVTLLKTLLEGVEMTEKQLGEVFKKFGVEKFDPLNEKFDP 256

Query: 145 NMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
           N H A+F+ P  + P+ T+  VV+ GY +++RVLRPA V +
Sbjct: 257 NRHYAIFQIPDPSKPSGTVAAVVKVGYMLHDRVLRPAEVGV 297


>gi|195400711|ref|XP_002058959.1| GJ15316 [Drosophila virilis]
 gi|194141611|gb|EDW58028.1| GJ15316 [Drosophila virilis]
          Length = 238

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/171 (35%), Positives = 106/171 (61%), Gaps = 8/171 (4%)

Query: 21  SSTAEEKSEINIPEESLNQSE----EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKF 76
           S+  E K EI    + L  +     E  DKY R +A+ EN+R+R +++  DA+ + I  F
Sbjct: 71  SADEEPKGEIEWLTQELAAARVEHNELLDKYKRALADGENMRKRLNKQIDDAKIFGIQGF 130

Query: 77  ARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID 136
            +D++ V+D L  A  + P D  N+       L++L EG+ +TR  ++   +R+G++ +D
Sbjct: 131 CKDLIEVADVLGHATQAVPKDKLNANAD----LRNLYEGLNLTRASLLQVFKRHGLEALD 186

Query: 137 AKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
             +QKF+PN+H+A+F+   +TV ANT+++V + GY +++R +RPALV +SK
Sbjct: 187 PINQKFDPNLHEALFQTLDNTVEANTVVQVTKLGYKLHKRCIRPALVGVSK 237


>gi|992710|gb|AAA79044.1| droe1 [Drosophila melanogaster]
          Length = 213

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 58/149 (38%), Positives = 96/149 (64%), Gaps = 4/149 (2%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           Q+ E  DKY R +A+ EN+R R +++  DA+ + I  F +D+L V+D L  A  + P D 
Sbjct: 68  QNAELMDKYKRSLADSENMRNRLNKQISDAKIFGIQSFCKDLLEVADTLGHATQAVPKD- 126

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
              +    + LK+L EG+ MTR  ++   +R+G++ +D  +QKF+PN H+A+F++   TV
Sbjct: 127 ---KLSGNTDLKNLYEGLTMTRASLLQVFKRHGLESLDPINQKFDPNQHEALFQKEDKTV 183

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISK 187
             NT+++V + GY ++ER +RPALV +SK
Sbjct: 184 EPNTVVEVTKLGYKLHERCIRPALVGVSK 212


>gi|117921343|ref|YP_870535.1| heat shock protein GrpE [Shewanella sp. ANA-3]
 gi|226737181|sp|A0KZB0|GRPE_SHESA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|117613675|gb|ABK49129.1| GrpE protein [Shewanella sp. ANA-3]
          Length = 206

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 102/163 (62%), Gaps = 13/163 (7%)

Query: 35  ESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSA 94
           ++L + EE +D  +R  AE++N+RRR   + + A  +++ KFA ++L V DN+ RAL   
Sbjct: 48  DALAKVEEQKDSVIRAAAEVDNIRRRAAMDVEKANKFALEKFANELLPVLDNMERALQGT 107

Query: 95  -PLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
            P D            K+L EG+E+T++  ++ + ++GVK ID + Q FNP+ HQA+  +
Sbjct: 108 NPQD---------ETTKALFEGVELTQKSFLTAVAKFGVKPIDPQGQAFNPDQHQAIGMQ 158

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEE 196
           P    PANT++ V+Q GY +N R+LRPA+V +S+G    P++E
Sbjct: 159 PSAEYPANTVMLVMQKGYELNSRLLRPAMVMVSQG---GPSQE 198


>gi|294085183|ref|YP_003551943.1| Ribulose-phosphate 3-epimerase [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664758|gb|ADE39859.1| Ribulose-phosphate 3-epimerase [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 249

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 61/175 (34%), Positives = 110/175 (62%), Gaps = 1/175 (0%)

Query: 13  EKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYS 72
           E  P   +  + ++ + ++  ++ L + +  +D+ LR +AE EN RRR++R+   A+ Y 
Sbjct: 47  ETAPPAESDGSDDDGASLDPYDQLLAERDALKDQLLRALAESENTRRRSERDVLAAKKYG 106

Query: 73  IAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGV 132
               ARD++   DNL+RALD    D   +   SE+ + +++ GIE++  E++S  E++G+
Sbjct: 107 HTGLARDLVGAIDNLARALDIMKDDGFEAGSLSEA-MTNVVTGIELSWTEIISITEKHGI 165

Query: 133 KKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           K+I+   +KF+ N+HQAMFE P    P   +++V+Q GY +++R+LRPA+V +SK
Sbjct: 166 KQINPAGEKFDYNLHQAMFEVPTAETPPGMVVEVLQHGYVLHDRLLRPAMVGVSK 220


>gi|126463640|ref|YP_001044754.1| Fis family transcriptional regulator [Rhodobacter sphaeroides ATCC
           17029]
 gi|221640716|ref|YP_002526978.1| GrpE protein [Rhodobacter sphaeroides KD131]
 gi|126105304|gb|ABN77982.1| transcriptional regulator, Fis family [Rhodobacter sphaeroides ATCC
           17029]
 gi|221161497|gb|ACM02477.1| GrpE protein [Rhodobacter sphaeroides KD131]
          Length = 186

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 64/162 (39%), Positives = 105/162 (64%), Gaps = 8/162 (4%)

Query: 26  EKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSD 85
           E  EI+  E    + +E RD+++R +A+ EN R+R DR++++A+ Y   + ARD+L V D
Sbjct: 27  EAPEIDELETLRAERDELRDRFMRALADAENSRKRADRDRREAEQYGGTRLARDLLPVYD 86

Query: 86  NLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNP 144
           NLSRA     L++A  E+++ +   +LIEG+E+T RE+ + + ++GV+ I  +    F+P
Sbjct: 87  NLSRA-----LEVATDEQRAAAA--ALIEGVELTLRELRNVMNKHGVRPISPQVGDTFDP 139

Query: 145 NMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
             HQAMFE P     A  II+V+ +G+ I++R+LRPA V +S
Sbjct: 140 QQHQAMFEAPVPGTKAGQIIQVMTEGFMIHDRLLRPAQVGVS 181


>gi|77464797|ref|YP_354301.1| putative chaperone protein GrpE (heat shock protein) [Rhodobacter
           sphaeroides 2.4.1]
 gi|123590774|sp|Q3IYI4|GRPE_RHOS4 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|77389215|gb|ABA80400.1| putative chaperone protein GrpE (heat shock protein) [Rhodobacter
           sphaeroides 2.4.1]
          Length = 189

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 64/162 (39%), Positives = 105/162 (64%), Gaps = 8/162 (4%)

Query: 26  EKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSD 85
           E  EI+  E    + +E RD+++R +A+ EN R+R DR++++A+ Y   + ARD+L V D
Sbjct: 30  EAPEIDELETLRAERDELRDRFMRALADAENSRKRADRDRREAEQYGGTRLARDLLPVYD 89

Query: 86  NLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNP 144
           NLSRA     L++A  E+++ +   +LIEG+E+T RE+ + + ++GV+ I  +    F+P
Sbjct: 90  NLSRA-----LEVATDEQRAAAA--ALIEGVELTLRELRNVMNKHGVRPITPQVGDTFDP 142

Query: 145 NMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
             HQAMFE P     A  II+V+ +G+ I++R+LRPA V +S
Sbjct: 143 QQHQAMFEAPVPGTKAGQIIQVMTEGFMIHDRLLRPAQVGVS 184


>gi|332559693|ref|ZP_08414015.1| putative chaperone protein GrpE (heat shock protein) [Rhodobacter
           sphaeroides WS8N]
 gi|332277405|gb|EGJ22720.1| putative chaperone protein GrpE (heat shock protein) [Rhodobacter
           sphaeroides WS8N]
          Length = 178

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 64/162 (39%), Positives = 105/162 (64%), Gaps = 8/162 (4%)

Query: 26  EKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSD 85
           E  EI+  E    + +E RD+++R +A+ EN R+R DR++++A+ Y   + ARD+L V D
Sbjct: 19  EAPEIDELETLRAERDELRDRFMRALADAENSRKRADRDRREAEQYGGTRLARDLLPVYD 78

Query: 86  NLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNP 144
           NLSRA     L++A  E+++ +   +LIEG+E+T RE+ + + ++GV+ I  +    F+P
Sbjct: 79  NLSRA-----LEVATDEQRAAAA--ALIEGVELTLRELRNVMNKHGVRPITPQVGDTFDP 131

Query: 145 NMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
             HQAMFE P     A  II+V+ +G+ I++R+LRPA V +S
Sbjct: 132 QQHQAMFEAPVPGTKAGQIIQVMTEGFMIHDRLLRPAQVGVS 173


>gi|308050611|ref|YP_003914177.1| GrpE protein [Ferrimonas balearica DSM 9799]
 gi|307632801|gb|ADN77103.1| GrpE protein [Ferrimonas balearica DSM 9799]
          Length = 204

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 100/145 (68%), Gaps = 8/145 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  +R  AE+EN+RRRT ++ + A  +++ KFA ++L V DNL RAL+     ++NS+ 
Sbjct: 58  KDSVVRAAAEVENIRRRTAQDVEKAHKFALEKFANELLPVIDNLERALE-----VSNSDD 112

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           ++   +K ++EG+E+T + M++++ ++G++ +D   + FNP  HQA+   P +   ANT+
Sbjct: 113 EA---IKPMLEGVELTLKSMLASVAKFGIEVVDPVGEAFNPEFHQAISMLPSEEFAANTV 169

Query: 164 IKVVQDGYAINERVLRPALVSISKG 188
           I V+Q GYA+N R+LRPA+V +S+G
Sbjct: 170 ISVMQKGYALNGRLLRPAMVIVSRG 194


>gi|24653432|ref|NP_610886.2| Roe1 [Drosophila melanogaster]
 gi|52788262|sp|P48604|GRPE_DROME RecName: Full=GrpE protein homolog, mitochondrial; AltName:
           Full=dRoe1; Flags: Precursor
 gi|7303294|gb|AAF58354.1| Roe1 [Drosophila melanogaster]
 gi|211938555|gb|ACJ13174.1| FI04716p [Drosophila melanogaster]
          Length = 213

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 58/149 (38%), Positives = 96/149 (64%), Gaps = 4/149 (2%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           Q+ E  DKY R +A+ EN+R R +++  DA+ + I  F +D+L V+D L  A  + P D 
Sbjct: 68  QNAELMDKYKRSLADSENMRNRLNKQISDAKIFGIQSFCKDLLEVADTLGHATQAVPKD- 126

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
              +    + LK+L EG+ MTR  ++   +R+G++ +D  +QKF+PN H+A+F++   TV
Sbjct: 127 ---KLSGNADLKNLYEGLTMTRASLLQVFKRHGLEPLDPINQKFDPNQHEALFQKEDKTV 183

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISK 187
             NT+++V + GY ++ER +RPALV +SK
Sbjct: 184 EPNTVVEVTKLGYKLHERCIRPALVGVSK 212


>gi|242044212|ref|XP_002459977.1| hypothetical protein SORBIDRAFT_02g019590 [Sorghum bicolor]
 gi|241923354|gb|EER96498.1| hypothetical protein SORBIDRAFT_02g019590 [Sorghum bicolor]
          Length = 305

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 107/168 (63%), Gaps = 10/168 (5%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS-----APL 96
           + +DK LR  AEMEN+  RT RE ++++ Y++  FA+ +L V+DNLSRA        + +
Sbjct: 136 DMKDKVLRSYAEMENIIARTKRESENSKKYAVQNFAKSLLDVADNLSRASSVVKESFSKI 195

Query: 97  DLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHD 156
           D +     +  +LK+L+EG++MT +++    +++GV+K D  ++KF+PN H A+F+ P  
Sbjct: 196 DASKDSAGAIPLLKTLLEGVDMTEKQLAEVFKKFGVEKFDPLNEKFDPNRHCAVFQIPDP 255

Query: 157 TVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQP 204
           + P+ T+  VV+ GY +++RVLRPA V ++ G   + TEE     EQP
Sbjct: 256 SKPSGTVASVVKVGYMLHDRVLRPAEVGVTAGGA-DATEEA----EQP 298


>gi|148258936|ref|YP_001243521.1| putative heat shock protein (HSP-70 cofactor), grpE [Bradyrhizobium
           sp. BTAi1]
 gi|146411109|gb|ABQ39615.1| putative heat shock protein (HSP-70 COFACTOR), grpE [Bradyrhizobium
           sp. BTAi1]
          Length = 181

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 100/151 (66%), Gaps = 7/151 (4%)

Query: 37  LNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPL 96
           L+++   +D+ LR +A+ EN RR+ DR+ +D + +++A+FAR++L V DNL R +++   
Sbjct: 25  LSENASLKDRLLRALADAENARRQADRKAEDTRKFAVAEFARELLPVIDNLQRVIEA--- 81

Query: 97  DLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHD 156
                +    +   +L+EG+E T R  + TLER+GVKKI A  Q+F+P++H+A+ E    
Sbjct: 82  ----RKTVPSTQHDALLEGVETTLRLFLQTLERFGVKKIAASGQRFDPSLHEALMEAEDA 137

Query: 157 TVPANTIIKVVQDGYAINERVLRPALVSISK 187
           + P   I +V++DGY I++R+LRPA V +SK
Sbjct: 138 SHPPGIITRVLEDGYMIHDRLLRPARVVVSK 168


>gi|85374031|ref|YP_458093.1| molecular chaperone GrpE [Erythrobacter litoralis HTCC2594]
 gi|123005038|sp|Q2NAJ5|GRPE_ERYLH RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|84787114|gb|ABC63296.1| molecular chaperone GrpE [Erythrobacter litoralis HTCC2594]
          Length = 197

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 91/136 (66%), Gaps = 5/136 (3%)

Query: 52  AEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKS 111
           AE +N+RRR +++ +DA++Y+   FARD+LS++DNL+RA+D+ P +L   EK      K 
Sbjct: 64  AETQNVRRRMEKDIQDARTYAATGFARDILSIADNLARAIDAIPQELREDEK-----FKG 118

Query: 112 LIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGY 171
           L+ GIE T+RE+     ++GV +I A     +PN HQAM E P D V   TI++ +Q GY
Sbjct: 119 LVAGIEATQRELDKVFAQHGVSRIAAMGLPLDPNQHQAMMEVPTDEVEPGTIVQEMQAGY 178

Query: 172 AINERVLRPALVSISK 187
            I +R+LRP++V ++K
Sbjct: 179 MIRDRLLRPSMVGVAK 194


>gi|310817154|ref|YP_003965118.1| GrpE protein HSP-70 cofactor, putative [Ketogulonicigenium vulgare
           Y25]
 gi|308755889|gb|ADO43818.1| GrpE protein HSP-70 cofactor, putative [Ketogulonicigenium vulgare
           Y25]
          Length = 183

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 61/154 (39%), Positives = 106/154 (68%), Gaps = 8/154 (5%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           E +L + +E +D+ LR  A+ EN+R+R DR++++A++Y  +K ARDML V DNL+RAL++
Sbjct: 33  EATLAERDELKDRLLRAFADSENMRKRADRDRREAENYGGSKLARDMLPVYDNLTRALEA 92

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID-AKDQKFNPNMHQAMFE 152
               + + ++++ +   +LIEGI++T RE+++   R+G+K+I  A   KF+P  H+AMFE
Sbjct: 93  ----ITDEQREANA---ALIEGIDLTMRELVAVFARHGIKQIAPAAGDKFDPQQHEAMFE 145

Query: 153 EPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
            P     +  II+V+Q G+ +++R+LR A V +S
Sbjct: 146 APVPGTKSGEIIQVMQVGFMLHDRLLRAAKVGVS 179


>gi|113971067|ref|YP_734860.1| heat shock protein GrpE [Shewanella sp. MR-4]
 gi|122943661|sp|Q0HGL4|GRPE_SHESM RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|113885751|gb|ABI39803.1| GrpE protein [Shewanella sp. MR-4]
          Length = 203

 Score =  125 bits (314), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 103/163 (63%), Gaps = 13/163 (7%)

Query: 35  ESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSA 94
           ++L + EE +D  +R  AE++N+RRR   + + A  +++ KFA ++L V DN+ RAL   
Sbjct: 48  DALAKVEEQKDSVIRAAAEVDNIRRRAAMDVEKANKFALEKFANELLPVLDNMERALQGT 107

Query: 95  -PLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
            P D            K++ EG+E+T++ +++ + ++GVK ID + Q FNP+ HQA+  +
Sbjct: 108 NPQD---------ETTKAIYEGVELTQKSLLTAVAKFGVKPIDPQGQAFNPDQHQAIGMQ 158

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEE 196
           P    PANT++ V+Q GY +N R+LRPA+V +S+G    P++E
Sbjct: 159 PSAEFPANTVMLVMQKGYELNSRLLRPAMVMVSQG---GPSQE 198


>gi|117619528|ref|YP_857488.1| co-chaperone GrpE [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
 gi|226737101|sp|A0KMI7|GRPE_AERHH RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|117560935|gb|ABK37883.1| co-chaperone GrpE [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
          Length = 191

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 67/177 (37%), Positives = 112/177 (63%), Gaps = 12/177 (6%)

Query: 16  PSNANSSTAEEKSEINIPEESLNQSE----EFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
           P++ +S    E++ I   E  L+ ++    E R++ +R +AEMENLRRR  ++ + A  +
Sbjct: 21  PTDVDSEVTAEQARIAELEAQLDAAQQASLEERERAIRAVAEMENLRRRAAQDVEKAHKF 80

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
           ++ KFA ++L V DNL RA++     LA+ E ++   LK +IEG+E+T + M S++ ++G
Sbjct: 81  ALEKFAAELLPVLDNLERAIE-----LADKENEA---LKPMIEGVELTLKSMQSSVGKFG 132

Query: 132 VKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           +  +D  +Q F+PN HQAM    +  +  NT+I V+Q GY +N RV+RPA+V +SK 
Sbjct: 133 LNPLDPLNQPFDPNAHQAMSMIENAELAPNTVIAVMQKGYELNGRVIRPAMVMVSKA 189


>gi|195455354|ref|XP_002074684.1| GK23032 [Drosophila willistoni]
 gi|194170769|gb|EDW85670.1| GK23032 [Drosophila willistoni]
          Length = 170

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 99/154 (64%), Gaps = 6/154 (3%)

Query: 35  ESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSA 94
           E+  Q  E  DKY R +A+ EN+R R +++  DA+++ I  F +D L V+D L  A  + 
Sbjct: 22  EAKEQHSELLDKYKRSLADSENMRTRLNKQIADAKTFGIQSFCKDFLEVADTLGHATQAV 81

Query: 95  PLDLANSEKKSESV-LKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
           P      EK +++  LK+L EG+ MT+  ++   + +G++ +D  +QKFNPN+H+A+F++
Sbjct: 82  P-----KEKLADNADLKNLFEGLSMTKASLLQVFKCHGLEPLDPINQKFNPNLHEALFQK 136

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
              TV ANT+++V +  Y ++ER +RPALV +SK
Sbjct: 137 EDKTVDANTVVEVTKLDYTLHERCIRPALVGVSK 170


>gi|115475980|ref|NP_001061586.1| Os08g0338700 [Oryza sativa Japonica Group]
 gi|38636943|dbj|BAD03205.1| putative chaperone GrpE [Oryza sativa Japonica Group]
 gi|38637387|dbj|BAD03646.1| putative chaperone GrpE [Oryza sativa Japonica Group]
 gi|113623555|dbj|BAF23500.1| Os08g0338700 [Oryza sativa Japonica Group]
 gi|215704442|dbj|BAG93876.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215765184|dbj|BAG86881.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|218200983|gb|EEC83410.1| hypothetical protein OsI_28865 [Oryza sativa Indica Group]
 gi|222640387|gb|EEE68519.1| hypothetical protein OsJ_26957 [Oryza sativa Japonica Group]
          Length = 311

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 58/150 (38%), Positives = 99/150 (66%), Gaps = 5/150 (3%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS-----APL 96
           + +DK LR  AEMEN+  RT RE  +A+ Y++  F++ +L V+DNLSRA        + +
Sbjct: 145 DMKDKVLRSYAEMENVIARTKRESDNAKKYAVQGFSKSLLDVADNLSRASSVVKESFSKI 204

Query: 97  DLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHD 156
           D +N   ++  +L +L+EG+EMT +++    +++GV+K D  ++KF+PN H A+F+ P  
Sbjct: 205 DTSNESAEAVKLLNTLLEGVEMTEKQLGEVFKKFGVEKFDPLNEKFDPNKHAALFQIPDP 264

Query: 157 TVPANTIIKVVQDGYAINERVLRPALVSIS 186
           + P+ T+  VV+ GY +++RVLRPA V ++
Sbjct: 265 SKPSGTVAAVVKVGYMLHDRVLRPAEVGVT 294


>gi|146278689|ref|YP_001168848.1| GrpE protein [Rhodobacter sphaeroides ATCC 17025]
 gi|145556930|gb|ABP71543.1| GrpE protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 186

 Score =  125 bits (313), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 64/162 (39%), Positives = 105/162 (64%), Gaps = 8/162 (4%)

Query: 26  EKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSD 85
           E  EI+  E    + +E RD+++R +A+ EN R+R DR++++A+ Y   + ARD+L V D
Sbjct: 27  EAPEIDELEVLRAERDELRDRFMRALADAENSRKRADRDRREAEQYGGTRLARDLLPVYD 86

Query: 86  NLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNP 144
           NLSRA     L++A  E+++ +   +LIEG+E+T RE+ + + ++GV+ I  +    F+P
Sbjct: 87  NLSRA-----LEVAGDEQRAAAA--ALIEGVELTLRELRNVMNKHGVRPITPQVGDTFDP 139

Query: 145 NMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
             HQAMFE P     A  II+V+ +G+ I++R+LRPA V +S
Sbjct: 140 QQHQAMFEAPVPGTKAGQIIQVMTEGFMIHDRLLRPAQVGVS 181


>gi|83942036|ref|ZP_00954498.1| co-chaperone GrpE [Sulfitobacter sp. EE-36]
 gi|83847856|gb|EAP85731.1| co-chaperone GrpE [Sulfitobacter sp. EE-36]
          Length = 187

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 65/172 (37%), Positives = 112/172 (65%), Gaps = 16/172 (9%)

Query: 22  STAEEKSEINIPEESLNQSE------EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAK 75
           + A+E SEI+  +E+L   E      + +D+++R +A+ EN R+R+D+++++A++Y  +K
Sbjct: 20  AYADEMSEID--DEALELDELRAERDQLKDRFMRALADAENARKRSDKDRREAENYGGSK 77

Query: 76  FARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI 135
            ARDML V DN+ RAL++A        ++  ++   L+EGIE+T RE++S  +++G++ I
Sbjct: 78  LARDMLPVYDNMKRALEAAT-------EEQRTISGPLLEGIELTMRELLSVFKKHGIEVI 130

Query: 136 D-AKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
             A   KF+P  HQAMFE P     A  II+V  +G+ +++R+LRPA V +S
Sbjct: 131 SPAVGDKFDPQHHQAMFEAPVPDTKAGDIIQVAAEGFMLHDRLLRPAQVGVS 182


>gi|224133294|ref|XP_002321532.1| predicted protein [Populus trichocarpa]
 gi|222868528|gb|EEF05659.1| predicted protein [Populus trichocarpa]
          Length = 265

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 101/152 (66%), Gaps = 5/152 (3%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRA-----LDSAP 95
           E  +DK LR  AEMEN++ RT RE ++++ ++I  FA+ +L V+DNL RA      + + 
Sbjct: 104 ETIQDKVLRAYAEMENVKERTKREAENSKKFAIQNFAKSLLDVADNLGRASSVVKGNFSK 163

Query: 96  LDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPH 155
           +D++N   +   +LK+L+EG+EMT +++    ++YG++K D  ++ F+P+ H A+F+ P 
Sbjct: 164 IDVSNDTAQVVPLLKTLLEGVEMTEKQLGEVFKKYGIEKFDPTNEPFDPHRHNAIFQVPD 223

Query: 156 DTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            + P  T+  V++ GY +++RV+RPA V +++
Sbjct: 224 ASKPPGTVAAVLKAGYMLHDRVIRPAEVGVTR 255


>gi|145299905|ref|YP_001142746.1| heat shock protein GrpE [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|226737102|sp|A4SQ26|GRPE_AERS4 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|142852677|gb|ABO90998.1| heat shock protein GrpE [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 191

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 110/177 (62%), Gaps = 12/177 (6%)

Query: 16  PSNANSSTAEEKSEINIPEESLNQSE----EFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
           P++ +S    E++ I   E  L  ++    E R++ +R +AEMENLRRR  ++ + A  +
Sbjct: 21  PTDVDSEVTAEQARIAELEAQLEAAQLASNEERERAIRAVAEMENLRRRAAQDVEKAHKF 80

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
           ++ KFA ++L V DNL RA++ A       +K+SE  LK +IEG+E+T + M S + ++G
Sbjct: 81  ALEKFAAELLPVLDNLERAIELA-------DKESEE-LKPMIEGVELTLKSMQSGVAKFG 132

Query: 132 VKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           +  +D  +Q F+PN HQAM    +  +  NT+I V+Q GY +N RV+RPA+V +SK 
Sbjct: 133 LNPLDPLNQPFDPNAHQAMSMIENGELAPNTVIAVMQKGYELNGRVIRPAMVMVSKA 189


>gi|158287473|ref|XP_309497.4| AGAP011150-PA [Anopheles gambiae str. PEST]
 gi|157019667|gb|EAA05028.4| AGAP011150-PA [Anopheles gambiae str. PEST]
          Length = 221

 Score =  124 bits (312), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 97/144 (67%), Gaps = 3/144 (2%)

Query: 45  DKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKK 104
           DKY R +AE EN+RRR  ++  DA+ + I  F +D+L V+D L  A ++ P D   S+K 
Sbjct: 81  DKYKRALAESENIRRRLTKQIDDAKLFGIQGFCKDLLEVADILGHATEAVPKD-EISDKN 139

Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTII 164
               LK+L EG+ MTR+++ S  +R+G++ ++  ++KFNPN+H+A+F++    V  NT++
Sbjct: 140 PH--LKNLFEGLSMTRQQLNSVFKRHGLETVNPMNEKFNPNLHEALFQQEVANVEPNTVV 197

Query: 165 KVVQDGYAINERVLRPALVSISKG 188
            V + GY +++R +RPALV ++KG
Sbjct: 198 VVSKIGYKLHDRCIRPALVGVTKG 221


>gi|170043539|ref|XP_001849441.1| grpE [Culex quinquefasciatus]
 gi|167866847|gb|EDS30230.1| grpE [Culex quinquefasciatus]
          Length = 221

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 59/152 (38%), Positives = 102/152 (67%), Gaps = 7/152 (4%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           +++E  DKY R +A+ ENLRRR  ++ +DA+ + I  F +D+L V+D L  A ++ P   
Sbjct: 75  KTKELDDKYKRALADGENLRRRLTKQIEDAKLFGIQGFCKDLLEVADILGHATEAVP--- 131

Query: 99  ANSEKKSES--VLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHD 156
              E+ S+S   LK+L EG+ MT+ ++    +R+G+++++  ++KFNPN+H+A+F++   
Sbjct: 132 --KEEISDSNPHLKNLYEGLTMTKAQLNQVFKRHGLEQVNPLNEKFNPNLHEALFQQEVQ 189

Query: 157 TVPANTIIKVVQDGYAINERVLRPALVSISKG 188
            V  NT++ V + GY ++ER +RPALV +SKG
Sbjct: 190 NVEPNTVVVVSKIGYKLHERCIRPALVGVSKG 221


>gi|83950765|ref|ZP_00959498.1| co-chaperone GrpE [Roseovarius nubinhibens ISM]
 gi|83838664|gb|EAP77960.1| co-chaperone GrpE [Roseovarius nubinhibens ISM]
          Length = 186

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 59/145 (40%), Positives = 96/145 (66%), Gaps = 8/145 (5%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            +DK++R +A+ EN R+R D+ ++DA+ Y   + ARD+L V DN+ RAL++     A  E
Sbjct: 45  LQDKFMRALADAENARKRGDKARRDAEQYGGTRLARDVLPVYDNMKRALEA-----ATDE 99

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPAN 161
           +K   + K+LIEGIE+T RE++S  +++G+  +  +   KF+P +H+AMFE P     A 
Sbjct: 100 QK--EIAKALIEGIELTMRELLSVFQKHGITLVSPQVGDKFDPQLHEAMFEAPVPGTKAG 157

Query: 162 TIIKVVQDGYAINERVLRPALVSIS 186
            II+V  +G+ ++ER+LRPA V +S
Sbjct: 158 EIIQVSAEGFMLHERILRPAQVGVS 182


>gi|329891266|ref|ZP_08269609.1| protein grpE [Brevundimonas diminuta ATCC 11568]
 gi|328846567|gb|EGF96131.1| protein grpE [Brevundimonas diminuta ATCC 11568]
          Length = 208

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 93/137 (67%), Gaps = 8/137 (5%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           ++++D+ LR +AE EN++RR + ++ DA++Y+I +FA+D+LSV+D L R L +AP     
Sbjct: 43  DQWKDRALRAVAEAENVKRRAETQQNDARAYAIQRFAKDLLSVADTLERGLATAP----- 97

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID-AKDQKFNPNMHQAMFEEPHDTVP 159
             K ++    +++ G+E+T++ ++S  E  G+ ++D A    F+P++HQAM E+P DTVP
Sbjct: 98  --KDADGPAAAMVTGLELTQKSLLSAFEANGLTRVDPAPGDAFDPHLHQAMMEQPSDTVP 155

Query: 160 ANTIIKVVQDGYAINER 176
              +I+ +Q GYA+  R
Sbjct: 156 GGAVIQTLQPGYALFGR 172


>gi|120599629|ref|YP_964203.1| heat shock protein GrpE [Shewanella sp. W3-18-1]
 gi|146292377|ref|YP_001182801.1| heat shock protein GrpE [Shewanella putrefaciens CN-32]
 gi|226737179|sp|A4Y4W9|GRPE_SHEPC RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737182|sp|A1RLV4|GRPE_SHESW RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|120559722|gb|ABM25649.1| GrpE protein [Shewanella sp. W3-18-1]
 gi|145564067|gb|ABP75002.1| GrpE protein [Shewanella putrefaciens CN-32]
 gi|319425677|gb|ADV53751.1| heat shock protein, GrpE [Shewanella putrefaciens 200]
          Length = 206

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 115/193 (59%), Gaps = 21/193 (10%)

Query: 13  EKNPSNANSSTAEEKSEINIPEESLNQ--------SEEFRDKYLRVIAEMENLRRRTDRE 64
           E   S A +S  +E ++ N   E L Q         EE +D  +R  AE++N+RRR   +
Sbjct: 18  ESEVSTAEASLVDELTQANFRIEELEQLLADALAKVEEQKDSVIRAAAEVDNIRRRAAMD 77

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRAL-DSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
            + A  +++ KFA ++L V DN+ RAL  + P D A          K++ +G+E+T++ +
Sbjct: 78  VEKANKFALEKFANELLPVLDNMERALMGTNPEDEAT---------KAIYQGVELTQKSL 128

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
           ++ + ++GVK+ID + + FNP+ HQA+  +P    PANT++ V+Q GY +N R+LRPA+V
Sbjct: 129 LTAVAKFGVKQIDPQGESFNPDQHQAIGMQPSADFPANTVMLVMQKGYELNSRLLRPAMV 188

Query: 184 SISKGKTQNPTEE 196
            +S+G    P++E
Sbjct: 189 MVSQG---GPSQE 198


>gi|114048297|ref|YP_738847.1| heat shock protein GrpE [Shewanella sp. MR-7]
 gi|122944499|sp|Q0HSW5|GRPE_SHESR RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|113889739|gb|ABI43790.1| GrpE protein [Shewanella sp. MR-7]
          Length = 203

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 102/163 (62%), Gaps = 13/163 (7%)

Query: 35  ESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSA 94
           ++L + EE +D  +R  AE++N+RRR   + + A  +++ KFA ++L V DN+ RAL   
Sbjct: 48  DALAKVEEQKDSVIRAAAEVDNIRRRAAMDVEKANKFALEKFANELLPVLDNMERALQGT 107

Query: 95  -PLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
            P D            K++ EG+E+T++  ++ + ++GVK ID + Q FNP+ HQA+  +
Sbjct: 108 NPQD---------ETTKAIYEGVELTQKSFLTAVAKFGVKPIDPQGQAFNPDQHQAIGMQ 158

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEE 196
           P    PANT++ V+Q GY +N R+LRPA+V +S+G    P++E
Sbjct: 159 PSAEYPANTVMLVMQKGYELNSRLLRPAMVMVSQG---GPSQE 198


>gi|321477283|gb|EFX88242.1| hypothetical protein DAPPUDRAFT_305539 [Daphnia pulex]
          Length = 217

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 56/149 (37%), Positives = 96/149 (64%), Gaps = 4/149 (2%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           +  +  DKY R +A+ EN+R+R  ++ +DA+ + I  F +D+LSVSD L +A +  P D 
Sbjct: 73  KCSDLDDKYKRSLADTENMRKRLTKQIEDAKLFGIQGFCKDLLSVSDILQKATECVPAD- 131

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
              + K+ + LK+L EG+ MT  E+    +R+G+ ++    +KFNPN H+A+FE+P +  
Sbjct: 132 ---QVKTNTHLKNLYEGLTMTEAELQKVFKRHGLAQVSPLGEKFNPNHHEALFEQPIEGK 188

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISK 187
              T+I V + GY ++ER++RPA+V ++K
Sbjct: 189 EPGTVIAVTKIGYKLHERIVRPAMVGVAK 217


>gi|157962810|ref|YP_001502844.1| heat shock protein GrpE [Shewanella pealeana ATCC 700345]
 gi|226737178|sp|A8H6X2|GRPE_SHEPA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|157847810|gb|ABV88309.1| GrpE protein [Shewanella pealeana ATCC 700345]
          Length = 200

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 55/145 (37%), Positives = 97/145 (66%), Gaps = 8/145 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  +R  AE++N+RRR+  + + A  +++ KF  ++L V DN+ RAL         ++ 
Sbjct: 64  KDSVIRAAAEVDNIRRRSAMDVEKAHKFALEKFINELLPVLDNMERALQG-------TDA 116

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           ++E+  K++ EG+E+T +  MST+E++G+ ++D +   FNP +HQA+  +P    PANT+
Sbjct: 117 EAEAT-KAIYEGVELTAKSFMSTVEKFGLVQVDPQGDTFNPELHQAIGMQPSADFPANTV 175

Query: 164 IKVVQDGYAINERVLRPALVSISKG 188
           + V+Q GY +NER+LRPA+V +S+G
Sbjct: 176 MMVMQKGYTLNERLLRPAMVMVSQG 200


>gi|218781454|ref|YP_002432772.1| GrpE protein [Desulfatibacillum alkenivorans AK-01]
 gi|226737125|sp|B8FGS4|GRPE_DESAA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|218762838|gb|ACL05304.1| GrpE protein [Desulfatibacillum alkenivorans AK-01]
          Length = 208

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 93/148 (62%), Gaps = 6/148 (4%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
           ++D YLR +AE EN RRR DRE  + + Y+     +D++ V DNL RA++       N++
Sbjct: 67  YKDLYLRTLAEFENYRRRADRETNEFKKYANETLIKDIIPVIDNLERAMECT----VNTD 122

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
                  ++L+ G++MT RE++  LE+YGV +I A  + F+P  HQA+  E  D  P  T
Sbjct: 123 DPG--CAQNLLAGVQMTEREILKVLEKYGVTRISAIGETFDPAYHQALMAEESDEHPDET 180

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKT 190
           +I+ +Q GY + +R++RPALV+++KGK 
Sbjct: 181 VIREMQKGYLLKDRLIRPALVAVAKGKA 208


>gi|254295456|ref|YP_003061479.1| GrpE protein [Hirschia baltica ATCC 49814]
 gi|254043987|gb|ACT60782.1| GrpE protein [Hirschia baltica ATCC 49814]
          Length = 199

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 97/147 (65%), Gaps = 5/147 (3%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            +D+ +R +A+MENLR+RT+++  D++ Y++ KFA D+LSVSDN++RAL  A  D A + 
Sbjct: 56  LKDQLVRTMADMENLRKRTEKQVADSRIYAVEKFAGDLLSVSDNMTRAL-GAVSDEAKAA 114

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPAN 161
              +   +SL+ GIEMT++E+ +   R GV  IDA     F+PN+HQA+ + P D  P  
Sbjct: 115 LSEQG--QSLLAGIEMTQKELHAAFARNGVVAIDAAPGASFDPNLHQAISQIPSDQ-PNG 171

Query: 162 TIIKVVQDGYAINERVLRPALVSISKG 188
           T+ +  Q G+ I +R LR A+V++S G
Sbjct: 172 TVAETFQSGWKIGDRTLRAAMVAVSSG 198


>gi|209544120|ref|YP_002276349.1| GrpE protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|209531797|gb|ACI51734.1| GrpE protein [Gluconacetobacter diazotrophicus PAl 5]
          Length = 210

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 91/147 (61%), Gaps = 4/147 (2%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           EE R+K+LR  AEM+NLR RT RE +DA+ Y+  KFARD++  ++NL RAL S P    +
Sbjct: 38  EEMREKWLRSEAEMQNLRTRTKRELEDARQYATQKFARDVVEAAENLKRALASLP----H 93

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
           + +  + ++  + EGIE T R  M  LER+G+   D     F+ N HQAM E+  D  P 
Sbjct: 94  ATEGEDRLIARMREGIESTERSFMGILERHGISAADPAGTPFDANHHQAMAEQHSDEHPH 153

Query: 161 NTIIKVVQDGYAINERVLRPALVSISK 187
            T+I+     + ++ R+L+PA+V +SK
Sbjct: 154 GTVIQAWTPAWTLHGRLLKPAMVVVSK 180


>gi|240948615|ref|ZP_04752988.1| heat shock protein [Actinobacillus minor NM305]
 gi|240297123|gb|EER47694.1| heat shock protein [Actinobacillus minor NM305]
          Length = 195

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 58/143 (40%), Positives = 99/143 (69%), Gaps = 6/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE++N+RRR +++ + A  +++ KF++++L+V DNL R L  A LD A +++
Sbjct: 58  KDIQLRAQAEIQNIRRRAEQDVEKAHKFALEKFSKELLTVVDNLERGL--AALDNAVTDE 115

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           K+    ++L++G+EMT +E +STL ++GV+ + A  + FNP +HQA+  +P + V AN I
Sbjct: 116 KT----QALVDGVEMTHKEFISTLAKFGVEAVGAVGEAFNPELHQAISMQPAEGVDANHI 171

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY +  RVLRPA+V ++
Sbjct: 172 STVLQKGYTLQGRVLRPAMVIVA 194


>gi|85082684|ref|XP_956965.1| hypothetical protein NCU01516 [Neurospora crassa OR74A]
 gi|52782986|sp|Q9P5U4|GRPE_NEUCR RecName: Full=GrpE protein homolog, mitochondrial; Flags: Precursor
 gi|7801031|emb|CAB91427.1| probable heat shock protein MGE1 precursor [Neurospora crassa]
 gi|28918047|gb|EAA27729.1| conserved hypothetical protein [Neurospora crassa OR74A]
          Length = 238

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 62/153 (40%), Positives = 98/153 (64%), Gaps = 2/153 (1%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           ++ E++DK LR +A+  NL+ RT R+ K A+ ++I KFA+D++   DN  RAL   P D 
Sbjct: 86  EAREWKDKCLRTVADFRNLQERTARDVKQAKDFAIQKFAKDLVESVDNFERALSVVPQDK 145

Query: 99  ANSEKKSESV--LKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHD 156
             SE++SE +  L +L EG++MT   ++STL+++G+++I+ + + FNPN H+A F  P  
Sbjct: 146 LKSEEQSEHLKDLVNLYEGLKMTESILLSTLKKHGLERIEPEGEVFNPNEHEATFMAPMP 205

Query: 157 TVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
               N +  V Q G+ +N RVLRPA V + K K
Sbjct: 206 DKEHNVVFHVQQKGFKLNGRVLRPAQVGVVKNK 238


>gi|240851506|ref|ZP_04752257.1| heat shock protein (HSP-70 cofactor) [Actinobacillus minor 202]
 gi|240310024|gb|EER48316.1| heat shock protein (HSP-70 cofactor) [Actinobacillus minor 202]
          Length = 195

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 57/143 (39%), Positives = 99/143 (69%), Gaps = 6/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE++N+RRR +++ + A  +++ KF++++L+V DNL R L  A LD A +++
Sbjct: 58  KDIQLRAQAEIQNIRRRAEQDVEKAHKFALEKFSKELLTVVDNLERGL--AALDNAVTDE 115

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           K+    ++L++G+EMT +E +STL ++GV+ + A  + FNP +HQA+  +P + + AN I
Sbjct: 116 KT----QALVDGVEMTHKEFISTLAKFGVEAVGAVGEVFNPELHQAISMQPAEGIDANHI 171

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY +  RVLRPA+V ++
Sbjct: 172 STVLQKGYTLQGRVLRPAMVIVA 194


>gi|227818330|ref|YP_002822301.1| heat shock protein GrpE-like protein [Sinorhizobium fredii NGR234]
 gi|227337329|gb|ACP21548.1| heat shock protein GrpE-like protein [Sinorhizobium fredii NGR234]
          Length = 198

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 95/151 (62%), Gaps = 5/151 (3%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E +D+ LR +AE +N+R +  R+ +DA  ++ ++   D+L   DNL RA++S P     S
Sbjct: 44  ETKDRLLRAVAEQQNIRLQMQRQCEDAVKFAASQLMGDLLDTLDNLRRAIESVP-----S 98

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
           E     V+  L++G+E T   +++TL R+GV++ID   Q F+P+ H A+F+ P  T    
Sbjct: 99  EASGHDVVNPLLKGVEATESNLLATLARHGVQRIDPLGQAFDPHHHHAIFQRPDATAAEG 158

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGKTQN 192
           T+++V+Q GY ++ RVLRPA+V ++   +Q+
Sbjct: 159 TVVEVLQPGYMLHGRVLRPAMVGVAVRGSQH 189


>gi|119382765|ref|YP_913821.1| GrpE protein [Paracoccus denitrificans PD1222]
 gi|119372532|gb|ABL68125.1| GrpE protein [Paracoccus denitrificans PD1222]
          Length = 179

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 102/154 (66%), Gaps = 9/154 (5%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           E  + + +E+RD+++R +A+ EN R+R +++++DA+ Y  ++ ARD+L V D L+RAL++
Sbjct: 29  EALIAERDEYRDRFMRALADAENARKRAEKDRRDAEQYGGSRLARDLLPVHDALTRALEA 88

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI-DAKDQKFNPNMHQAMFE 152
           A         + +    +LIEG+E+T RE+ +   ++G+K I  A  +KF+P  H+AMFE
Sbjct: 89  A--------SEDQRAAAALIEGVELTLRELNNVFAKHGIKVITPAPGEKFDPQQHEAMFE 140

Query: 153 EPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
            P     A +II+V+ +G+ +++R+LRPA V +S
Sbjct: 141 APVPGTVAGSIIQVMDNGFMLHDRLLRPAKVGVS 174


>gi|149184527|ref|ZP_01862845.1| molecular chaperone GrpE [Erythrobacter sp. SD-21]
 gi|148831847|gb|EDL50280.1| molecular chaperone GrpE [Erythrobacter sp. SD-21]
          Length = 200

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 93/147 (63%), Gaps = 5/147 (3%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           E  + + L   AE +N+RRR +++ +DA++Y+   FARD+LSV+DNL RALD+ P     
Sbjct: 56  ETAKQEVLYARAETQNVRRRMEKDVQDARNYAATGFARDILSVADNLGRALDAIP----- 110

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
           +E++ +  LK  I GIE T+RE+     + G+ +I AK    +PN HQAM E P      
Sbjct: 111 AEQREDEKLKGFIAGIEATQRELEKVFNQNGITRIAAKGMPLDPNQHQAMMEIPTADAEP 170

Query: 161 NTIIKVVQDGYAINERVLRPALVSISK 187
            TI++ +Q GY I +R+LRPA+V ++K
Sbjct: 171 GTIVQEMQAGYMIKDRLLRPAMVGVAK 197


>gi|83953085|ref|ZP_00961807.1| co-chaperone GrpE [Sulfitobacter sp. NAS-14.1]
 gi|83842053|gb|EAP81221.1| co-chaperone GrpE [Sulfitobacter sp. NAS-14.1]
          Length = 187

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 112/172 (65%), Gaps = 16/172 (9%)

Query: 22  STAEEKSEINIPEESLNQSE------EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAK 75
           + A+E SEI+  +E+L   E      + +D+++R +A+ EN R+R+D+++++A++Y  +K
Sbjct: 20  AYADEMSEID--DEALELDELRAERDQLKDRFMRALADAENARKRSDKDRREAENYGGSK 77

Query: 76  FARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI 135
            ARDML V DN+ RAL++A        ++  ++   L+EGIE+T RE++S  +++G++ I
Sbjct: 78  LARDMLPVYDNMKRALEAAT-------EEQRTISGPLLEGIELTMRELLSVFKKHGIEVI 130

Query: 136 D-AKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
             A   KF+P  HQAMFE P     +  II+V  +G+ +++R+LRPA V +S
Sbjct: 131 SPAVGDKFDPQHHQAMFEAPVPDTKSGDIIQVAAEGFMLHDRLLRPAQVGVS 182


>gi|162147058|ref|YP_001601519.1| chaperone binding [Gluconacetobacter diazotrophicus PAl 5]
 gi|161785635|emb|CAP55206.1| Chaperone binding [Gluconacetobacter diazotrophicus PAl 5]
          Length = 274

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 91/147 (61%), Gaps = 4/147 (2%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           EE R+K+LR  AEM+NLR RT RE +DA+ Y+  KFARD++  ++NL RAL S P    +
Sbjct: 102 EEMREKWLRSEAEMQNLRTRTKRELEDARQYATQKFARDVVEAAENLKRALASLP----H 157

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
           + +  + ++  + EGIE T R  M  LER+G+   D     F+ N HQAM E+  D  P 
Sbjct: 158 ATEGEDRLIARMREGIESTERSFMGILERHGISAADPAGTPFDANHHQAMAEQHSDEHPH 217

Query: 161 NTIIKVVQDGYAINERVLRPALVSISK 187
            T+I+     + ++ R+L+PA+V +SK
Sbjct: 218 GTVIQAWTPAWTLHGRLLKPAMVVVSK 244


>gi|163745102|ref|ZP_02152462.1| GrpE protein HSP-70 cofactor, putative [Oceanibulbus indolifex
           HEL-45]
 gi|161381920|gb|EDQ06329.1| GrpE protein HSP-70 cofactor, putative [Oceanibulbus indolifex
           HEL-45]
          Length = 187

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 66/176 (37%), Positives = 116/176 (65%), Gaps = 16/176 (9%)

Query: 20  NSSTAEEKSE--INIPEESLNQSE------EFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
           +S+ AEE +E    I EE+L   E      ++RD+++R +A+ EN R+R+D+++++A++Y
Sbjct: 14  DSAEAEEYAEDMAEIDEEALAVEELRAERDQYRDRFMRALADAENARKRSDKDRREAENY 73

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
             +K ARDML V DN+ RAL++       ++++ E+ L  L+EGI++T RE++S  +++G
Sbjct: 74  GGSKLARDMLPVYDNMKRALET------TTDEQREA-LGPLLEGIQLTMRELLSVFKKHG 126

Query: 132 VKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           ++ I  +   KF+P  H+AMFE P     A  II+V  +G+ +++R+LRPA V +S
Sbjct: 127 IEVIAPEVGDKFDPKHHEAMFEAPVPGTVAGEIIQVAAEGFMLHDRLLRPAQVGVS 182


>gi|302753576|ref|XP_002960212.1| hypothetical protein SELMODRAFT_71278 [Selaginella moellendorffii]
 gi|300171151|gb|EFJ37751.1| hypothetical protein SELMODRAFT_71278 [Selaginella moellendorffii]
          Length = 161

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 103/160 (64%), Gaps = 6/160 (3%)

Query: 31  NIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRA 90
           +I EE     +E +D  LR +AE+EN R R  RE++ ++ +++  F++D+L VSDNLSRA
Sbjct: 4   SIIEEKDELVKELKDSVLRGLAELENYRERAKREQESSRKFAVQSFSKDLLDVSDNLSRA 63

Query: 91  LDSA--PLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQ 148
           L S   P D   ++K    +L +L+ G++MT +++M  L++YGV++ D   + F+PN+H 
Sbjct: 64  LSSVGQPKDAEEAKK----LLDTLLAGVKMTEKQLMQVLKKYGVERFDPTGEPFDPNVHL 119

Query: 149 AMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           A+ E    + PA T+  V + GY ++ERVLRPA V++ K 
Sbjct: 120 AVCEIADPSKPAGTVANVFKVGYLLHERVLRPAEVAVVKA 159


>gi|115478362|ref|NP_001062776.1| Os09g0284400 [Oryza sativa Japonica Group]
 gi|50252542|dbj|BAD28716.1| putative chaperone GrpE type 2 [Oryza sativa Japonica Group]
 gi|50253109|dbj|BAD29356.1| putative chaperone GrpE type 2 [Oryza sativa Japonica Group]
 gi|113631009|dbj|BAF24690.1| Os09g0284400 [Oryza sativa Japonica Group]
 gi|125605029|gb|EAZ44065.1| hypothetical protein OsJ_28684 [Oryza sativa Japonica Group]
 gi|215766781|dbj|BAG99009.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 302

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 62/169 (36%), Positives = 108/169 (63%), Gaps = 6/169 (3%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS-----APL 96
           + +DK LR  AEMEN+  RT RE ++++ Y++  F++ +L V+DNL+RA        + +
Sbjct: 132 DMKDKVLRSYAEMENVIARTKRESENSKKYAVQNFSKSLLDVADNLTRASSVVKESFSKI 191

Query: 97  DLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHD 156
           D +     +  +LK+L+EG++MT +++    +++GV+K D  ++KF+P+ H A+F+ P  
Sbjct: 192 DTSKDSTGAVPLLKTLLEGVDMTDKQLGEVFKKFGVEKFDPLNEKFDPSRHCAIFQIPDP 251

Query: 157 TVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQPS 205
           + P+ T+  VV+ GY +++RVLRPA V +++G     TEE  E  EQ S
Sbjct: 252 SKPSGTVASVVKVGYMLHDRVLRPAEVGVTEGGPTT-TEEAAENSEQKS 299


>gi|119478524|ref|ZP_01618486.1| putative heat shock protein GrpE [marine gamma proteobacterium
           HTCC2143]
 gi|119448505|gb|EAW29753.1| putative heat shock protein GrpE [marine gamma proteobacterium
           HTCC2143]
          Length = 212

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 96/145 (66%), Gaps = 8/145 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LR +AE +N+RRR++++ ++A+ +++ KFA ++L V+DNL RALDSA         
Sbjct: 67  RDDALRTLAEAQNIRRRSEKDIENARKFALEKFASELLGVADNLERALDSA--------D 118

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           K   V+K L+EG+ +T++ ++ TL ++ + ++D   + F+P  HQAM    +  V  NT+
Sbjct: 119 KDNEVVKVLLEGVALTQKSLVDTLAKFNIMQLDPLGEPFDPQFHQAMSMVENPDVEPNTV 178

Query: 164 IKVVQDGYAINERVLRPALVSISKG 188
             V+Q GY +NER+LRPA+V +SK 
Sbjct: 179 TLVMQKGYVLNERLLRPAMVMVSKA 203


>gi|251792990|ref|YP_003007716.1| heat shock protein GrpE [Aggregatibacter aphrophilus NJ8700]
 gi|247534383|gb|ACS97629.1| co-chaperone GrpE [Aggregatibacter aphrophilus NJ8700]
          Length = 191

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 95/143 (66%), Gaps = 7/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE++N+RRRT+++ + A  +++ KFA+D+L+  DNL RAL       A    
Sbjct: 55  QDLLLRTRAEIDNIRRRTEQDVEKAHKFALEKFAKDILNTIDNLERAL-------ATPRN 107

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
             E  +K+L +G+E+T +E+++T+ R+GV+ + A  + FNP++HQA+  +P D   +N I
Sbjct: 108 TEEECVKALFDGVELTLKELLATVARFGVEPVGAVGETFNPDLHQAISMQPTDGFESNQI 167

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY +N RV+RPA+V ++
Sbjct: 168 TTVLQKGYLLNGRVIRPAMVMVA 190


>gi|302768152|ref|XP_002967496.1| hypothetical protein SELMODRAFT_35787 [Selaginella moellendorffii]
 gi|300165487|gb|EFJ32095.1| hypothetical protein SELMODRAFT_35787 [Selaginella moellendorffii]
          Length = 160

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 63/159 (39%), Positives = 103/159 (64%), Gaps = 6/159 (3%)

Query: 31  NIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRA 90
           +I EE     +E +D  LR +AE+EN R R  RE++ ++ +++  F++D+L VSDNLSRA
Sbjct: 6   SIIEEKDELVKELKDSVLRGLAELENYRERAKREQESSRKFAVQSFSKDLLDVSDNLSRA 65

Query: 91  LDSA--PLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQ 148
           L S   P D   ++K    +L +L+ G++MT +++M  L++YGV++ D   + F+PN+H 
Sbjct: 66  LSSVGQPKDAEEAKK----LLDTLLAGVKMTEKQLMQVLKKYGVERFDPTGEPFDPNVHL 121

Query: 149 AMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           A+ E    + PA T+  V + GY ++ERVLRPA V++ K
Sbjct: 122 AVCEIADPSKPAGTVANVFKVGYLLHERVLRPAEVAVVK 160


>gi|24373098|ref|NP_717141.1| heat shock protein GrpE [Shewanella oneidensis MR-1]
 gi|52782945|sp|Q8EGS0|GRPE_SHEON RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|24347284|gb|AAN54585.1|AE015598_4 heat shock protein GrpE [Shewanella oneidensis MR-1]
          Length = 206

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 103/163 (63%), Gaps = 13/163 (7%)

Query: 35  ESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSA 94
           ++L + +E +D  +R  AE++N+RRR   + + A  +++ KFA ++L V DN+ RAL   
Sbjct: 48  DALAKVDEQKDSVIRAAAEVDNIRRRAAMDVEKANKFALEKFANELLPVLDNMERALQGT 107

Query: 95  -PLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
            P D            K++ EG+E+T++ +++ + ++GVK+ID + Q FNP+ HQA+  +
Sbjct: 108 NPQD---------ETTKAIYEGVELTQKSLLTAVAKFGVKQIDPQGQAFNPDQHQAIGMQ 158

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEE 196
           P    P NT++ V+Q GY +N R+LRPA+V +S+G    P++E
Sbjct: 159 PSAEFPTNTVMLVMQKGYELNSRLLRPAMVMVSQG---GPSQE 198


>gi|312375535|gb|EFR22892.1| hypothetical protein AND_14051 [Anopheles darlingi]
          Length = 160

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 95/144 (65%), Gaps = 3/144 (2%)

Query: 45  DKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKK 104
           DKY R +AE EN+RRR  ++ +DA+ + I  F +D+L V+D L  A ++ P +  +    
Sbjct: 20  DKYKRALAESENIRRRLTKQIEDAKQFGIQGFCKDLLEVADILGHATEAVPKEEVSDRNP 79

Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTII 164
               LK+L EG+ MTR ++ S   R+G++ ++  ++KFNPN+H+A+F++  + V  NT++
Sbjct: 80  H---LKNLFEGLSMTRAQLNSVFRRHGLEPVNPLNEKFNPNLHEALFQQEVENVEPNTVV 136

Query: 165 KVVQDGYAINERVLRPALVSISKG 188
            V + GY +++R +RPALV ++KG
Sbjct: 137 VVSKIGYKLHDRCIRPALVGVAKG 160


>gi|125563069|gb|EAZ08449.1| hypothetical protein OsI_30714 [Oryza sativa Indica Group]
          Length = 302

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 128/221 (57%), Gaps = 21/221 (9%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQS---------------EEFRDKYLR 49
           +S+K  ++ K+  NA + + E   ++++ +E L Q                 + +DK LR
Sbjct: 80  LSDKEENQRKDQENATNVSNEGTEDVDLSKEDLVQLVLEKDGLLKSKDEEINDMKDKVLR 139

Query: 50  VIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS-----APLDLANSEKK 104
             AEMEN+  RT RE ++++ Y++  F++ +L V+DNL+RA        + +D +     
Sbjct: 140 SYAEMENVIARTKRESENSKKYAVQNFSKSLLDVADNLTRASSVVKESFSKIDTSKDSTG 199

Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTII 164
           +  +LK+L+EG++MT +++    +++GV+K D  ++KF+P+ H A+F+ P    P+ T+ 
Sbjct: 200 AVPLLKTLLEGVDMTDKQLGEVFKKFGVEKFDPLNEKFDPSRHCAIFQIPDPLKPSGTVA 259

Query: 165 KVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQPS 205
            VV+ GY +++RVLRPA V +++G     TEE  E  EQ S
Sbjct: 260 SVVKVGYMLHDRVLRPAEVGVTEGGPTT-TEEAAENSEQKS 299


>gi|84501185|ref|ZP_00999390.1| co-chaperone GrpE [Oceanicola batsensis HTCC2597]
 gi|84390476|gb|EAQ02964.1| co-chaperone GrpE [Oceanicola batsensis HTCC2597]
          Length = 186

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 102/147 (69%), Gaps = 9/147 (6%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           +E +DK++R +A+ EN R+R D+++++A+ Y  +K ARD+L + DN+ RAL++A      
Sbjct: 43  DELKDKWMRALADAENSRKRADKQRREAELYGGSKLARDLLPIYDNMKRALEAA------ 96

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVP 159
            EK  E+   +LIEG+E+T RE+++T +++G++ I  +   +F+PN+H+AMFE P     
Sbjct: 97  GEKTDEN--SALIEGVELTMRELLNTFKKHGMEPISPEVGDRFDPNVHEAMFEAPVPGTK 154

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
           A  II+V  +G+ +++R+LRPA V +S
Sbjct: 155 AGDIIQVSAEGFWLSDRLLRPAQVGVS 181


>gi|332306630|ref|YP_004434481.1| GrpE protein [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332173959|gb|AEE23213.1| GrpE protein [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 204

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 100/145 (68%), Gaps = 8/145 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  +R IA+ +N+R+R + E   A+ +++ KFA ++L V+DNL RAL  A       +K
Sbjct: 59  KDSVMRAIADADNVRKRAEGEVDKARKFALEKFASELLPVADNLERALQVA-------DK 111

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           ++E++ K +IEG+E+T +  +S++E++G+K ID + + FNP  HQAM  + +  +PANT+
Sbjct: 112 ENEAI-KPVIEGVEITLKSFVSSIEKFGMKVIDPQGESFNPEQHQAMSMQENAELPANTV 170

Query: 164 IKVVQDGYAINERVLRPALVSISKG 188
           + V+Q GY +N R+LRPA+V +S+ 
Sbjct: 171 MAVMQKGYELNGRLLRPAMVMVSRA 195


>gi|53803854|ref|YP_114294.1| GrpE protein [Methylococcus capsulatus str. Bath]
 gi|81681775|sp|Q607A4|GRPE_METCA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|53757615|gb|AAU91906.1| GrpE protein [Methylococcus capsulatus str. Bath]
          Length = 185

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 96/154 (62%), Gaps = 8/154 (5%)

Query: 35  ESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSA 94
           E+  Q+ E  D+++R  AEMENLRRR +++ ++A  Y++ KFA+++L V D+L       
Sbjct: 40  EAQQQASENWDRFVRAQAEMENLRRRLEKDIQNAHKYALEKFAKELLPVMDSLE------ 93

Query: 95  PLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEP 154
            L +A S   +  V K L EG E+T ++  S  E++G+  +D   +KFNP  HQAM  EP
Sbjct: 94  -LGIAASTGDAPDVAK-LREGAELTLKQFKSVFEKFGIAVVDPLGEKFNPEQHQAMAMEP 151

Query: 155 HDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
                 NT++KV Q GY +N+R+LRPALV +++ 
Sbjct: 152 AGEAEPNTVVKVFQKGYLLNDRLLRPALVVVAQA 185


>gi|195131301|ref|XP_002010089.1| GI14884 [Drosophila mojavensis]
 gi|193908539|gb|EDW07406.1| GI14884 [Drosophila mojavensis]
          Length = 250

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 64/180 (35%), Positives = 111/180 (61%), Gaps = 9/180 (5%)

Query: 13  EKNPSNAN-SSTAEEKSEINIPEESLN----QSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           E+ PS+ + S      SE++   + L     + ++  DKY R +A+ ENLRRR +R+  +
Sbjct: 74  EQTPSHDDESKGGAAMSEVDWLTQELATIKVEHKQLLDKYKRALADGENLRRRLNRQIDE 133

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A+ + I  F +D++ V+D L  A  S P D    +  + + LKSL EG+ +TR  +    
Sbjct: 134 AKLFGIQGFCKDLIEVADVLGHATRSVPKD----KLSTNAELKSLYEGLNLTRASLQQVF 189

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +R+GV+ +D  +QKF+PN+H+A+F+    +V A+T+++V + GY +++R +RPALV +SK
Sbjct: 190 KRHGVEILDPINQKFDPNLHEALFQTVDKSVDADTVVQVNKLGYKLHKRCIRPALVGVSK 249


>gi|48525531|gb|AAT45013.1| GrpE2 [Saccharum hybrid cultivar SP80-3280]
          Length = 298

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 62/168 (36%), Positives = 107/168 (63%), Gaps = 10/168 (5%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS-----APL 96
           + +DK LR  AEMEN+  RT RE ++++ Y++  F++ +L V+DNL+RA        + +
Sbjct: 129 DMKDKVLRSYAEMENIIARTKRESENSKKYAVQNFSKSLLDVADNLARASSVVKESFSKI 188

Query: 97  DLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHD 156
           D +     +  +LK+L+EG++MT +++    +++GV+K D  ++KF+PN H A+F+ P  
Sbjct: 189 DASKDSAGAIPLLKTLLEGVDMTEKQLAEVFKKFGVEKFDPLNEKFDPNRHCAVFQIPDP 248

Query: 157 TVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQP 204
           + P  T+  VV+ GY +++RVLRPA V +++G   + TEE     EQP
Sbjct: 249 SKPPGTVASVVKVGYMLHDRVLRPAEVGVTEGGA-DATEEA----EQP 291


>gi|315497105|ref|YP_004085909.1| grpe protein [Asticcacaulis excentricus CB 48]
 gi|315415117|gb|ADU11758.1| GrpE protein [Asticcacaulis excentricus CB 48]
          Length = 198

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 93/149 (62%), Gaps = 8/149 (5%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            +++ LR  AE EN++RR +RE  DA++Y+I +F+RD+L V+D L RAL + P  +    
Sbjct: 34  LKEQALRYAAEAENVKRRAEREMNDARAYAIQRFSRDLLGVADVLQRALQAVPGQV---- 89

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKID-AKDQKFNPNMHQAMFEEPHDTVPAN 161
              +   K+ + GIEMT +E+    E+ GVKKI   K  KF+PN HQA+ E+P   V   
Sbjct: 90  --EDPAFKNFVSGIEMTEKELAGAFEKNGVKKIAPLKGDKFDPNFHQAVMEQPSTEVEGG 147

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGKT 190
           +++ V+Q GY +  R +RPA+V ++  KT
Sbjct: 148 SVLMVMQAGYELFGRTIRPAMV-VTAAKT 175


>gi|83594972|ref|YP_428724.1| GrpE protein [Rhodospirillum rubrum ATCC 11170]
 gi|83577886|gb|ABC24437.1| GrpE protein [Rhodospirillum rubrum ATCC 11170]
          Length = 221

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 98/146 (67%), Gaps = 4/146 (2%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            +++YLR +AE +N +R  D+  +D   Y+++ FA+ +L V+DNL RAL S P       
Sbjct: 59  LKEEYLRALAEAQNAKRMADKRIEDNSRYAVSNFAKAVLGVADNLGRALLSVP----EEA 114

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
           +    ++K+L  G+E+T +E+ + L +Y +++++A ++ F+P+ HQA+ E  +  VP  T
Sbjct: 115 RGGNEMVKNLAFGVELTAKELENALAQYQIRRVEALNEAFDPHFHQAVQEVENTAVPNAT 174

Query: 163 IIKVVQDGYAINERVLRPALVSISKG 188
           I+ V+QDGY I++R+LRPA+V +S+G
Sbjct: 175 IVSVLQDGYVIHDRLLRPAMVVVSRG 200


>gi|326529893|dbj|BAK08226.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 297

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 59/160 (36%), Positives = 105/160 (65%), Gaps = 8/160 (5%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS-----APL 96
           + +DK LR  AEMEN+  RT RE ++++ Y++  F++ +L V+DNL+RA        + L
Sbjct: 133 DMKDKVLRSYAEMENVIARTKRESENSKKYAVQNFSKSLLDVADNLARASSVVKESFSKL 192

Query: 97  DLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHD 156
           D +     +  +LK+L+EG++MT +++    +++GV+K D  ++KF+P+ H A+F+ P  
Sbjct: 193 DTSEDSSGAVPLLKTLLEGVDMTDKQLGEVFKKFGVEKFDPMNEKFDPDKHFALFQIPDP 252

Query: 157 TVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEE 196
           + P+ T+  VV+ GY +++RVLRPA V +++G    P+EE
Sbjct: 253 SKPSGTVASVVKVGYMLHDRVLRPAEVGVTEG---GPSEE 289


>gi|71280635|ref|YP_270486.1| co-chaperone GrpE [Colwellia psychrerythraea 34H]
 gi|123760978|sp|Q47XI4|GRPE_COLP3 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|71146375|gb|AAZ26848.1| co-chaperone GrpE [Colwellia psychrerythraea 34H]
          Length = 209

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 98/145 (67%), Gaps = 8/145 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  +R  AE++N+RRR  ++ + A+ +++ KFA +ML+  DNL RAL        N +K
Sbjct: 65  KDSVIRAKAEVDNIRRRAAQDVEKARKFALEKFAGEMLTSVDNLERALQ-------NIDK 117

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           + ES  K +IEG+E+T + ++++L+++GVK +D +DQ FNP +HQAM  +    V  NT+
Sbjct: 118 EDESN-KGVIEGVELTLQGLITSLDKFGVKAVDPQDQPFNPELHQAMSMQEVPGVAPNTV 176

Query: 164 IKVVQDGYAINERVLRPALVSISKG 188
           I V+Q GY +N R++RPA+V +SK 
Sbjct: 177 IAVMQKGYELNGRLIRPAMVMVSKA 201


>gi|157106034|ref|XP_001649137.1| hypothetical protein AaeL_AAEL004438 [Aedes aegypti]
 gi|108879963|gb|EAT44188.1| conserved hypothetical protein [Aedes aegypti]
          Length = 226

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 60/155 (38%), Positives = 103/155 (66%), Gaps = 4/155 (2%)

Query: 35  ESLNQS-EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           +SLN+  +E  DKY R +A+ EN+RRR  ++ +DA+ + I  F +D+L V+D L  A ++
Sbjct: 75  DSLNEKVKELDDKYKRALADGENMRRRLTKQIEDAKLFGIQGFCKDLLEVADILGHATEA 134

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
            P +   S+K     LK+L EG+ MT+ ++    +R+G++ ++  ++KFNPN+H+A+F++
Sbjct: 135 VPKE-EISDKNPH--LKNLYEGLTMTKAQLNQVFKRHGLETVNPLNEKFNPNLHEALFQQ 191

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
               V  NT++ V + GY ++ER +RPALV +SKG
Sbjct: 192 EVQNVEPNTVVVVSKIGYKLHERCIRPALVGVSKG 226


>gi|237809002|ref|YP_002893442.1| heat shock protein GrpE [Tolumonas auensis DSM 9187]
 gi|237501263|gb|ACQ93856.1| GrpE protein [Tolumonas auensis DSM 9187]
          Length = 197

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 101/155 (65%), Gaps = 8/155 (5%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           E++ + + E +D+ LR +AEMENLRRRT  + + A  +++ KF  ++L V DNL R +  
Sbjct: 44  EQASSIAAEEKDRALRTVAEMENLRRRTALDVEKAHKFALEKFVTELLPVLDNLERTIQV 103

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
           A       +K++++V K L+EG+E+T + M +++ ++GV  +D + Q F+PN HQAM   
Sbjct: 104 A-------DKQNDAV-KPLLEGVELTLKSMANSVAKFGVIALDPQGQAFDPNQHQAMSMI 155

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
            +  V  NT+I V+Q GY +N RV+RPA+V +SK 
Sbjct: 156 ENGDVAPNTVIAVMQKGYELNGRVIRPAMVMVSKA 190


>gi|195440246|ref|XP_002067953.1| GK11616 [Drosophila willistoni]
 gi|194164038|gb|EDW78939.1| GK11616 [Drosophila willistoni]
          Length = 223

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 58/150 (38%), Positives = 96/150 (64%), Gaps = 6/150 (4%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           Q  +  DKY R +AE EN+R R +++  DA+ + I  F RD+L V+D L  A  + P D 
Sbjct: 79  QHSDLLDKYRRSLAETENMRARLNKQIADAKMFGIQVFCRDLLDVADTLGHATQAVPKD- 137

Query: 99  ANSEKKSESV-LKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
               K ++++ LK+L EG+ MT+  ++   +R+G++  +  ++KFNPN+H+A+FE     
Sbjct: 138 ----KLADNLDLKNLFEGLSMTKACLLQVFKRHGLEPFNPINEKFNPNLHEALFEIEDKN 193

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISK 187
           V ANTI+ V + GY +++R +RPALV ++K
Sbjct: 194 VDANTIVDVTKLGYILHKRCIRPALVGVAK 223


>gi|95931198|ref|ZP_01313920.1| GrpE protein [Desulfuromonas acetoxidans DSM 684]
 gi|95132760|gb|EAT14437.1| GrpE protein [Desulfuromonas acetoxidans DSM 684]
          Length = 202

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 62/165 (37%), Positives = 102/165 (61%), Gaps = 8/165 (4%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           E+S N+ E+ +++YLR  AEMEN RRR  REK++   ++     R++L V DNL RA+  
Sbjct: 46  EQSRNEVEQQKEQYLRTRAEMENFRRRMQREKEELSKFANESILREILPVIDNLERAVCH 105

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
           A        +++E+   SL++G+EMT  +    LE++ V  +DA+ + F+P+ H+AM ++
Sbjct: 106 A--------RENEADASSLLDGVEMTLSQFQKVLEKFNVIPVDAQGKPFDPSCHEAMGQQ 157

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKK 198
            +     NT+++V+Q GY +N+R+LRPALV +SK       E  K
Sbjct: 158 ENADCEPNTVVQVLQSGYMLNDRLLRPALVMVSKAAASQEAEADK 202


>gi|149912898|ref|ZP_01901432.1| GrpE protein HSP-70 cofactor, putative [Roseobacter sp. AzwK-3b]
 gi|149813304|gb|EDM73130.1| GrpE protein HSP-70 cofactor, putative [Roseobacter sp. AzwK-3b]
          Length = 186

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 62/178 (34%), Positives = 114/178 (64%), Gaps = 9/178 (5%)

Query: 11  DKEKNPSNANSSTAEEKSEINIPEESLN-QSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
           D E+  +  ++   EE S+ +   E+L  + +  +DK++R +A+ EN R+R+D+++++A+
Sbjct: 12  DIEQAEAEEHALANEEISDTDAEIETLRAERDALQDKFMRALADAENARKRSDKDRREAE 71

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
           +Y  +K ARDML V DN+ RAL++A        ++ + V  +L+EG+E+T RE+++   R
Sbjct: 72  NYGGSKLARDMLPVYDNMKRALEAAT-------EEQKQVSAALLEGVELTMRELLNVFSR 124

Query: 130 YGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           +G+ +I  +   +F+P  H+AMFE P     A  II+V  +G+ +++R+LRPA V +S
Sbjct: 125 HGITRISPEVGDRFDPQQHEAMFEAPLPGTKAGDIIQVSTEGFMLHDRILRPAQVGVS 182


>gi|224116576|ref|XP_002317335.1| predicted protein [Populus trichocarpa]
 gi|222860400|gb|EEE97947.1| predicted protein [Populus trichocarpa]
          Length = 244

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 98/153 (64%), Gaps = 5/153 (3%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRA-----LDSAP 95
           E  +DK LR  AEMEN++ RT RE ++++ ++I  FA+ +L V+DNL RA      + + 
Sbjct: 88  ETMQDKVLRTYAEMENVKERTKREAENSKKFAIQNFAKSLLDVADNLGRASSVVKGNFSK 147

Query: 96  LDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPH 155
           ++++N       +LK+L+EG+EMT +++    ++YGV+K D  ++ F+P+ H AMFE P 
Sbjct: 148 INVSNDAADVVPLLKTLLEGVEMTEKQLGEVFKKYGVEKFDPINEPFDPHRHNAMFEVPD 207

Query: 156 DTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
              P   +  V++ GY ++ERV+RPA V +++ 
Sbjct: 208 PLKPPGIVAAVLKVGYMLHERVIRPAEVGVTRA 240


>gi|149204368|ref|ZP_01881335.1| GrpE protein [Roseovarius sp. TM1035]
 gi|149142253|gb|EDM30300.1| GrpE protein [Roseovarius sp. TM1035]
          Length = 186

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 97/145 (66%), Gaps = 8/145 (5%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            RDK++R +A+ EN R+R+++++++A++Y  +K ARDML V DNL RAL++      N E
Sbjct: 45  LRDKFMRALADAENARKRSEKDRREAENYGGSKLARDMLPVHDNLKRALET-----VNEE 99

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPAN 161
           +++ S   +L EGIE+T RE+++   ++G+  ID +   +F+P  H+AMFE P     A 
Sbjct: 100 QRAASA--ALFEGIELTLRELLNVFTKHGITVIDPQVGDRFDPQHHEAMFEAPLPGTKAG 157

Query: 162 TIIKVVQDGYAINERVLRPALVSIS 186
            II+V   G+ +++R+LRPA V +S
Sbjct: 158 EIIQVSTQGFMLHDRILRPAQVGVS 182


>gi|89052699|ref|YP_508150.1| GrpE protein [Jannaschia sp. CCS1]
 gi|88862248|gb|ABD53125.1| GrpE protein [Jannaschia sp. CCS1]
          Length = 188

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 112/179 (62%), Gaps = 19/179 (10%)

Query: 20  NSSTAEEKSEINIPEESLNQSE-----------EFRDKYLRVIAEMENLRRRTDREKKDA 68
            ++ A++K+++++  E ++ ++           E RD+ LR +AE EN+R+R DR++++A
Sbjct: 12  QTADAQDKADVSLAPEDMSGTDAVIEALEAERDELRDRMLRAMAEAENMRKRADRDRREA 71

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
           + Y  +K +RD+L V DN+ RALD+A  D A  E  S      L+EG+E+T RE++S   
Sbjct: 72  EQYGGSKLSRDLLPVYDNMRRALDAA--DDATREAAS-----GLVEGVELTMRELISIFG 124

Query: 129 RYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           ++G+  +  +  ++FN   H+AMFE P     A  II+V+ +G+ +++R+LRPA V +S
Sbjct: 125 KHGIVPVVPEVGERFNAQEHEAMFEAPVPGTKAGDIIQVMSEGFLLHDRLLRPAQVGVS 183


>gi|262277779|ref|ZP_06055572.1| co-chaperone GrpE [alpha proteobacterium HIMB114]
 gi|262224882|gb|EEY75341.1| co-chaperone GrpE [alpha proteobacterium HIMB114]
          Length = 193

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 70/176 (39%), Positives = 110/176 (62%), Gaps = 10/176 (5%)

Query: 13  EKNPSNANSST-AEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
           E+N  + + ST A+E  E NI E+ LN   +  DKYLR++AE +NLR+  ++EK+D   Y
Sbjct: 23  EENSKDEDHSTEAKENLEYNI-EDKLN---DLNDKYLRLLAENQNLRKNHEQEKEDILKY 78

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
               FA+ +L ++DNL RA         N EK      K+++ GIEM  +E+ STLE+  
Sbjct: 79  GSFSFAQQILGLTDNLDRAFQI----FKNDEKFKTDEFKNILSGIEMIEKELQSTLEKNS 134

Query: 132 VKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +K ID  D+ F+PN+HQA+ E+  D     T+++ +Q GY +++R+LRP++V +SK
Sbjct: 135 IKYIDCLDKPFDPNLHQAIGEKESDKSQG-TVVEEMQKGYQMHDRLLRPSMVYVSK 189


>gi|4455201|emb|CAB36524.1| grpE like protein [Arabidopsis thaliana]
 gi|7269530|emb|CAB79533.1| grpE like protein [Arabidopsis thaliana]
          Length = 311

 Score =  121 bits (304), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 59/164 (35%), Positives = 102/164 (62%), Gaps = 7/164 (4%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS-----APL 96
           + +DK LR  AEMEN+  RT R+ ++ + Y++  FA+ +L V+DNL RA        + L
Sbjct: 148 QLKDKVLRTYAEMENVMDRTRRDAENTKKYAVQNFAKSLLDVADNLGRASSVVKESFSKL 207

Query: 97  DLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHD 156
           D +     +  +LK+L+EG+EMT +++    +++G++K D  ++ F+PN H A+F+ P  
Sbjct: 208 DTSEDSAGAAPLLKTLLEGVEMTEKQLAEVFKKFGMEKYDPINEPFDPNRHNAVFQVPDA 267

Query: 157 TVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKET 200
           + P  T+  V++ GY + +RV+RPA V +++G      EEKKE+
Sbjct: 268 SKPEGTVAHVLKSGYTLYDRVIRPAEVGVTQGGENQ--EEKKES 309


>gi|310794497|gb|EFQ29958.1| GrpE protein [Glomerella graminicola M1.001]
          Length = 235

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 60/151 (39%), Positives = 96/151 (63%), Gaps = 2/151 (1%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           ++ +++DK LR +A+  NL+ RT RE K A+ +++ KFA+D++   DNL RAL   P D 
Sbjct: 83  EAADWKDKCLRTVADFRNLQDRTQREVKQARDFALQKFAKDLIDSIDNLDRALSMVPKDK 142

Query: 99  ANSEKKSESV--LKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHD 156
            N+ +K+  +  L +L EG++MT   +MSTL+++G+++ D + +KFNPN H A F  P  
Sbjct: 143 INAPEKTGDLQDLANLYEGLKMTDDILMSTLKKHGIERFDPEGEKFNPNEHDATFMAPQP 202

Query: 157 TVPANTIIKVVQDGYAINERVLRPALVSISK 187
               NT+  V Q G+ +N RV+R A V + K
Sbjct: 203 DKEDNTVFHVQQKGFKLNGRVMRAAKVGVVK 233


>gi|332993770|gb|AEF03825.1| heat shock protein GrpE [Alteromonas sp. SN2]
          Length = 206

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 119/192 (61%), Gaps = 17/192 (8%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSE----EFRDKYLRVIAEMENL 57
           ET    + I +E++   A S   +   E+   E +L++++    E +D  LR  A++EN 
Sbjct: 18  ETVQDAEVIQEEQSSPEAGSDATQRIYEL---ETALSEAQATIKEQQDSVLRARADVENA 74

Query: 58  RRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIE 117
           RRR + E + A+ +++ +FA ++L V DNL RA++     L + E ++   +K L+EG+E
Sbjct: 75  RRRAEMEVEKARKFALERFAGELLPVVDNLERAIE-----LTDGENEA---VKPLLEGVE 126

Query: 118 MTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANTIIKVVQDGYAINER 176
           MT +  +ST+E++G+  ID + + FNP++HQAM  +E  D  P NT++ V+Q GY IN R
Sbjct: 127 MTHKSFLSTIEKFGLSLIDPQGETFNPDLHQAMSMQESADHAP-NTVMAVMQKGYQINGR 185

Query: 177 VLRPALVSISKG 188
           +LRPA+V +S+ 
Sbjct: 186 LLRPAMVMVSRA 197


>gi|260576119|ref|ZP_05844112.1| GrpE protein [Rhodobacter sp. SW2]
 gi|259021599|gb|EEW24902.1| GrpE protein [Rhodobacter sp. SW2]
          Length = 186

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 96/147 (65%), Gaps = 8/147 (5%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           +E RD+++R +A+ EN R+R +R++++A+ Y   + ARDML V DNL RA     LD+ +
Sbjct: 41  DELRDRFMRALADAENARKRGERDRREAEQYGGTRLARDMLPVYDNLRRA-----LDVIS 95

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID-AKDQKFNPNMHQAMFEEPHDTVP 159
            E++  S   +L+EGIE+T REM + L ++GV  I  A    F+P  HQAMFE P     
Sbjct: 96  EEQREGSA--ALVEGIELTLREMQNVLTKHGVTVIAPAIGDVFDPQRHQAMFEAPVAGTK 153

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
           A  II+V+ +G+ +++R+LRPA V +S
Sbjct: 154 AGQIIQVMTEGFLLHDRLLRPAQVGVS 180


>gi|18416821|ref|NP_567757.1| AR192; adenyl-nucleotide exchange factor/ chaperone binding /
           protein binding / protein homodimerization [Arabidopsis
           thaliana]
 gi|21593024|gb|AAM64973.1| grpE like protein [Arabidopsis thaliana]
 gi|26451456|dbj|BAC42827.1| putative grpE protein [Arabidopsis thaliana]
 gi|29824143|gb|AAP04032.1| putative grpE protein [Arabidopsis thaliana]
 gi|332659851|gb|AEE85251.1| molecular chaperone GrpE [Arabidopsis thaliana]
          Length = 327

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 59/165 (35%), Positives = 103/165 (62%), Gaps = 7/165 (4%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS-----AP 95
           ++ +DK LR  AEMEN+  RT R+ ++ + Y++  FA+ +L V+DNL RA        + 
Sbjct: 163 KQLKDKVLRTYAEMENVMDRTRRDAENTKKYAVQNFAKSLLDVADNLGRASSVVKESFSK 222

Query: 96  LDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPH 155
           LD +     +  +LK+L+EG+EMT +++    +++G++K D  ++ F+PN H A+F+ P 
Sbjct: 223 LDTSEDSAGAAPLLKTLLEGVEMTEKQLAEVFKKFGMEKYDPINEPFDPNRHNAVFQVPD 282

Query: 156 DTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKET 200
            + P  T+  V++ GY + +RV+RPA V +++G      EEKKE+
Sbjct: 283 ASKPEGTVAHVLKSGYTLYDRVIRPAEVGVTQGGENQ--EEKKES 325


>gi|255580752|ref|XP_002531197.1| Protein grpE, putative [Ricinus communis]
 gi|223529199|gb|EEF31174.1| Protein grpE, putative [Ricinus communis]
          Length = 308

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 59/152 (38%), Positives = 99/152 (65%), Gaps = 5/152 (3%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRAL----DS-AP 95
           E+ +DK LR  AEMEN+  RT RE ++++ ++I  FA+ +L V+DNL RA     DS + 
Sbjct: 147 EKMQDKVLRTYAEMENVMERTKREAENSRKFAIQNFAKGLLDVADNLGRASSVVKDSYSK 206

Query: 96  LDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPH 155
           +D +     +  +LK+L+EG+EMT +++     + GV+K D +D+ F+P+ H A+FE P 
Sbjct: 207 IDTSTDTAGAVPLLKTLLEGVEMTEKQLAEVFRKSGVEKYDPRDEPFDPHRHNAVFEVPD 266

Query: 156 DTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            + P  T+  V++ GY +++RV+RPA V ++K
Sbjct: 267 SSKPPGTVAVVLKAGYLLHDRVIRPAEVGVTK 298


>gi|242010313|ref|XP_002425913.1| grpe protein, putative [Pediculus humanus corporis]
 gi|212509889|gb|EEB13175.1| grpe protein, putative [Pediculus humanus corporis]
          Length = 239

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 60/154 (38%), Positives = 98/154 (63%), Gaps = 3/154 (1%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           E + N++  F DKY R +AE ENLR R  ++ +DA+ + I  F +D+L VSD L RA +S
Sbjct: 86  EAATNKAATFEDKYKRSLAEGENLRLRLTKQIEDAKLFGIQSFCKDLLEVSDILQRATES 145

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
            P +    +      LK+L EG+ MT  ++ +   R+G+  ++  ++KF+PN+H+A+F++
Sbjct: 146 VPKEEITDKNPH---LKNLFEGLTMTEAQLQNVFRRHGLVPVNPLNEKFDPNLHEALFQQ 202

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
             +   A TI+ V + GY ++ERV+RPALV I+K
Sbjct: 203 EVEGKEAGTIVVVSKIGYKLHERVIRPALVGIAK 236


>gi|127513700|ref|YP_001094897.1| GrpE protein [Shewanella loihica PV-4]
 gi|166215284|sp|A3QGP0|GRPE_SHELP RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|126638995|gb|ABO24638.1| GrpE protein [Shewanella loihica PV-4]
          Length = 205

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 97/148 (65%), Gaps = 8/148 (5%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           EE +D  +R  AE+EN+RRR   + + A  +++ KFA ++L V DN+ RAL        +
Sbjct: 58  EEQKDSVIRAAAEVENVRRRAAIDVEKAHKFALEKFANELLPVIDNMERALQGT-----S 112

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
           SE ++    K++ EG+E+T +   S + ++G+ ++D + + FNP+ HQA+  +P +  PA
Sbjct: 113 SEDEA---TKAIYEGVELTLKTFTSAVAKFGLTQVDPQGEAFNPDHHQAIGMQPSEEFPA 169

Query: 161 NTIIKVVQDGYAINERVLRPALVSISKG 188
           NT++ V+Q GY +NER+LRPA+V +S+G
Sbjct: 170 NTVMMVMQKGYMLNERLLRPAMVMVSQG 197


>gi|109898303|ref|YP_661558.1| GrpE protein [Pseudoalteromonas atlantica T6c]
 gi|123360844|sp|Q15UD4|GRPE_PSEA6 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|109700584|gb|ABG40504.1| GrpE protein [Pseudoalteromonas atlantica T6c]
          Length = 204

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 100/145 (68%), Gaps = 8/145 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  +R IA+ +N+R+R + E   A+ +++ KFA ++L V+DNL RAL  A       +K
Sbjct: 59  KDSVMRAIADADNVRKRAEGEVDKARKFALEKFASELLPVADNLERALQVA-------DK 111

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           ++E++ K +IEG+++T +  +S++E++G+K ID + + FNP  HQAM  + +  +PANT+
Sbjct: 112 ENEAI-KPVIEGVDITLKSFVSSIEKFGMKVIDPQGETFNPEQHQAMSMQENAELPANTV 170

Query: 164 IKVVQDGYAINERVLRPALVSISKG 188
           + V+Q GY +N R+LRPA+V +S+ 
Sbjct: 171 MAVMQKGYELNGRLLRPAMVMVSRA 195


>gi|114797336|ref|YP_761991.1| co-chaperone GrpE [Hyphomonas neptunium ATCC 15444]
 gi|123027612|sp|Q0BX02|GRPE_HYPNA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|114737510|gb|ABI75635.1| co-chaperone GrpE [Hyphomonas neptunium ATCC 15444]
          Length = 188

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 102/149 (68%), Gaps = 7/149 (4%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           +   + LR++A+++N R+R DR+  +A+ Y+I KFA D+LSVSDNLSRALD+ P    +S
Sbjct: 42  DMNGQILRLLADLDNTRKRADRQVSEARIYAIEKFAADLLSVSDNLSRALDALP----DS 97

Query: 102 EKKSES-VLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQK-FNPNMHQAMFEEPHDTVP 159
           E+++ +   K+L+ GIEMT +E+ + L R+GV  + A+    F+PN+HQA+ + P    P
Sbjct: 98  ERENLTDAGKNLLGGIEMTAKELNTALSRHGVVPVPAEPGAVFDPNVHQAVAQIPSPQ-P 156

Query: 160 ANTIIKVVQDGYAINERVLRPALVSISKG 188
           + TI ++ Q G+ I +R LR A+V++S G
Sbjct: 157 SGTIAQLFQPGWKIGDRTLRAAMVAVSTG 185


>gi|89072618|ref|ZP_01159190.1| putative heat shock protein GrpE [Photobacterium sp. SKA34]
 gi|89051722|gb|EAR57175.1| putative heat shock protein GrpE [Photobacterium sp. SKA34]
          Length = 204

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 63/155 (40%), Positives = 99/155 (63%), Gaps = 10/155 (6%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           Q+ E +D  LR  AE EN+RRR+++E   A+ Y++ KFA ++L V DNL RAL+ A    
Sbjct: 54  QANEAKDAALRARAEGENIRRRSEQEIDKARKYALNKFAEELLPVIDNLERALEMA---- 109

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDT 157
                K++   K+++EG+E+T + M  T+ ++G+ +I+ + + FNP  HQAM  +E  D 
Sbjct: 110 ----DKTDESSKAMMEGVELTLKTMTDTVAKFGLAQINPQGEAFNPEFHQAMAIQESTDF 165

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISKGKTQN 192
            P NT++ V+Q GY +N RV+RPA+V +SK    N
Sbjct: 166 AP-NTVMMVMQKGYELNGRVIRPAMVMVSKAAAGN 199


>gi|114762205|ref|ZP_01441673.1| co-chaperone GrpE [Pelagibaca bermudensis HTCC2601]
 gi|114545229|gb|EAU48232.1| co-chaperone GrpE [Roseovarius sp. HTCC2601]
          Length = 185

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 94/147 (63%), Gaps = 10/147 (6%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           +EF+D+++R +A+ EN R+R D+++++AQ Y  ++ ARD+L V DNL RAL  A      
Sbjct: 43  DEFKDRFMRALADAENARKRADKDRREAQQYGGSRLARDLLPVYDNLHRALGVA------ 96

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVP 159
              + E+   +LIEGIE+T RE+ +T  ++G+  I  +   KF+P  H+AMFE P     
Sbjct: 97  ---REENAADALIEGIELTLRELTNTFSKHGMTTISPQVGDKFDPQQHEAMFEAPVPGTK 153

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
           A  II+V  +G+ + +R+LRPA V +S
Sbjct: 154 AGEIIQVSAEGFYLYDRLLRPAQVGVS 180


>gi|145642157|ref|ZP_01797726.1| heat shock protein [Haemophilus influenzae R3021]
 gi|145273148|gb|EDK13025.1| heat shock protein [Haemophilus influenzae 22.4-21]
          Length = 198

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 98/143 (68%), Gaps = 7/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+ENLRRRT+++ + A  +++ KF++D+L+  DNL RAL + P   AN E 
Sbjct: 62  QDILLRSRAEIENLRRRTEQDVEKAHKFAVEKFSKDILNTIDNLERAL-ATP---ANKED 117

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           +S   +K+L +G+E+T +E++ST+ R+GV+ +    + FNP++HQA+  +P +    N I
Sbjct: 118 ES---VKALFDGVELTLKELVSTVGRFGVETVGVVGETFNPDLHQAISMQPAEGFETNQI 174

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY +N RV+RPA+V ++
Sbjct: 175 SVVLQKGYTLNGRVIRPAMVMVA 197


>gi|328770994|gb|EGF81035.1| hypothetical protein BATDEDRAFT_24663 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 199

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 109/180 (60%), Gaps = 7/180 (3%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           N  +  +P+ +  ++  E + I    E   Q  + +D Y R +A+ EN+R+RT +E  + 
Sbjct: 20  NAAESNDPNPSTETSTPEDAHIKALAEKDAQIAQLQDMYRRALADAENVRQRTRKEIDEK 79

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
           QSY+I KFA+++L+ +D L+ ALDS P     SEK + S LK L  G+ MTR E++ T +
Sbjct: 80  QSYAIQKFAKELLNTADILTMALDSVPA-AERSEKSTNSHLKDLYTGVSMTRVELLKTFK 138

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA---NTIIKVVQDGYAINERVLRPALVSI 185
           ++GV+  +   +KF+ N+HQA+F+    +VP      + +V + GY +++RVLRPA V +
Sbjct: 139 QFGVESYNPDGEKFDHNLHQALFQA---SVPGKEPGVVFQVTKVGYKLHDRVLRPAQVGV 195


>gi|302381324|ref|YP_003817147.1| GrpE protein [Brevundimonas subvibrioides ATCC 15264]
 gi|302191952|gb|ADK99523.1| GrpE protein [Brevundimonas subvibrioides ATCC 15264]
          Length = 209

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 97/156 (62%), Gaps = 12/156 (7%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
           ++D+ +R  AE +N++RRT+ +  DA++++I +FA+D+L V+DNL RAL +AP       
Sbjct: 45  WKDRAMRAAAEADNVKRRTETQMNDARAFAIQRFAKDLLGVADNLERALMAAP------- 97

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKID-AKDQKFNPNMHQAMFEEPHDTVPAN 161
           K ++S    LI G+E+T++ ++   E  G+K++       F+P++HQAM E+P    P  
Sbjct: 98  KDADSAAAGLINGLELTQKSLLQAFETNGLKRLAPGLGDAFDPHLHQAMMEQPSTEAPGG 157

Query: 162 TIIKVVQDGYAINERVLRPALVSI----SKGKTQNP 193
           T+++ +Q GY +  R +RPA+V +    S  +  NP
Sbjct: 158 TVLQTMQAGYELFGRTVRPAMVVVAAKGSGAQGANP 193


>gi|90581508|ref|ZP_01237301.1| putative heat shock protein GrpE [Vibrio angustum S14]
 gi|90437270|gb|EAS62468.1| putative heat shock protein GrpE [Vibrio angustum S14]
          Length = 204

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 63/155 (40%), Positives = 99/155 (63%), Gaps = 10/155 (6%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           Q+ E +D  LR  AE EN+RRR+++E   A+ Y++ KFA ++L V DNL RAL+ A    
Sbjct: 54  QANEAKDAALRARAEGENVRRRSEQEIDKARKYALNKFAEELLPVIDNLERALEMA---- 109

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDT 157
                K++   K+++EG+E+T + M  T+ ++G+ +I+ + + FNP  HQAM  +E  D 
Sbjct: 110 ----DKTDESSKAMMEGVELTLKTMTDTVAKFGLTQINPQGEAFNPEFHQAMAIQESTDF 165

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISKGKTQN 192
            P NT++ V+Q GY +N RV+RPA+V +SK    N
Sbjct: 166 AP-NTVMMVMQKGYELNGRVIRPAMVMVSKAAAGN 199


>gi|289615068|emb|CBI58138.1| unnamed protein product [Sordaria macrospora]
          Length = 214

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 61/149 (40%), Positives = 93/149 (62%), Gaps = 2/149 (1%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            +DK LR +A+  NL+ RT R+ K A+ ++I KFA+D++   DN  RAL   P +   SE
Sbjct: 66  LQDKCLRTVADFRNLQERTARDVKQAKDFAIQKFAKDLVESVDNFDRALSVVPKEKLKSE 125

Query: 103 KKSESV--LKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
           +KSE +  L +L EG++MT   ++ TL+++G+++ID   + FNPN H+A F  P      
Sbjct: 126 EKSEHLNDLVNLYEGLKMTENILLQTLKKHGLERIDPDGEVFNPNEHEATFMAPMPDKEH 185

Query: 161 NTIIKVVQDGYAINERVLRPALVSISKGK 189
           NT+  + Q G+ +N RVLRPA V + K K
Sbjct: 186 NTVFHIQQKGFKLNGRVLRPAQVGVVKNK 214


>gi|254512466|ref|ZP_05124533.1| co-chaperone GrpE [Rhodobacteraceae bacterium KLH11]
 gi|221536177|gb|EEE39165.1| co-chaperone GrpE [Rhodobacteraceae bacterium KLH11]
          Length = 187

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 97/147 (65%), Gaps = 8/147 (5%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           ++F+DK++R +A+ EN R+R D+ ++DA+ Y  +K ARDML V DN+ RAL++     A 
Sbjct: 43  DDFKDKFMRALADAENARKRGDKARRDAEQYGGSKLARDMLPVYDNMKRALEA-----AT 97

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVP 159
            E+K   V   L+EG+E+T R +    +++G++ I  +   +F+PN+H+AMFE P     
Sbjct: 98  DEQK--EVAAGLLEGVELTMRALKDVFQKHGIEVITPEVGDRFDPNVHEAMFEAPVPGTR 155

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
           A  II+V  +G+ +++R+LRPA V +S
Sbjct: 156 AGDIIQVSAEGFMLHDRLLRPAQVGVS 182


>gi|48525529|gb|AAT45012.1| GrpE1 [Saccharum hybrid cultivar SP80-3280]
          Length = 294

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 64/161 (39%), Positives = 106/161 (65%), Gaps = 9/161 (5%)

Query: 34  EESL-NQSEEFRD---KYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSR 89
           +ESL ++ EEF+D   K LR  AEMEN+  RT RE ++ + Y+I  F++ +L V+DNLSR
Sbjct: 119 DESLKSKDEEFKDMKDKVLRSYAEMENVLARTKRESENTKKYAIQSFSKSLLDVADNLSR 178

Query: 90  ALDS-----APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNP 144
           A        + +D +N+  ++  +LK+L+EG+EMT +++    +++GV+K D  ++KF+P
Sbjct: 179 ASSVVKESFSKIDSSNNFDEAVPLLKTLLEGVEMTEKQLGEVFKKFGVEKFDPLNEKFDP 238

Query: 145 NMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
           N H A F+    + P+ T+  VV+ GY +++RVLRPA V +
Sbjct: 239 NRHYAFFQIHDPSKPSGTVAAVVKVGYMLHDRVLRPAEVGV 279


>gi|213408729|ref|XP_002175135.1| grpE [Schizosaccharomyces japonicus yFS275]
 gi|212003182|gb|EEB08842.1| grpE [Schizosaccharomyces japonicus yFS275]
          Length = 216

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 61/175 (34%), Positives = 106/175 (60%), Gaps = 5/175 (2%)

Query: 18  NANSSTAEEKSEINIPEESLNQSE----EFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
           + ++++A   SE+ + +E + + +    E +D++LR +A+  NL +R +RE K A+ +++
Sbjct: 41  DGSATSAASGSEVEVLKEQVAKKDKEISELKDQFLRQVADYRNLEKRVERETKQARDFAL 100

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
            K A+D+L   DNL RAL+  P ++ N + K+ S L  L +G+ MT   +M TL ++G+K
Sbjct: 101 QKLAKDLLESLDNLERALEIVPEEMRN-DTKNHSELAELYKGLSMTEEILMKTLNKHGLK 159

Query: 134 KIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           + D   + FNPN+H+A+F  P      NT+      G+ +N RV+RPA V + KG
Sbjct: 160 RYDGVGEHFNPNLHEAVFFVPVPDKEPNTVFHCESKGFDLNGRVIRPAKVGVVKG 214


>gi|296533452|ref|ZP_06896035.1| co-chaperone GrpE [Roseomonas cervicalis ATCC 49957]
 gi|296266232|gb|EFH12274.1| co-chaperone GrpE [Roseomonas cervicalis ATCC 49957]
          Length = 199

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 66/190 (34%), Positives = 109/190 (57%), Gaps = 12/190 (6%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEF-------RDKYLRVIAEMENL 57
           M+EK      +PSN  +   E +     P ++L +  E        +D++LR  AEM+NL
Sbjct: 6   MTEKIDSDMTDPSNPTAPHPETQPTPEQPADALARLAELEAENAQLKDRWLRSEAEMQNL 65

Query: 58  RRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIE 117
           R RT RE ++A+++++ KFARD++  ++NL R LD+ P     +++    +L  L  G E
Sbjct: 66  RTRTKREVEEARAFAVQKFARDVVEAAENLRRGLDALP----PAQEGEAELLTKLRGGFE 121

Query: 118 MTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE-PHDTVPANTIIKVVQDGYAINER 176
              R  +S LER GV K DA  + F+P +HQAM ++ P + V A T+I+     + +N R
Sbjct: 122 GVERAFLSILERNGVSKQDATGKPFDPELHQAMAQQPPPEGVAAGTVIQAWTPAWTLNGR 181

Query: 177 VLRPALVSIS 186
           +L+PA+V ++
Sbjct: 182 LLKPAMVVVA 191


>gi|33152198|ref|NP_873551.1| HSP-70 cofactor [Haemophilus ducreyi 35000HP]
 gi|52782916|sp|Q7VMB7|GRPE_HAEDU RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|33148420|gb|AAP95940.1| heat shock protein GrpE [Haemophilus ducreyi 35000HP]
          Length = 198

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 98/143 (68%), Gaps = 6/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE++N+RRRT+++ + A  +++ KFA+++L+V DNL R L    LD A +++
Sbjct: 61  QDIQLRAQAEIQNIRRRTEQDIEKAHKFALEKFAKELLTVVDNLERGL--VALDTAVTDE 118

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           K+    ++L++G+EMT +E +STL ++G++ I      FNP +HQA+  +P + + AN +
Sbjct: 119 KT----QALVDGVEMTHKEFVSTLAKFGIEAIGEIGDVFNPELHQAISMQPAENIEANHL 174

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
            +V+Q GY +  RV+RPA+V ++
Sbjct: 175 SQVLQKGYTLQGRVIRPAMVMVA 197


>gi|163737984|ref|ZP_02145400.1| DNA mismatch repair protein [Phaeobacter gallaeciensis BS107]
 gi|163742620|ref|ZP_02150006.1| co-chaperone GrpE [Phaeobacter gallaeciensis 2.10]
 gi|161384205|gb|EDQ08588.1| co-chaperone GrpE [Phaeobacter gallaeciensis 2.10]
 gi|161388600|gb|EDQ12953.1| DNA mismatch repair protein [Phaeobacter gallaeciensis BS107]
          Length = 187

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 62/168 (36%), Positives = 110/168 (65%), Gaps = 9/168 (5%)

Query: 21  SSTAEEKSEINIPEESLN-QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARD 79
           S+  EE  +  +  +SL  + +E +D+++R +A+ EN R+R D+ +++A+ Y  +K ARD
Sbjct: 22  SAQTEEFDDAALELDSLRAERDELKDRFMRALADAENARKRGDKARREAEQYGGSKLARD 81

Query: 80  MLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK- 138
           ML V DN+ RA+++A      S+++ E V  +LIEG+E+T R ++   E++G++ I  + 
Sbjct: 82  MLPVYDNMKRAIEAA------SDEQRE-VSAALIEGVELTMRALLGVFEKHGMQVIAPEV 134

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
            Q+F+P +H+AMFE P     A  II+V  +G+ +++R+LRPA V +S
Sbjct: 135 GQRFDPQVHEAMFEAPVPGTKAGDIIQVSAEGFMLHDRLLRPAQVGVS 182


>gi|330991342|ref|ZP_08315293.1| Protein grpE [Gluconacetobacter sp. SXCC-1]
 gi|329761361|gb|EGG77854.1| Protein grpE [Gluconacetobacter sp. SXCC-1]
          Length = 201

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/149 (39%), Positives = 93/149 (62%), Gaps = 4/149 (2%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            RDK++R  AE +N+R R  RE +DA+ Y++ KFA+D++  +DNL RA+ S P     + 
Sbjct: 55  LRDKWVRAEAETQNVRSRAKREVEDARQYAVQKFAKDVVEAADNLKRAVASLP----PAT 110

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
           +  +S+L  + EGIE T R  +  LER G+K  DAK + F+ N+HQAM E+  D     T
Sbjct: 111 EGEDSLLTRMREGIESTERSFVGILERNGIKAEDAKGKPFDANLHQAMSEQHSDEHGHGT 170

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKTQ 191
           +++     + ++ R+L+PA+V +SKG  Q
Sbjct: 171 VMEAWTPAWTLHGRLLKPAMVVVSKGPAQ 199


>gi|307256411|ref|ZP_07538193.1| hypothetical protein appser10_4170 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306865041|gb|EFM96942.1| hypothetical protein appser10_4170 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
          Length = 198

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 54/143 (37%), Positives = 99/143 (69%), Gaps = 6/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE++N+RRR +++ + A  +++ KF++++L+V DNL R L++  LD A +++
Sbjct: 61  KDIQLRAQAEIQNIRRRAEQDVEKAHKFALEKFSKELLTVVDNLERGLNA--LDTAVTDE 118

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           K+    ++L++G+EMT +E +STL ++GV+ +    + FNP +H+A+  +P + + AN I
Sbjct: 119 KT----QALVDGVEMTHKEFISTLAKFGVEAVGVVGEAFNPEVHEAISMQPAEGIEANHI 174

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY +  RVLRPA+V ++
Sbjct: 175 SVVLQKGYTLQGRVLRPAMVMVA 197


>gi|307249587|ref|ZP_07531574.1| hypothetical protein appser4_3980 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306858442|gb|EFM90511.1| hypothetical protein appser4_3980 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
          Length = 198

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 54/143 (37%), Positives = 99/143 (69%), Gaps = 6/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE++N+RRR +++ + A  +++ KF++++L+V DNL R L++  LD A +++
Sbjct: 61  KDIQLRAQAEIQNIRRRAEQDVEKAHKFALEKFSKELLTVVDNLERGLNA--LDTAVTDE 118

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           K+    ++L++G+EMT +E +STL ++GV+ +    + FNP +H+A+  +P + + AN I
Sbjct: 119 KT----QALVDGVEMTHKEFISTLAKFGVEAVGVVGEAFNPEVHEAISMQPAEGIEANHI 174

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY +  RVLRPA+V ++
Sbjct: 175 SVVLQKGYTLQGRVLRPAMVMVA 197


>gi|260431974|ref|ZP_05785945.1| co-chaperone GrpE [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415802|gb|EEX09061.1| co-chaperone GrpE [Silicibacter lacuscaerulensis ITI-1157]
          Length = 187

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 64/162 (39%), Positives = 104/162 (64%), Gaps = 14/162 (8%)

Query: 32  IPEESLN------QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSD 85
           I EE+L       + +E RDK++R +A+ EN R+R DR +++A+ Y  +K ARDML V D
Sbjct: 28  ISEEALELDALKAERDELRDKFMRALADAENARKRGDRARREAEQYGGSKLARDMLPVYD 87

Query: 86  NLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNP 144
           ++ RAL++A      S+++ E V   LIEG+E+T R +    +++G++ I  +   KF+P
Sbjct: 88  SMKRALEAA------SDEQRE-VAAGLIEGVELTMRMLRDVFKKHGIEVIAPEVGDKFDP 140

Query: 145 NMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           N+H+AMFE P     A  II+V  +G+ +++R+LRPA V +S
Sbjct: 141 NLHEAMFEAPVPGTKAGEIIQVSAEGFMLHDRLLRPAQVGVS 182


>gi|165975827|ref|YP_001651420.1| heat shock protein [Actinobacillus pleuropneumoniae serovar 3 str.
           JL03]
 gi|303249729|ref|ZP_07335933.1| heat shock protein [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|307245195|ref|ZP_07527286.1| hypothetical protein appser1_4030 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307251916|ref|ZP_07533817.1| hypothetical protein appser6_4360 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307254142|ref|ZP_07535987.1| hypothetical protein appser9_3950 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307258606|ref|ZP_07540341.1| hypothetical protein appser11_4050 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|226737100|sp|B0BTB9|GRPE_ACTPJ RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|165875928|gb|ABY68976.1| heat shock protein [Actinobacillus pleuropneumoniae serovar 3 str.
           JL03]
 gi|302651296|gb|EFL81448.1| heat shock protein [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|306853839|gb|EFM86053.1| hypothetical protein appser1_4030 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306860608|gb|EFM92620.1| hypothetical protein appser6_4360 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306862842|gb|EFM94791.1| hypothetical protein appser9_3950 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306867263|gb|EFM99116.1| hypothetical protein appser11_4050 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
          Length = 198

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 54/143 (37%), Positives = 99/143 (69%), Gaps = 6/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE++N+RRR +++ + A  +++ KF++++L+V DNL R L++  LD A +++
Sbjct: 61  KDIQLRAQAEIQNIRRRAEQDVEKAHKFALEKFSKELLTVVDNLERGLNA--LDTAVTDE 118

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           K+    ++L++G+EMT +E +STL ++GV+ +    + FNP +H+A+  +P + + AN I
Sbjct: 119 KT----QALVDGVEMTHKEFISTLAKFGVEAVGVVGEAFNPEVHEAISMQPAEGIEANHI 174

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY +  RVLRPA+V ++
Sbjct: 175 SVVLQKGYTLQGRVLRPAMVMVA 197


>gi|32035761|ref|ZP_00135624.1| COG0576: Molecular chaperone GrpE (heat shock protein)
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126207851|ref|YP_001053076.1| heat shock protein (HSP-70 cofactor) [Actinobacillus
           pleuropneumoniae L20]
 gi|303252610|ref|ZP_07338773.1| heat shock protein (HSP-70 cofactor) [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|307247365|ref|ZP_07529413.1| hypothetical protein appser2_3620 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|166215246|sp|A3MZ85|GRPE_ACTP2 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|126096643|gb|ABN73471.1| heat shock protein (HSP-70 cofactor) [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
 gi|302648578|gb|EFL78771.1| heat shock protein (HSP-70 cofactor) [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|306856209|gb|EFM88364.1| hypothetical protein appser2_3620 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
          Length = 198

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 54/143 (37%), Positives = 99/143 (69%), Gaps = 6/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE++N+RRR +++ + A  +++ KF++++L+V DNL R L++  LD A +++
Sbjct: 61  KDIQLRAQAEIQNIRRRAEQDVEKAHKFALEKFSKELLTVVDNLERGLNA--LDTAVTDE 118

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           K+    ++L++G+EMT +E +STL ++GV+ +    + FNP +H+A+  +P + + AN I
Sbjct: 119 KT----QALVDGVEMTHKEFISTLAKFGVEAVGVVGEAFNPEVHEAISMQPAEGIEANHI 174

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY +  RVLRPA+V ++
Sbjct: 175 SVVLQKGYTLQGRVLRPAMVMVA 197


>gi|190149658|ref|YP_001968183.1| heat shock protein (HSP-70 cofactor) [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|307260841|ref|ZP_07542527.1| hypothetical protein appser12_4120 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|307262966|ref|ZP_07544588.1| hypothetical protein appser13_3890 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|226737099|sp|B3H0M9|GRPE_ACTP7 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|189914789|gb|ACE61041.1| heat shock protein (HSP-70 cofactor) [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|306869408|gb|EFN01199.1| hypothetical protein appser12_4120 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|306871592|gb|EFN03314.1| hypothetical protein appser13_3890 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 198

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 54/143 (37%), Positives = 99/143 (69%), Gaps = 6/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE++N+RRR +++ + A  +++ KF++++L+V DNL R L++  LD A +++
Sbjct: 61  KDIQLRAQAEIQNIRRRAEQDIEKAHKFALEKFSKELLTVVDNLERGLNA--LDTAVTDE 118

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           K+    ++L++G+EMT +E +STL ++GV+ +    + FNP +H+A+  +P + + AN I
Sbjct: 119 KT----QALVDGVEMTHKEFISTLAKFGVEAVGVVGEAFNPEVHEAISMQPAEGIEANHI 174

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY +  RVLRPA+V ++
Sbjct: 175 SVVLQKGYTLQGRVLRPAMVMVA 197


>gi|94500152|ref|ZP_01306686.1| co-chaperone GrpE [Oceanobacter sp. RED65]
 gi|94427725|gb|EAT12701.1| co-chaperone GrpE [Oceanobacter sp. RED65]
          Length = 198

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 117/202 (57%), Gaps = 30/202 (14%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEI------NIPEESLNQSE----------EFRDKYL 48
           MSE+  D E NP      TA+E+SE       N  E  + Q            E +++ L
Sbjct: 1   MSEQGQDIE-NPEVETQETAQEQSESAQESADNTVESVVEQDSQVEALQAEVAELKEEVL 59

Query: 49  RVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESV 108
           R  AE +N+RRR + + + A  +S  KFAR++L V DNL RA+ ++P D          V
Sbjct: 60  RAQAETQNVRRRAEVDVEKAHKFSTEKFARELLEVVDNLERAIAASPED---------EV 110

Query: 109 LKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQA--MFEEPHDTVPANTIIKV 166
           +K  +EG+EMT++  ++TL+++ V+ I+ +   F+P++HQA  M + P D  P NT++ V
Sbjct: 111 VKPFLEGVEMTQKSFVNTLKKFKVEAIEPEGHPFDPDLHQAISMVDAP-DAEP-NTVLNV 168

Query: 167 VQDGYAINERVLRPALVSISKG 188
           VQ GY I++R+LRPA+V +SK 
Sbjct: 169 VQKGYTIHDRLLRPAMVVVSKA 190


>gi|303277531|ref|XP_003058059.1| mitochondrial protein translocase family [Micromonas pusilla
           CCMP1545]
 gi|226460716|gb|EEH58010.1| mitochondrial protein translocase family [Micromonas pusilla
           CCMP1545]
          Length = 150

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 91/150 (60%), Gaps = 3/150 (2%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           Q ++  DK LR +A+MENLR RT R+ ++A+ ++I  F +D+L V+DNL RA  +   D 
Sbjct: 1   QVKDLNDKLLRTLADMENLRERTRRQAENAEKFAIQGFCKDLLDVADNLGRAAATVDADA 60

Query: 99  ANSEKKSESV---LKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPH 155
             +E   E +   L SL EG+ M  +++ ST  ++GV+K D   + F+PN H A+F  P 
Sbjct: 61  IAAESDGEKLKKMLTSLHEGVLMVEKQLGSTFGKHGVEKYDPTGEDFDPNAHMALFNVPD 120

Query: 156 DTVPANTIIKVVQDGYAINERVLRPALVSI 185
               A TI  V + GY +++RV+RPA V +
Sbjct: 121 AEKTAGTIASVTKAGYKLHDRVIRPAEVGV 150


>gi|301168665|emb|CBW28256.1| heat shock protein [Haemophilus influenzae 10810]
          Length = 234

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 98/143 (68%), Gaps = 7/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+ENLRRRT+++ + A  +++ KF++D+L+  DNL RAL + P   AN E 
Sbjct: 98  QDILLRSRAEIENLRRRTEQDVEKAHKFALEKFSKDILNTIDNLERAL-ATP---ANKED 153

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           +S   +K+L +G+E+T +E++ST+ R+GV+ +    + FNP++HQA+  +P +    N I
Sbjct: 154 ES---VKALFDGVELTLKELVSTVGRFGVEAVGVVGEAFNPDLHQAISMQPAEGFETNQI 210

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY +N RV+RPA+V ++
Sbjct: 211 SVVLQKGYTLNGRVIRPAMVMVA 233


>gi|145633366|ref|ZP_01789096.1| GrpE [Haemophilus influenzae 3655]
 gi|145635257|ref|ZP_01790961.1| GrpE [Haemophilus influenzae PittAA]
 gi|148827223|ref|YP_001291976.1| heat shock protein GrpE [Haemophilus influenzae PittGG]
 gi|229845410|ref|ZP_04465541.1| GrpE [Haemophilus influenzae 6P18H1]
 gi|144985929|gb|EDJ92531.1| GrpE [Haemophilus influenzae 3655]
 gi|145267536|gb|EDK07536.1| GrpE [Haemophilus influenzae PittAA]
 gi|148718465|gb|ABQ99592.1| GrpE [Haemophilus influenzae PittGG]
 gi|229811718|gb|EEP47416.1| GrpE [Haemophilus influenzae 6P18H1]
          Length = 234

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 98/143 (68%), Gaps = 7/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+ENLRRRT+++ + A  +++ KF++D+L+  DNL RAL + P   AN E 
Sbjct: 98  QDILLRSRAEIENLRRRTEQDVEKAHKFALEKFSKDILNTIDNLERAL-ATP---ANKED 153

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           +S   +K+L +G+E+T +E++ST+ R+GV+ +    + FNP++HQA+  +P +    N I
Sbjct: 154 ES---VKALFDGVELTLKELVSTVGRFGVEAVGVVGEAFNPDLHQAISMQPAEGFETNQI 210

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY +N RV+RPA+V ++
Sbjct: 211 SVVLQKGYTLNGRVIRPAMVMVA 233


>gi|8039789|sp|P43732|GRPE_HAEIN RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
          Length = 198

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 98/143 (68%), Gaps = 7/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+ENLRRRT+++ + A  +++ KF++D+L+  DNL RAL + P   AN E 
Sbjct: 62  QDILLRSRAEIENLRRRTEQDVEKAHKFALEKFSKDILNTIDNLERAL-ATP---ANKED 117

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           +S   +K+L +G+E+T +E++ST+ R+GV+ +    + FNP++HQA+  +P +    N I
Sbjct: 118 ES---VKALFDGVELTLKELVSTVGRFGVEAVGVVGEAFNPDLHQAISMQPAEGFETNQI 174

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY +N RV+RPA+V ++
Sbjct: 175 SVVLQKGYTLNGRVIRPAMVMVA 197


>gi|260580624|ref|ZP_05848451.1| co-chaperone GrpE [Haemophilus influenzae RdAW]
 gi|1573022|gb|AAC21750.1| heat shock protein (grpE) [Haemophilus influenzae Rd KW20]
 gi|260092686|gb|EEW76622.1| co-chaperone GrpE [Haemophilus influenzae RdAW]
          Length = 234

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 98/143 (68%), Gaps = 7/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+ENLRRRT+++ + A  +++ KF++D+L+  DNL RAL + P   AN E 
Sbjct: 98  QDILLRSRAEIENLRRRTEQDVEKAHKFALEKFSKDILNTIDNLERAL-ATP---ANKED 153

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           +S   +K+L +G+E+T +E++ST+ R+GV+ +    + FNP++HQA+  +P +    N I
Sbjct: 154 ES---VKALFDGVELTLKELVSTVGRFGVEAVGVVGEAFNPDLHQAISMQPAEGFETNQI 210

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY +N RV+RPA+V ++
Sbjct: 211 SVVLQKGYTLNGRVIRPAMVMVA 233


>gi|30995352|ref|NP_438245.2| heat shock protein GrpE [Haemophilus influenzae Rd KW20]
          Length = 230

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 98/143 (68%), Gaps = 7/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+ENLRRRT+++ + A  +++ KF++D+L+  DNL RAL + P   AN E 
Sbjct: 94  QDILLRSRAEIENLRRRTEQDVEKAHKFALEKFSKDILNTIDNLERAL-ATP---ANKED 149

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           +S   +K+L +G+E+T +E++ST+ R+GV+ +    + FNP++HQA+  +P +    N I
Sbjct: 150 ES---VKALFDGVELTLKELVSTVGRFGVEAVGVVGEAFNPDLHQAISMQPAEGFETNQI 206

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY +N RV+RPA+V ++
Sbjct: 207 SVVLQKGYTLNGRVIRPAMVMVA 229


>gi|319775015|ref|YP_004137503.1| GrpE nucleotide exchange factor [Haemophilus influenzae F3047]
 gi|319896485|ref|YP_004134678.1| grpe nucleotide exchange factor [Haemophilus influenzae F3031]
 gi|317431987|emb|CBY80335.1| GrpE nucleotide exchange factor [Haemophilus influenzae F3031]
 gi|317449606|emb|CBY85811.1| GrpE nucleotide exchange factor [Haemophilus influenzae F3047]
          Length = 234

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 58/143 (40%), Positives = 97/143 (67%), Gaps = 7/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+ENLRRRT+++ + A  +++ KF++D+L+  DNL RAL +     AN E 
Sbjct: 98  QDILLRSRAEIENLRRRTEQDVEKAHKFALEKFSKDILNTIDNLERALATP----ANKED 153

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           +S   +K+L +G+E+T +E++ST+ R+GV+ +    + FNP++HQA+  +P +    N I
Sbjct: 154 ES---VKALFDGVELTLKELVSTVGRFGVEAVGVVGEAFNPDLHQAISMQPAEGFETNQI 210

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY +N RV+RPA+V ++
Sbjct: 211 SVVLQKGYTLNGRVIRPAMVMVA 233


>gi|255081366|ref|XP_002507905.1| mitochondrial protein translocase family [Micromonas sp. RCC299]
 gi|226523181|gb|ACO69163.1| mitochondrial protein translocase family [Micromonas sp. RCC299]
          Length = 216

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 94/155 (60%), Gaps = 4/155 (2%)

Query: 35  ESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRA---L 91
           E   Q ++  DK LR +A+MENLR RT R+ + A+ ++I  F +D+L V+DNL+RA   +
Sbjct: 59  EKTAQVKDLNDKLLRTLADMENLRERTRRQAETAEKFAIQGFCKDLLDVADNLARASATV 118

Query: 92  DSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID-AKDQKFNPNMHQAM 150
           D   L+        ++VL SL EG+ M  +++MST  ++GV K D A+   FNPN H A+
Sbjct: 119 DPEALETETDAANIKNVLASLHEGVLMVEKQLMSTFGKHGVVKFDPAEGDPFNPNDHMAL 178

Query: 151 FEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
           F  P     A T+  V + GY +++RV+RPA V +
Sbjct: 179 FNVPKGEKEAGTVAAVTKVGYKLHDRVIRPAEVGV 213


>gi|157376462|ref|YP_001475062.1| GrpE protein [Shewanella sediminis HAW-EB3]
 gi|189041747|sp|A8FYL1|GRPE_SHESH RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|157318836|gb|ABV37934.1| GrpE protein [Shewanella sediminis HAW-EB3]
          Length = 209

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 111/186 (59%), Gaps = 16/186 (8%)

Query: 11  DKEKNPSNANSSTAEEKSEINIPEESLNQS--------EEFRDKYLRVIAEMENLRRRTD 62
           D E       +S  +E ++ N   E L Q+        +E +D  +R  AE++N+RRR  
Sbjct: 24  DNENETVTGEASLMDELTQANFRVEELEQALEAATAKVDEQKDSVIRAAAEVDNIRRRAA 83

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
            + + A+ +++ KFA ++L V DN+ RAL         ++ ++E+  K++ EG+E+T + 
Sbjct: 84  IDVEKARKFALEKFANELLPVIDNMERALQG-------TDAEAEAT-KAVYEGVELTLKS 135

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
            + T+E++G+  ++ + + FNP  HQA+  +P    PANT++ V+Q GY +NER+LRPA+
Sbjct: 136 FIGTVEKFGLTVVNPQGETFNPEHHQAIGMQPSPDFPANTVMMVMQKGYILNERLLRPAM 195

Query: 183 VSISKG 188
           V +S+G
Sbjct: 196 VMVSQG 201


>gi|238753936|ref|ZP_04615296.1| hypothetical protein yruck0001_7110 [Yersinia ruckeri ATCC 29473]
 gi|238707924|gb|EEQ00282.1| hypothetical protein yruck0001_7110 [Yersinia ruckeri ATCC 29473]
          Length = 192

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 96/148 (64%), Gaps = 10/148 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LR  AE+EN+RRRT+ + + A  +++ KF+  +L V DNL RALDSA  D +N+E 
Sbjct: 54  RDSLLRAKAEVENIRRRTELDIEKAHKFALEKFSSSLLPVIDNLERALDSA--DHSNTE- 110

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                L  +IEG+E+TR+ ++  +E++G++ +   +  FNP +HQAM   E  D  P N 
Sbjct: 111 -----LAVMIEGVELTRKSLLDAVEKFGIEVVAESNVPFNPEVHQAMTMIESADHEP-NH 164

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ V+Q GY +N R+LRPA+V +SK K 
Sbjct: 165 VMNVMQKGYTLNGRLLRPAMVVVSKAKA 192


>gi|87200075|ref|YP_497332.1| GrpE protein [Novosphingobium aromaticivorans DSM 12444]
 gi|123763471|sp|Q2G6M5|GRPE_NOVAD RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|87135756|gb|ABD26498.1| GrpE protein [Novosphingobium aromaticivorans DSM 12444]
          Length = 186

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 91/147 (61%), Gaps = 5/147 (3%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           E  R   L   AE +N+RRR +++  DA++Y+   FARD+LSV+DNLSRAL+S P DL  
Sbjct: 42  ETARQDVLYAKAETQNVRRRMEKDVADARAYAATGFARDILSVADNLSRALESIPADLRE 101

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
            +K      K+L+ G+E T RE+      +G+ +I A     +P+ HQAM E P      
Sbjct: 102 DDK-----FKNLVAGLEATGREIEKVFSSHGIVRIAAMGLPLDPHQHQAMIEMPSADAEP 156

Query: 161 NTIIKVVQDGYAINERVLRPALVSISK 187
            T+I+ +Q GY I +R+LRPA+V+++K
Sbjct: 157 GTVIQELQAGYMIKDRLLRPAMVAVAK 183


>gi|126730095|ref|ZP_01745907.1| co-chaperone GrpE [Sagittula stellata E-37]
 gi|126709475|gb|EBA08529.1| co-chaperone GrpE [Sagittula stellata E-37]
          Length = 187

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 102/147 (69%), Gaps = 8/147 (5%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           ++++D+++R +A+ EN R+R  +++++AQ+Y  ++ ARD+L V DNL+RAL +A  D +N
Sbjct: 43  DDYKDRFMRALADAENARKRAAKDRQEAQAYGGSRIARDLLPVYDNLNRALLAAKEDGSN 102

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVP 159
           +         +L+EG+E+T +E+M+  +R+G+ ++  +  ++F+P +H+AMFE P     
Sbjct: 103 AS-------TALVEGVELTLKELMNVFDRHGMTRVSPEIGERFDPKLHEAMFEAPVPGTS 155

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
           A  II+V  +G+ +++R+LRPA V +S
Sbjct: 156 AGEIIQVSAEGFMLHDRLLRPAQVGVS 182


>gi|254475115|ref|ZP_05088501.1| co-chaperone GrpE [Ruegeria sp. R11]
 gi|214029358|gb|EEB70193.1| co-chaperone GrpE [Ruegeria sp. R11]
          Length = 187

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 110/168 (65%), Gaps = 9/168 (5%)

Query: 21  SSTAEEKSEINIPEESLN-QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARD 79
           S+  EE  ++ +  +SL  + +E +D+++R +A+ EN R+R D+ +++A+ Y  +K ARD
Sbjct: 22  SAQTEEFDDVALELDSLRAERDELKDRFMRALADAENARKRGDKARREAEQYGGSKLARD 81

Query: 80  MLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK- 138
           ML V DN+ RA+++A      ++++ E V  +LIEG+E+T R ++   E++G++ I  + 
Sbjct: 82  MLPVYDNMKRAVEAA------TDEQRE-VSAALIEGVELTMRALLGVFEKHGMQVIAPEV 134

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
             KF+P +H+AMFE P     A  II+V  +G+ +++R+LRPA V +S
Sbjct: 135 GDKFDPQVHEAMFEAPVPGTKAGDIIQVSAEGFMLHDRLLRPAQVGVS 182


>gi|145630627|ref|ZP_01786406.1| anaerobic ribonucleoside triphosphate reductase [Haemophilus
           influenzae R3021]
 gi|144983753|gb|EDJ91203.1| anaerobic ribonucleoside triphosphate reductase [Haemophilus
           influenzae R3021]
          Length = 234

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 98/143 (68%), Gaps = 7/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+ENLRRRT+++ + A  +++ KF++D+L+  DNL RAL + P     + K
Sbjct: 98  QDILLRSRAEIENLRRRTEQDVEKAHKFALEKFSKDILNTIDNLERAL-ATP-----TNK 151

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           + ESV K+L +G+E+T +E++ST+ R+GV+ +    + FNP++HQA+  +P +    N I
Sbjct: 152 EDESV-KALFDGVELTLKELVSTVGRFGVEAVGVVGEAFNPDLHQAISMQPAEGFETNQI 210

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY +N RV+RPA+V ++
Sbjct: 211 SVVLQKGYTLNGRVIRPAMVMVA 233


>gi|270265315|ref|ZP_06193576.1| protein GrpE [Serratia odorifera 4Rx13]
 gi|270040719|gb|EFA13822.1| protein GrpE [Serratia odorifera 4Rx13]
          Length = 190

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 93/148 (62%), Gaps = 10/148 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LR  AEMEN+RRRT+ + + A  +++ KFA D+L V DNL RALD A         
Sbjct: 52  RDSLLRAKAEMENVRRRTELDIEKAHKFALEKFAGDLLPVIDNLERALDLA--------D 103

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
           KS   L ++IEGIE+T + +   + +YG++ +   +  FNP++HQAM   E  D  P N 
Sbjct: 104 KSNPELTAMIEGIELTLKSLQDAVSKYGIEIVGDINVPFNPDVHQAMSLMESADHQP-NH 162

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ V+Q GY +N R+LRPA+V++SK K 
Sbjct: 163 VMMVMQKGYTLNGRLLRPAMVAVSKAKA 190


>gi|209966221|ref|YP_002299136.1| co-chaperone GrpE, putative [Rhodospirillum centenum SW]
 gi|209959687|gb|ACJ00324.1| co-chaperone GrpE, putative [Rhodospirillum centenum SW]
          Length = 234

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 58/146 (39%), Positives = 97/146 (66%), Gaps = 4/146 (2%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            +D+ LR +AE EN+RRR +RE++D   Y+IAKFA+D+L+V+DNL RA++S    +A  +
Sbjct: 83  LKDQLLRALAETENVRRRAEREREDTAKYAIAKFAKDLLAVADNLRRAVES----VAPDQ 138

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
           ++    + SL+ G+E T R++ +  +R G++K++  D+ F+PN HQ M E         T
Sbjct: 139 RQGNEAVNSLLTGVEATERQLAAAFDRAGIQKMEPLDRPFDPNFHQVMMEMEGTGKAPGT 198

Query: 163 IIKVVQDGYAINERVLRPALVSISKG 188
           ++ V+Q GY +  R+LR A+V ++KG
Sbjct: 199 VVAVLQAGYTLQGRLLREAMVGVAKG 224


>gi|167624994|ref|YP_001675288.1| heat shock protein GrpE [Shewanella halifaxensis HAW-EB4]
 gi|226737177|sp|B0TQ37|GRPE_SHEHH RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|167355016|gb|ABZ77629.1| GrpE protein [Shewanella halifaxensis HAW-EB4]
          Length = 200

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 53/145 (36%), Positives = 96/145 (66%), Gaps = 8/145 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  +R  AE++N+RRR+  + + A  +++ KF  ++L V DN+ RAL         ++ 
Sbjct: 64  KDSVIRAAAEVDNIRRRSAIDVEKAHKFALEKFINELLPVLDNMERALQG-------TDA 116

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           ++E+  K++ EG+E+T +  +ST+E++G+ ++D     FNP +HQA+  +P    PANT+
Sbjct: 117 EAEAT-KAIYEGVELTAKSFVSTVEKFGLTQVDPLGDTFNPELHQAIGMQPSADFPANTV 175

Query: 164 IKVVQDGYAINERVLRPALVSISKG 188
           + V+Q GY +N+R+LRPA+V +S+G
Sbjct: 176 MMVMQKGYTLNDRLLRPAMVMVSQG 200


>gi|212636379|ref|YP_002312904.1| heat shock protein GrpE [Shewanella piezotolerans WP3]
 gi|226737180|sp|B8CS27|GRPE_SHEPW RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|212557863|gb|ACJ30317.1| Heat shock protein GrpE [Shewanella piezotolerans WP3]
          Length = 200

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 53/145 (36%), Positives = 97/145 (66%), Gaps = 8/145 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  +R  AE++N+RRR   + + A+ +++ KFA ++L V DN+ RAL         ++ 
Sbjct: 64  KDSVIRAAAEVDNIRRRAAIDVEKARKFALEKFANELLPVLDNMERALQ-------GTDA 116

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           ++E+  K++ EG+E+T +  +S +E++G+ ++D + + FNP +HQA+  +P     ANT+
Sbjct: 117 EAEAT-KAIYEGVELTAKSFVSAVEKFGLTQVDPQGEAFNPELHQAIGMQPSTDFAANTV 175

Query: 164 IKVVQDGYAINERVLRPALVSISKG 188
           + V+Q GY +NER+LRPA+V +S+G
Sbjct: 176 MMVMQKGYTLNERLLRPAMVMVSQG 200


>gi|167534495|ref|XP_001748923.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163772603|gb|EDQ86253.1| predicted protein [Monosiga brevicollis MX1]
          Length = 246

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 56/141 (39%), Positives = 89/141 (63%), Gaps = 2/141 (1%)

Query: 45  DKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKK 104
           DKYLR +A+MENLR R+ RE +DA  Y++ KFA+D+L  +DNL RAL   P +   +E  
Sbjct: 104 DKYLRALADMENLRHRSKREVQDASDYAMQKFAKDLLEFADNLERALAYVPEEARTAEGN 163

Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTII 164
           ++  LK+L EG+E T+R++     RY +  ++   +KF+P +H+A+F+ P       T+ 
Sbjct: 164 TD--LKNLYEGVEGTQRQLQHVFARYELLPVNPLGEKFDPELHEALFQVPDPNQAPGTVA 221

Query: 165 KVVQDGYAINERVLRPALVSI 185
           +V+  GY +  R+LR A V +
Sbjct: 222 QVMHTGYTLKGRLLRAAGVGV 242


>gi|85712934|ref|ZP_01043974.1| Molecular chaperone GrpE (heat shock protein) [Idiomarina baltica
           OS145]
 gi|85693240|gb|EAQ31198.1| Molecular chaperone GrpE (heat shock protein) [Idiomarina baltica
           OS145]
          Length = 224

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 61/146 (41%), Positives = 95/146 (65%), Gaps = 8/146 (5%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E ++  LR  AEMEN+RRR  ++ + A  +++ KFA ++L+  DNL RA+ +A  D  N 
Sbjct: 77  EQKESVLRSQAEMENVRRRASQDVEKAHKFALEKFANELLTSVDNLERAMQAA--DTENP 134

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
           E      LKS +EGIE+T + + STL+++GVK +  + + FNP++HQAM  +       N
Sbjct: 135 E------LKSFLEGIELTYKSLTSTLDKFGVKAVGEEGEVFNPDLHQAMSMQESAEHKNN 188

Query: 162 TIIKVVQDGYAINERVLRPALVSISK 187
           TII V+Q GY +N R+LRPA+V +++
Sbjct: 189 TIIAVMQKGYELNGRLLRPAMVMVAR 214


>gi|119775571|ref|YP_928311.1| heat shock protein GrpE [Shewanella amazonensis SB2B]
 gi|226737173|sp|A1S8D5|GRPE_SHEAM RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|119768071|gb|ABM00642.1| heat shock protein GrpE [Shewanella amazonensis SB2B]
          Length = 200

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 96/148 (64%), Gaps = 8/148 (5%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           EE +D  +R  AE++N+RRR   + + A  +++ KFA ++L V DN+ RAL        N
Sbjct: 54  EEQKDSVVRAAAEVDNIRRRAAMDVEKANKFALEKFANELLPVLDNMERALAGT-----N 108

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
           +E ++    K++ EG+ +T + +++ +E++GVK +D   Q FNP  HQA+  +P+  VPA
Sbjct: 109 AEDEAT---KAMYEGVSLTMKTLVNAVEKFGVKVVDPMGQPFNPEQHQAIGMQPNPEVPA 165

Query: 161 NTIIKVVQDGYAINERVLRPALVSISKG 188
           N ++ V+Q GY +N R+LRPA+V +S+G
Sbjct: 166 NHVMVVLQKGYELNGRLLRPAMVMVSQG 193


>gi|332374942|gb|AEE62612.1| unknown [Dendroctonus ponderosae]
          Length = 218

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 65/182 (35%), Positives = 112/182 (61%), Gaps = 13/182 (7%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQ--------SEEFRDKYLRVIAEMENLRRRTDREK 65
           K+ ++ + S  ++KS + I  E LN+        + E  DKY R +A+ ENLR+R  ++ 
Sbjct: 42  KSETDTSPSANDDKSNVEI--EKLNKQIVELTEKNSELLDKYKRSLADGENLRQRLTKQI 99

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
            +A+ Y I  F +D+L V+D L +A ++ P D     K S   LK L EG+ MT  ++ S
Sbjct: 100 GEAKIYGIQGFCKDLLDVADVLGKATETVPKD---EIKDSNPHLKGLYEGLIMTEAQLKS 156

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
             +R+G+++++  ++KF+PN H+A+F++  +   A T++ V + GY +++RVLRPALV +
Sbjct: 157 VFKRHGLEQVNPLNEKFDPNFHEALFQQEVEGKAAGTVVVVSKIGYKLHDRVLRPALVGV 216

Query: 186 SK 187
           SK
Sbjct: 217 SK 218


>gi|113460794|ref|YP_718861.1| heat shock protein GrpE [Haemophilus somnus 129PT]
 gi|170719175|ref|YP_001784319.1| heat shock protein GrpE [Haemophilus somnus 2336]
 gi|123132056|sp|Q0I2Y4|GRPE_HAES1 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|189041743|sp|B0UT70|GRPE_HAES2 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|112822837|gb|ABI24926.1| GrpE protein [Haemophilus somnus 129PT]
 gi|168827304|gb|ACA32675.1| GrpE protein [Haemophilus somnus 2336]
          Length = 195

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 57/144 (39%), Positives = 97/144 (67%), Gaps = 7/144 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE++N+RRR +++ + A  +++ KFA+D+L   DNL RAL S P   AN E 
Sbjct: 59  QDILLRTRAEIDNIRRRAEQDVEKAHKFALEKFAKDLLETIDNLERAL-STP---ANVEN 114

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           ++   +KSL++G+E+T + ++ST+ R+GV+ +    + FNP +HQA+  +P +   +N I
Sbjct: 115 ET---IKSLVDGVELTLKGLLSTVARFGVEPVGVIGETFNPELHQAISMQPTEGFESNQI 171

Query: 164 IKVVQDGYAINERVLRPALVSISK 187
             V+Q GY +N RV+RPA+V +++
Sbjct: 172 TVVLQKGYLLNGRVIRPAMVMVAQ 195


>gi|260831059|ref|XP_002610477.1| hypothetical protein BRAFLDRAFT_124277 [Branchiostoma floridae]
 gi|229295843|gb|EEN66487.1| hypothetical protein BRAFLDRAFT_124277 [Branchiostoma floridae]
          Length = 223

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 104/172 (60%), Gaps = 10/172 (5%)

Query: 17  SNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKF 76
           S A+    EEK++++       + +E++DKY+R +AE EN+R+R  ++  D++ Y+I  F
Sbjct: 61  SPADKKLTEEKAKLD------KELKEYKDKYVRALAETENVRQRMKQQLADSKLYAIQGF 114

Query: 77  ARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID 136
            +D+L V+D L +A ++ P +    E K+   LK+L EG++MT  +M     R G++ ++
Sbjct: 115 CKDLLEVADVLQKATETVPAE----EMKNNPTLKTLFEGLKMTETQMQKVFSRNGLEMLN 170

Query: 137 AKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
              +KF+PN H+A+F  P +     T+  V + GY ++ RV+RPALV + K 
Sbjct: 171 PVGEKFDPNFHEALFMAPMEGKEPGTVAVVSKVGYTLHSRVIRPALVGVVKA 222


>gi|149909294|ref|ZP_01897950.1| Hsp 24 DnaK nucleotide exchange factor; probable member of
           theDnaK/DnaJ/GrpE foldase complex [Moritella sp. PE36]
 gi|149807611|gb|EDM67559.1| Hsp 24 DnaK nucleotide exchange factor; probable member of
           theDnaK/DnaJ/GrpE foldase complex [Moritella sp. PE36]
          Length = 216

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 66/162 (40%), Positives = 103/162 (63%), Gaps = 11/162 (6%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           E++   + EF+D  LR  A+ +N+RRR   +   A+ +++ KFA ++L V DN+ R L  
Sbjct: 60  EKATASAAEFKDVALRAKADADNIRRRAAIDVDKAKKFALEKFANELLPVIDNMERGL-- 117

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FE 152
                 + +K +E++L  LIEGIE+T + + + LE++GVK ++ + +KFNP +HQAM   
Sbjct: 118 -----LHVDKSNETLL-PLIEGIELTAKSLEAALEKFGVKSVNPEGEKFNPELHQAMSMI 171

Query: 153 EPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPT 194
           E  D  P NT+I V+Q GY +N R++RPA+V ISK  T  PT
Sbjct: 172 ESTDVEP-NTVISVMQKGYELNGRLIRPAMVMISKAAT-TPT 211


>gi|163732972|ref|ZP_02140416.1| GrpE protein HSP-70 cofactor, putative [Roseobacter litoralis Och
           149]
 gi|161393507|gb|EDQ17832.1| GrpE protein HSP-70 cofactor, putative [Roseobacter litoralis Och
           149]
          Length = 187

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 101/147 (68%), Gaps = 8/147 (5%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           ++ +D+++R +A+ EN R+R+DR++++A++Y  +K +RDML V DN+ RAL++       
Sbjct: 43  DQLKDRFMRALADAENARKRSDRDRREAENYGGSKLSRDMLPVYDNMKRALEA-----VT 97

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVP 159
            E++ ++   +L+EGIE+T RE++S  +++G++ I  +   +F+P  HQAMFE P     
Sbjct: 98  DEQREQNA--ALLEGIELTMRELLSVFKKHGIEVIAPEVGDRFDPQHHQAMFEAPVPGTR 155

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
           A  II+V  +G+ +++R+LRPA V +S
Sbjct: 156 AGDIIQVAAEGFMLHDRLLRPAQVGVS 182


>gi|56694938|ref|YP_165283.1| co-chaperone GrpE [Ruegeria pomeroyi DSS-3]
 gi|56676675|gb|AAV93341.1| co-chaperone GrpE [Ruegeria pomeroyi DSS-3]
          Length = 187

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 56/145 (38%), Positives = 96/145 (66%), Gaps = 8/145 (5%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
           F+DK++R +A+ EN+R+R +R +++A+ Y  +K ARDML V DN+ RAL++        E
Sbjct: 45  FKDKFMRALADAENVRKRGERARREAEQYGGSKLARDMLPVYDNMKRALET-----VTDE 99

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPAN 161
           +++ S   +LIEGIE+T R ++    ++G++ +  +   +F+P MH+AMFE P     A 
Sbjct: 100 QRAVS--GALIEGIELTMRALLDVFGKHGIQVLSPQVGDRFDPQMHEAMFEAPVPGTKAG 157

Query: 162 TIIKVVQDGYAINERVLRPALVSIS 186
            II+V  +G+ +++R+LRPA V +S
Sbjct: 158 DIIQVSAEGFMLHDRLLRPAQVGVS 182


>gi|325578788|ref|ZP_08148835.1| co-chaperone GrpE [Haemophilus parainfluenzae ATCC 33392]
 gi|325159612|gb|EGC71744.1| co-chaperone GrpE [Haemophilus parainfluenzae ATCC 33392]
          Length = 195

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 98/143 (68%), Gaps = 7/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE++N+RRR++++ + A  +++ KF++D+L+  DNL RAL + P   AN E 
Sbjct: 59  QDLLLRTRAEIDNMRRRSEQDIEKAHKFALEKFSKDILNTIDNLERAL-ATP---ANKED 114

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           ++   +K+L +G+E+T +E++ST+ R+GV+ + A    FNP++HQA+  +P +    N I
Sbjct: 115 EN---IKALFDGVELTLKELLSTVSRFGVEPVGAVGDTFNPDLHQAISMQPAEGFTTNQI 171

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY +N RV+RPA+V ++
Sbjct: 172 TTVLQKGYTLNGRVIRPAMVMVA 194


>gi|312885005|ref|ZP_07744694.1| heat shock protein GrpE [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309367337|gb|EFP94900.1| heat shock protein GrpE [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 198

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 62/148 (41%), Positives = 96/148 (64%), Gaps = 10/148 (6%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           +E +D  LR  AE+EN+RRRT+ E   A+ Y++ KFA ++L V DNL RA+ +A  D   
Sbjct: 60  QEQQDSVLRAKAEVENMRRRTEGEIDKARKYALNKFAEELLPVIDNLERAIQAADTD--- 116

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVP 159
                    K L+EG+E+T +  + T+ ++G+K+I+ + + FNP MHQAM  +E  D  P
Sbjct: 117 -----NEATKPLLEGVELTHKTFVDTVSKFGLKEINPEGETFNPEMHQAMSIQESPDHEP 171

Query: 160 ANTIIKVVQDGYAINERVLRPALVSISK 187
            NT++ V+Q GY +N RV+RPA+V ++K
Sbjct: 172 -NTVMFVMQKGYELNGRVIRPAMVMVAK 198


>gi|317049192|ref|YP_004116840.1| GrpE protein [Pantoea sp. At-9b]
 gi|316950809|gb|ADU70284.1| GrpE protein [Pantoea sp. At-9b]
          Length = 192

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 66/159 (41%), Positives = 102/159 (64%), Gaps = 11/159 (6%)

Query: 34  EESLNQSEE-FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALD 92
           E  L QS+   RD  LR  AE+EN+RRRT+ + + A  +++ KFA ++L V D+L RAL+
Sbjct: 43  EAELAQSQSGVRDAQLRAQAEIENIRRRTEMDVEKAHKFALEKFANELLPVIDSLERALE 102

Query: 93  SAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-F 151
            A  D  NSE      L S+IEGIE+T + ++  + ++GV+ +   +  FNP++HQAM  
Sbjct: 103 VA--DKENSE------LASMIEGIELTLKSLLGAVRKFGVEVVGETNVPFNPDVHQAMSM 154

Query: 152 EEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
            E  D  P N ++ V+Q GY +N R+LRPA+V+++K K+
Sbjct: 155 MESEDVAP-NHVMMVMQRGYTLNGRLLRPAMVAVAKAKS 192


>gi|126738495|ref|ZP_01754200.1| co-chaperone GrpE [Roseobacter sp. SK209-2-6]
 gi|126720294|gb|EBA17000.1| co-chaperone GrpE [Roseobacter sp. SK209-2-6]
          Length = 187

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 100/147 (68%), Gaps = 8/147 (5%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           ++++D+++R +A+ EN R+R D+ +++A++Y  +K ARDML V DNL RA++SA      
Sbjct: 43  DQYKDRFMRALADAENARKRGDKARREAENYGGSKLARDMLPVYDNLKRAVESA------ 96

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVP 159
           S+++ E V  +LIEG+E+T R ++   E++G++ +  +   +F+P MH+AMFE P     
Sbjct: 97  SDEQRE-VAAALIEGVELTMRSLLGVFEKHGIRIVSPEVGDRFDPQMHEAMFEAPVPGTK 155

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
           A  II+V  +G+ +++R+LR A V +S
Sbjct: 156 AGDIIQVSAEGFMLHDRLLRAAQVGVS 182


>gi|293391410|ref|ZP_06635744.1| co-chaperone GrpE [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290951944|gb|EFE02063.1| co-chaperone GrpE [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 192

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 99/143 (69%), Gaps = 7/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE++N+RRRT+++ + A  +++ KFA+D+L+  DNL RAL + P   AN+E 
Sbjct: 56  QDLLLRTRAEIDNIRRRTEQDIEKAHKFALEKFAKDILNTIDNLERAL-ATP---ANTED 111

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
            S   +K+L +G+E+T +E+++T+ R+G++ + A  + F+P +HQA+  +P +   +N I
Sbjct: 112 DS---VKALFDGVELTLKELLATVARFGIEPVGAVGEVFDPELHQAISMQPAEGFQSNQI 168

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY +N RV+RPA+V ++
Sbjct: 169 TAVLQKGYLLNGRVIRPAMVMVA 191


>gi|254487866|ref|ZP_05101071.1| co-chaperone GrpE [Roseobacter sp. GAI101]
 gi|214044735|gb|EEB85373.1| co-chaperone GrpE [Roseobacter sp. GAI101]
          Length = 187

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 100/145 (68%), Gaps = 8/145 (5%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            +D+++R +A+ EN R+R+D+++++A++Y  +K ARDML V DN+ RAL++       + 
Sbjct: 45  LKDRFMRALADAENARKRSDKDRREAENYGGSKLARDMLPVYDNMKRALET-------TS 97

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPAN 161
           ++  +V  +L+EGIE+T RE+++  +++G++ I  +   +F+P +HQAMFE P     A 
Sbjct: 98  EEQRTVSSALLEGIELTMRELVNVFKKHGMEVIAPEVGDRFDPQLHQAMFEAPVPGTKAG 157

Query: 162 TIIKVVQDGYAINERVLRPALVSIS 186
            II+V  +G+ +++R+LRPA V +S
Sbjct: 158 DIIQVAAEGFMLHDRLLRPAQVGVS 182


>gi|261867534|ref|YP_003255456.1| heat shock protein GrpE [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|261412866|gb|ACX82237.1| co-chaperone GrpE [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 192

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 99/143 (69%), Gaps = 7/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE++N+RRRT+++ + A  +++ KFA+D+L+  DNL RAL + P   AN+E 
Sbjct: 56  QDLLLRTRAEIDNIRRRTEQDIEKAHKFALEKFAKDILNTIDNLERAL-ATP---ANTED 111

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
            S   +K+L +G+E+T +E+++T+ R+G++ + A  + F+P +HQA+  +P +   +N I
Sbjct: 112 DS---VKALFDGVELTLKELLATVARFGIEPVGAVGEVFDPELHQAISMQPAEGFQSNQI 168

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY +N RV+RPA+V ++
Sbjct: 169 TAVLQKGYLLNGRVIRPAMVMVA 191


>gi|260582010|ref|ZP_05849805.1| co-chaperone GrpE [Haemophilus influenzae NT127]
 gi|260094900|gb|EEW78793.1| co-chaperone GrpE [Haemophilus influenzae NT127]
          Length = 232

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 98/143 (68%), Gaps = 7/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+ENLRRRT+++ + A  +++ KF++D+L+  DNL RAL + P   AN E 
Sbjct: 96  QDILLRSRAEIENLRRRTEQDVEKAHKFALEKFSKDILNTIDNLERAL-ATP---ANKED 151

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           +S   +K+L +G+E+T +E++ST+ R+GV+ +    + FNP++HQA+  +P +    N I
Sbjct: 152 ES---VKALFDGVELTLKELVSTVGRFGVEAVGVVGEAFNPDLHQAISMQPAEGFETNQI 208

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY +N RV+RPA+V ++
Sbjct: 209 SVVLQKGYTLNGRVIRPAMVMVA 231


>gi|269103346|ref|ZP_06156043.1| heat shock protein GrpE [Photobacterium damselae subsp. damselae
           CIP 102761]
 gi|268163244|gb|EEZ41740.1| heat shock protein GrpE [Photobacterium damselae subsp. damselae
           CIP 102761]
          Length = 206

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 111/190 (58%), Gaps = 16/190 (8%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPE--ESLNQSE----EFRDKYLRVIAEMENLRRRTDR 63
           ++ E     A   TAEE  E  I E   +L  SE    E +D  LR +AE EN+RRR ++
Sbjct: 21  VETESAEQEAVEMTAEELYEARIAELEAALLASEAKANEAKDSALRAMAEGENVRRRAEQ 80

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           E   A+ +++ KF+ ++L V DNL RA++ A         KS+  +K ++EG+E+T + M
Sbjct: 81  EIDKARKFALNKFSEELLPVIDNLERAIEMA--------DKSDEAIKPMLEGVELTLKTM 132

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
             T+ ++G+ +I+   + FNP  HQAM  +E  D  P N+++ V+Q GY +N RV+RPA+
Sbjct: 133 TDTVAKFGLTQINPMGEAFNPEFHQAMSIQESADHAP-NSVMFVMQKGYELNGRVIRPAM 191

Query: 183 VSISKGKTQN 192
           V +SK    N
Sbjct: 192 VMVSKAPAGN 201


>gi|209877437|ref|XP_002140160.1| GrpE family protein [Cryptosporidium muris RN66]
 gi|209555766|gb|EEA05811.1| GrpE family protein, putative [Cryptosporidium muris RN66]
          Length = 236

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 64/178 (35%), Positives = 107/178 (60%), Gaps = 8/178 (4%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPE----ESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
           +DK  N  N + +    K +I I E    E++ +++E +DK+LR +A++ENLR+R  ++ 
Sbjct: 57  LDKSNNLDNTSDTMEYLKEKIIILENDITENVKKTKETQDKFLRTLADLENLRQRHQKDL 116

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
           ++ + Y+I+ FA+ +L V DNLSRAL + P D   S+K     LKS+ +GI++T   ++ 
Sbjct: 117 ENTRIYAISNFAKSLLEVIDNLSRALSAFPSDKIQSDKN----LKSIYDGIDLTNSTLLK 172

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
             E +G+ K +   + F+P  H+ +FE   D  P  TI   +  GY I++R+LRPA V
Sbjct: 173 IFENFGIYKFECIGEIFDPKKHEVLFETIDDNKPKGTISCELLPGYTIHDRILRPAKV 230


>gi|312213136|emb|CBX93218.1| similar to mitochondrial co-chaperone GrpE [Leptosphaeria maculans]
          Length = 237

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 105/178 (58%), Gaps = 8/178 (4%)

Query: 12  KEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
           KE  PS AN   A+ K +I   E+   +  E +DKYLR +A+  NL+ RT RE K A+ +
Sbjct: 64  KEDAPSAANDEAAKLKEQI---EKKDKEIIELKDKYLRSVADFRNLQERTARETKAAKDF 120

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
           +I +FARD++   DNL RAL + P   A   K   + L +L +GI+MT   +++TL+++G
Sbjct: 121 AIQRFARDLVESVDNLDRALGTVP---AEKLKSDNADLIALHDGIKMTDTILINTLKKHG 177

Query: 132 VKKIDAKD--QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +++ D  +   KF+PN+H+A+F+ P             Q G+ +N RVLRPA V + K
Sbjct: 178 LERFDPSETGDKFDPNIHEAVFQAPQPDKEDGCCFHTQQKGFMLNGRVLRPAKVGVVK 235


>gi|298674231|ref|YP_003725981.1| GrpE protein [Methanohalobium evestigatum Z-7303]
 gi|298287219|gb|ADI73185.1| GrpE protein [Methanohalobium evestigatum Z-7303]
          Length = 204

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 70/191 (36%), Positives = 113/191 (59%), Gaps = 14/191 (7%)

Query: 13  EKNPSNANSSTAEEKSEINIPEES---LNQS-EEFRDKYLRVIAEMENLRRRTDREKKDA 68
           E N   A S    E+SE++  +E    LNQ  E+   KY R+ AE +N R+R  REK++ 
Sbjct: 17  ENNAEGAESQNLNEESEMSSKDEEIERLNQQIEDLNQKYRRLAAEYDNFRKRASREKEEL 76

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
           + Y I     D+L V DN  RAL+SA         ++ +   S+IEGIEM   +  STL 
Sbjct: 77  RKYGIENVVIDLLEVLDNFERALESA---------RNTNDTNSIIEGIEMVYNQFYSTLN 127

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           +YG++K+  + ++F+P  H+A+        P +T++ V + GYA+N +V+RPA+V++SK 
Sbjct: 128 KYGLEKLICEGEEFDPYKHEALSHVEKSENPEDTVVDVCKPGYALNSKVIRPAMVTVSK- 186

Query: 189 KTQNPTEEKKE 199
           K+++ TE++ E
Sbjct: 187 KSESETEDENE 197


>gi|126724516|ref|ZP_01740359.1| GrpE protein [Rhodobacterales bacterium HTCC2150]
 gi|126705680|gb|EBA04770.1| GrpE protein [Rhodobacterales bacterium HTCC2150]
          Length = 203

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 98/147 (66%), Gaps = 8/147 (5%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           +E +D+ +R +AE EN R+R +R+++DA+ Y  ++ ARDM+ V D + RALDS P D   
Sbjct: 59  DEMKDRLVRALAEAENTRKRGERDRRDAEKYGGSRLARDMIPVYDAMKRALDSIPGD--- 115

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI-DAKDQKFNPNMHQAMFEEPHDTVP 159
            +K+S +   S+IEGI +T +E++S  +++G+  I   +  +F+ N+HQAMFE P     
Sbjct: 116 -QKESSA---SMIEGIALTMQELLSVFKKHGITPIFPVEGDQFDANLHQAMFEAPVPGTT 171

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
           A  II+V++ G+ I++R+LR A V +S
Sbjct: 172 AGQIIQVMEQGFMIHDRLLRAANVGVS 198


>gi|294637627|ref|ZP_06715906.1| co-chaperone GrpE [Edwardsiella tarda ATCC 23685]
 gi|291089182|gb|EFE21743.1| co-chaperone GrpE [Edwardsiella tarda ATCC 23685]
          Length = 200

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 97/145 (66%), Gaps = 8/145 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LR  AEM+N+RRR +++ + A  +++ KF+ ++L V DNL RAL+ A  D +NSE 
Sbjct: 64  RDIMLRARAEMDNVRRRAEQDVEKAHKFALEKFSSELLPVIDNLERALEVA--DKSNSE- 120

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
                L S+IEG+E+T + ++  + ++GV+++   +  FNP++HQAM   P +    N +
Sbjct: 121 -----LVSMIEGVELTLKSLLDVVRKFGVEQVAEVNVPFNPDVHQAMTMLPSEEHAPNQV 175

Query: 164 IKVVQDGYAINERVLRPALVSISKG 188
           + V+Q GY +N R++RPA+V++SKG
Sbjct: 176 MMVMQKGYTLNGRLIRPAMVAVSKG 200


>gi|255081368|ref|XP_002507906.1| predicted protein [Micromonas sp. RCC299]
 gi|226523182|gb|ACO69164.1| predicted protein [Micromonas sp. RCC299]
          Length = 335

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 94/155 (60%), Gaps = 4/155 (2%)

Query: 35  ESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRA---L 91
           E   Q ++  DK LR +A+MENLR RT R+ + A+ ++I  F +D+L V+DNL+RA   +
Sbjct: 178 EKTAQVKDLNDKLLRTLADMENLRERTRRQAETAEKFAIQGFCKDLLDVADNLARASATV 237

Query: 92  DSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID-AKDQKFNPNMHQAM 150
           D   L+        ++VL SL EG+ M  +++MST  ++GV K D A+   FNPN H A+
Sbjct: 238 DPEALETETDAANIKNVLASLHEGVLMVEKQLMSTFGKHGVVKFDPAEGDPFNPNDHMAL 297

Query: 151 FEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
           F  P     A T+  V + GY +++RV+RPA V +
Sbjct: 298 FNVPKGEKEAGTVAAVTKVGYKLHDRVIRPAEVGV 332


>gi|301155918|emb|CBW15388.1| heat shock protein [Haemophilus parainfluenzae T3T1]
          Length = 191

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 98/143 (68%), Gaps = 7/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE++N+RRR++++ + A  +++ KF++D+L+  DNL RAL + P   AN E 
Sbjct: 55  QDLLLRTRAEIDNMRRRSEQDIEKAHKFALEKFSKDILNTIDNLERAL-ATP---ANKED 110

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           ++   +K+L +G+E+T +E++ST+ R+GV+ + A    FNP++HQA+  +P +    N I
Sbjct: 111 EN---IKALFDGVELTLKELLSTVSRFGVEPVGAVGDTFNPDLHQAISMQPAEGFTTNQI 167

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY +N RV+RPA+V ++
Sbjct: 168 TTVLQKGYTLNGRVIRPAMVMVA 190


>gi|171689618|ref|XP_001909749.1| hypothetical protein [Podospora anserina S mat+]
 gi|170944771|emb|CAP70882.1| unnamed protein product [Podospora anserina S mat+]
          Length = 238

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 92/150 (61%), Gaps = 2/150 (1%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           +++DKYLR +A+  NL+ RT RE K A+ ++I KFA+D++   DN  RAL   P +   S
Sbjct: 89  DWKDKYLRSVADFRNLQDRTAREMKAARDFAIQKFAKDLVDSVDNFDRALTMVPEEKLKS 148

Query: 102 EKKSESV--LKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVP 159
           E+KS  +  L +L EG++MT   ++ TL+++G+++ D     FNPN H+A F  P     
Sbjct: 149 EEKSAHLQDLVNLYEGLKMTENILLETLKKHGLERFDPHGLPFNPNEHEATFMTPMQDKE 208

Query: 160 ANTIIKVVQDGYAINERVLRPALVSISKGK 189
            NT+    Q G+ +N R+LRPA V + K K
Sbjct: 209 HNTVFHTQQKGFKLNGRILRPAKVGVVKNK 238


>gi|260776587|ref|ZP_05885482.1| heat shock protein GrpE [Vibrio coralliilyticus ATCC BAA-450]
 gi|260607810|gb|EEX34075.1| heat shock protein GrpE [Vibrio coralliilyticus ATCC BAA-450]
          Length = 204

 Score =  118 bits (295), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 111/181 (61%), Gaps = 12/181 (6%)

Query: 11  DKEKNPSNANSSTAEEKSEINIPEESLNQSE----EFRDKYLRVIAEMENLRRRTDREKK 66
           D E N +       E++S+I   E +L  SE    E +D  LR  AE+EN+RRRT+ E  
Sbjct: 32  DIEWNEATEQDEQDEQESKIAQLEAALLSSEAKVKEQQDSVLRAKAEVENMRRRTETEID 91

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
            A+ Y++ KFA ++L V DNL RA+ +A  D       +E+V K ++EG+E+T +  +  
Sbjct: 92  KARKYALNKFAEELLPVIDNLERAIQAADTD-------NEAV-KPIVEGVELTHKTFVDA 143

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           + ++G+K+I+ + + FNP MHQAM  +      +NT++ V+Q GY +N RV+RPA+V ++
Sbjct: 144 VAKFGLKEINPEGEAFNPEMHQAMSIQESPDHESNTVMFVMQKGYELNGRVIRPAMVMVA 203

Query: 187 K 187
           K
Sbjct: 204 K 204


>gi|254506755|ref|ZP_05118895.1| co-chaperone GrpE [Vibrio parahaemolyticus 16]
 gi|219550336|gb|EED27321.1| co-chaperone GrpE [Vibrio parahaemolyticus 16]
          Length = 206

 Score =  118 bits (295), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 97/147 (65%), Gaps = 8/147 (5%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           +E +D  LR  AE+EN+RRRT++E   A+ Y++ KFA ++L V DNL RA+ +A  D   
Sbjct: 68  QEQQDSVLRAKAEVENMRRRTEQEIDKARKYALNKFAEELLPVIDNLERAIQAADTD--- 124

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
                  V+K L+EG+E+T +  + T+ ++G+K+I+ + + FNP +HQAM  +      +
Sbjct: 125 -----AEVVKPLLEGVELTHKTFVDTVAKFGLKEINPEGEAFNPELHQAMSIQESPDHES 179

Query: 161 NTIIKVVQDGYAINERVLRPALVSISK 187
           NT++ V+Q GY +N RV+RPA+V ++K
Sbjct: 180 NTVMFVMQKGYELNGRVVRPAMVMVAK 206


>gi|254440319|ref|ZP_05053813.1| co-chaperone GrpE [Octadecabacter antarcticus 307]
 gi|198255765|gb|EDY80079.1| co-chaperone GrpE [Octadecabacter antarcticus 307]
          Length = 190

 Score =  117 bits (294), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 114/187 (60%), Gaps = 13/187 (6%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           ++  M+++NI  E +    +   AE+ + + +  E L    E +D Y+R +A++EN R+R
Sbjct: 11  LDDIMADQNIGPE-DEMTLDEMVAEDDNVVALKTEVL----ELKDGYMRALADVENSRKR 65

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
            DR++++A++Y  ++ ARD+L + DNL RAL     D  + +       K+L+EG+E+T 
Sbjct: 66  ADRDRREAENYGGSRLARDLLPIYDNLERALKMNKEDGKDGD-------KALLEGVELTM 118

Query: 121 REMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
           R ++   +++G+  I A+  ++F+P +H+AMFE P     A  II+V   G+ +++R+LR
Sbjct: 119 RALIGVFKKHGIDPIVAEVGERFDPQIHEAMFEAPLPETKAGDIIQVASTGFMLHDRLLR 178

Query: 180 PALVSIS 186
           PA V +S
Sbjct: 179 PAQVGVS 185


>gi|195999908|ref|XP_002109822.1| hypothetical protein TRIADDRAFT_21754 [Trichoplax adhaerens]
 gi|190587946|gb|EDV27988.1| hypothetical protein TRIADDRAFT_21754 [Trichoplax adhaerens]
          Length = 191

 Score =  117 bits (294), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 95/147 (64%), Gaps = 1/147 (0%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E RDKYLR +AE+EN+R RT R+  DA+ Y+I  F++D+++V+D L +A +S P     S
Sbjct: 45  ETRDKYLRTLAEIENMRERTVRQINDAKMYAIQNFSKDIIAVADILEKATESVPQQEIAS 104

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
              ++   KSL EG+++T  ++      +G++KI   ++KF+PN H+A+F+  +   P  
Sbjct: 105 AAANQH-FKSLYEGLKLTESQLQKVFSAHGLRKIYPINEKFDPNFHEALFQVENGEKPDG 163

Query: 162 TIIKVVQDGYAINERVLRPALVSISKG 188
           +I +V + GY ++ R LRPA+V ++K 
Sbjct: 164 SIAQVSKAGYLLHGRTLRPAMVGVTKA 190


>gi|86136766|ref|ZP_01055344.1| co-chaperone GrpE [Roseobacter sp. MED193]
 gi|85826090|gb|EAQ46287.1| co-chaperone GrpE [Roseobacter sp. MED193]
          Length = 186

 Score =  117 bits (294), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 100/147 (68%), Gaps = 8/147 (5%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           +E++D+++R +A+ EN R+R D+ +++A+ Y  +K +RD+L V DNL RA++SA      
Sbjct: 43  DEYKDRFMRALADAENSRKRGDKARREAEQYGGSKLSRDILPVFDNLKRAVESA------ 96

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVP 159
           +E++ E V  +LIEG+E+T R ++   E++GV+ +  +   +F+P +H+AMFE P     
Sbjct: 97  TEEQKE-VSAALIEGVELTMRALLGVFEKHGVRIVSPQVGDRFDPQVHEAMFEAPVPGTK 155

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
           A  II+V  +G+ +++R+LRPA V +S
Sbjct: 156 AGDIIQVSAEGFMLHDRLLRPAQVGVS 182


>gi|91793923|ref|YP_563574.1| GrpE protein [Shewanella denitrificans OS217]
 gi|123165920|sp|Q12L25|GRPE_SHEDO RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|91715925|gb|ABE55851.1| GrpE protein [Shewanella denitrificans OS217]
          Length = 201

 Score =  117 bits (294), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 54/147 (36%), Positives = 98/147 (66%), Gaps = 8/147 (5%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E +D  +R  AE +N+R R  ++ + A+ +++ KFA ++L V DN+ RAL        N 
Sbjct: 55  ERKDVEMRAAAETQNIRTRAAKDVEQARKFALEKFANELLPVIDNMERALQGT-----NP 109

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
           E ++    K++ EG+E+T +  ++++E++GVK+++ + + FNP+ HQA+  +P    PAN
Sbjct: 110 EDEAT---KAIYEGVELTMKGFLTSVEKFGVKQVNPQGETFNPDHHQAIGMQPSPDFPAN 166

Query: 162 TIIKVVQDGYAINERVLRPALVSISKG 188
           T++ V+Q GY +N+R+LRPA+V +S+G
Sbjct: 167 TVMMVMQKGYLLNDRLLRPAMVMVSQG 193


>gi|309972794|gb|ADO95995.1| Hsp 24 nucleotide exchange factor GrpE [Haemophilus influenzae
           R2846]
          Length = 230

 Score =  117 bits (294), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 58/143 (40%), Positives = 98/143 (68%), Gaps = 7/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+ENLRRRT+++ + A  +++ KF++D+L+  DNL RAL + P   AN E 
Sbjct: 94  QDILLRSRAEIENLRRRTEQDVEKAHKFALEKFSKDILNTIDNLERAL-ATP---ANKED 149

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           +S   +K+L +G+E+T +E++ST+ R+GV+ +    + FNP++HQA+  +P +    N I
Sbjct: 150 ES---VKALFDGVELTLKELVSTVGRFGVEAVGVVGEAFNPDLHQAISMQPAEGFETNQI 206

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY ++ RV+RPA+V ++
Sbjct: 207 SVVLQKGYTLSGRVIRPAMVMVA 229


>gi|255638729|gb|ACU19669.1| unknown [Glycine max]
          Length = 290

 Score =  117 bits (294), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 98/152 (64%), Gaps = 5/152 (3%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           E+ +DK LR  AEMEN+  RT RE ++++ ++I  FA+ +L V+DNL RA      + + 
Sbjct: 130 EKMQDKVLRTYAEMENVMDRTRREAENSKKFAIQNFAKSLLDVADNLGRASSVVKDNFSK 189

Query: 101 SEKKSES-----VLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPH 155
            E   ES     +LK+L+EG+EMT +++   L+++GV+K D  ++ F+P+MH A+F+ P 
Sbjct: 190 IESPEESSEAAQLLKTLLEGVEMTEKQLAEVLKKFGVEKFDPTNEPFDPHMHNAIFQIPD 249

Query: 156 DTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            +    T+  V++ GY + +RVLRPA V +++
Sbjct: 250 ASKAPGTVGVVLKAGYKLYDRVLRPAEVGVTQ 281


>gi|309750609|gb|ADO80593.1| Hsp 24 nucleotide exchange factor GrpE [Haemophilus influenzae
           R2866]
          Length = 230

 Score =  117 bits (294), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 58/143 (40%), Positives = 98/143 (68%), Gaps = 7/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+ENLRRRT+++ + A  +++ KF++D+L+  DNL RAL + P   AN E 
Sbjct: 94  QDILLRSRAEIENLRRRTEQDVEKAHKFALEKFSKDILNTIDNLERAL-ATP---ANKED 149

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           +S   +K+L +G+E+T +E++ST+ R+GV+ +    + FNP++HQA+  +P +    N I
Sbjct: 150 ES---VKALFDGVELTLKELVSTVGRFGVEAVGVVGEAFNPDLHQAISMQPAEGFETNQI 206

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY ++ RV+RPA+V ++
Sbjct: 207 SVVLQKGYTLSGRVIRPAMVMVA 229


>gi|330447335|ref|ZP_08310984.1| grpE domain protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328491526|dbj|GAA05481.1| grpE domain protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 204

 Score =  117 bits (294), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 100/155 (64%), Gaps = 10/155 (6%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           Q+ E +D  LR  AE EN+RRR+++E   A+ Y++ KFA ++L V DNL RAL+ A    
Sbjct: 54  QANEAKDMALRARAEGENVRRRSEQEIDKARKYALNKFAEELLPVIDNLERALEMA---- 109

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDT 157
              +K  ES  K+++EG+E+T + M  T+ ++G+ +I+ + + FNP  HQAM  +E  + 
Sbjct: 110 ---DKTDESS-KAMMEGVELTLKTMTDTVAKFGLTQINPQGEAFNPEFHQAMAIQESTEF 165

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISKGKTQN 192
            P NT++ V+Q GY +N RV+RPA+V +SK    N
Sbjct: 166 AP-NTVMMVMQKGYELNGRVIRPAMVMVSKAAAGN 199


>gi|259417105|ref|ZP_05741024.1| co-chaperone GrpE [Silicibacter sp. TrichCH4B]
 gi|259346011|gb|EEW57825.1| co-chaperone GrpE [Silicibacter sp. TrichCH4B]
          Length = 187

 Score =  117 bits (294), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 54/147 (36%), Positives = 99/147 (67%), Gaps = 8/147 (5%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           +E++D+++R +A+ EN R+R D+ +++A+ Y  +K ARDML V DN+ RA+++     A 
Sbjct: 43  DEYKDRFMRALADAENARKRGDKARREAEQYGGSKLARDMLPVYDNMKRAVEA-----AT 97

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVP 159
            E+K+ S   +LIEG+E+T R ++   +++G++ +  +   +F+P +H+AMFE P     
Sbjct: 98  EEQKAVSA--ALIEGVELTMRALLDVFQKHGIQVVTPEVGDRFDPQVHEAMFEAPVPGTK 155

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
           A  II+V  +G+ +++R+LRPA V +S
Sbjct: 156 AGDIIQVSAEGFMLHDRLLRPAQVGVS 182


>gi|322834140|ref|YP_004214167.1| GrpE protein [Rahnella sp. Y9602]
 gi|321169341|gb|ADW75040.1| GrpE protein [Rahnella sp. Y9602]
          Length = 195

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/147 (40%), Positives = 94/147 (63%), Gaps = 8/147 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LR  AE+EN+RRRT+++ + A  +++ KF+ ++L V DNL RALD A  D +NSE 
Sbjct: 57  RDSLLRAKAEVENIRRRTEQDIEKAHKFALEKFSGELLPVIDNLERALDLA--DKSNSE- 113

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
                L  LIEG+E+T + ++  + ++G++ +      FNP +HQAM     D +  N +
Sbjct: 114 -----LAGLIEGVELTLKSLLDAVRKFGMEVVADIHVPFNPELHQAMTMMESDELEPNHV 168

Query: 164 IKVVQDGYAINERVLRPALVSISKGKT 190
           + V+Q GY +N R+LRPA+V++SK K 
Sbjct: 169 MMVMQKGYTLNGRLLRPAMVAVSKAKA 195


>gi|297170564|gb|ADI21591.1| molecular chaperone GrpE (heat shock protein) [uncultured
           Oceanospirillales bacterium HF0130_06B06]
          Length = 205

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 97/150 (64%), Gaps = 9/150 (6%)

Query: 40  SEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLA 99
           +E  +D  LRV AEM+NLRRRT+++ + A  Y I KF+ ++L V DNL RAL SA     
Sbjct: 64  AERAKDDLLRVQAEMQNLRRRTEQDVEKAHKYGIEKFSAELLVVMDNLERALTSA----- 118

Query: 100 NSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMF-EEPHDTV 158
            SE K ESV K++ +G+ +T +       ++ +  +D   + F+P +HQA+  +E  D+ 
Sbjct: 119 -SESKDESV-KAIQDGVSLTLKSFNDCFAKFSIVAVDPLGEPFDPQLHQAIATQESPDSE 176

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISKG 188
           P N++I+V+Q GY +N RV+RPA+V +SKG
Sbjct: 177 P-NSVIEVIQKGYTLNGRVIRPAMVMVSKG 205


>gi|145636722|ref|ZP_01792388.1| anaerobic ribonucleoside triphosphate reductase [Haemophilus
           influenzae PittHH]
 gi|145639639|ref|ZP_01795242.1| anaerobic ribonucleoside triphosphate reductase [Haemophilus
           influenzae PittII]
 gi|145270020|gb|EDK09957.1| anaerobic ribonucleoside triphosphate reductase [Haemophilus
           influenzae PittHH]
 gi|145271196|gb|EDK11110.1| anaerobic ribonucleoside triphosphate reductase [Haemophilus
           influenzae PittII]
          Length = 234

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/143 (40%), Positives = 98/143 (68%), Gaps = 7/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+ENLRRRT+++ + A  +++ KF++D+L+  DNL RAL + P   AN E 
Sbjct: 98  QDILLRSRAEIENLRRRTEQDVEKAHKFALEKFSKDILNTIDNLERAL-ATP---ANKED 153

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           +S   +K+L +G+E+T +E++ST+ R+GV+ +    + FNP++HQA+  +P +    N I
Sbjct: 154 ES---VKALFDGVELTLKELVSTVGRFGVEAVGVVGEAFNPDLHQAISMQPAEGFETNQI 210

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY ++ RV+RPA+V ++
Sbjct: 211 SVVLQKGYTLSGRVIRPAMVMVA 233


>gi|148825648|ref|YP_001290401.1| heat shock protein GrpE [Haemophilus influenzae PittEE]
 gi|229846992|ref|ZP_04467098.1| anaerobic ribonucleoside triphosphate reductase [Haemophilus
           influenzae 7P49H1]
 gi|148715808|gb|ABQ98018.1| anaerobic ribonucleoside triphosphate reductase [Haemophilus
           influenzae PittEE]
 gi|229810076|gb|EEP45796.1| anaerobic ribonucleoside triphosphate reductase [Haemophilus
           influenzae 7P49H1]
          Length = 234

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/143 (40%), Positives = 98/143 (68%), Gaps = 7/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+ENLRRRT+++ + A  +++ KF++D+L+  DNL RAL + P   AN E 
Sbjct: 98  QDILLRSRAEIENLRRRTEQDVEKAHKFALEKFSKDILNTIDNLERAL-ATP---ANKED 153

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           +S   +K+L +G+E+T +E++ST+ R+GV+ +    + FNP++HQA+  +P +    N I
Sbjct: 154 ES---VKALFDGVELTLKELVSTVGRFGVEAVGVVGEAFNPDLHQAISMQPAEGFETNQI 210

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY ++ RV+RPA+V ++
Sbjct: 211 SVVLQKGYTLSGRVIRPAMVMVA 233


>gi|58039286|ref|YP_191250.1| GrpE protein (HSP-70 cofactor) [Gluconobacter oxydans 621H]
 gi|58001700|gb|AAW60594.1| GrpE protein (HSP-70 cofactor) [Gluconobacter oxydans 621H]
          Length = 221

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 111/192 (57%), Gaps = 10/192 (5%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPE---ESLN-QSEEFRDKYLRVIAEMENLRRR 60
           + E+ ++   + +   + T  E  E   PE   E+L  Q  E +D+++R  AE +N+R R
Sbjct: 25  VPEQGVETSGHETPGMNETGGETLEETTPEARIEALEAQVAELKDRWVRSEAESQNIRAR 84

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKS-LIEGIEMT 119
             R+ +DA+ Y+I KFARD++  ++NL R L S P     ++ + E VL + L EGIE T
Sbjct: 85  AKRDIEDARQYAIQKFARDVVEAAENLQRGLASLP-----AKTEGEDVLITKLREGIEGT 139

Query: 120 RREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
            R  ++ LER+G+   D   + F+ N+HQAM E+P D  P+  +++     + +  R+L+
Sbjct: 140 ERSFINILERHGITCEDPTGKPFDANLHQAMAEQPSDQHPSGHVMQSWTPAWLLKGRLLK 199

Query: 180 PALVSISKGKTQ 191
           PA+V ++KG  Q
Sbjct: 200 PAMVVVAKGGAQ 211


>gi|224000333|ref|XP_002289839.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220975047|gb|EED93376.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 178

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 93/149 (62%), Gaps = 1/149 (0%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           Q ++ +D  LR +AE EN RR   R+   A+S++I+ FA+ +L  SDNLSRALD+ P +L
Sbjct: 29  QVKDLKDNLLRSLAEQENTRRIAKRDVDQARSFAISSFAKSLLDTSDNLSRALDAVPEEL 88

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
            + + ++  VL +L EGI MT   +     + G+KK     +KF+PN H+A+FE P    
Sbjct: 89  RH-DHENHPVLANLYEGISMTDEGLTKAFAKNGLKKFGVPGEKFDPNKHEALFEYPDPNG 147

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISK 187
            A  I +V++ G+ +N+RV+RPA V + K
Sbjct: 148 EAGNIGQVMKVGFMLNDRVVRPAEVGVVK 176


>gi|254456136|ref|ZP_05069565.1| co-chaperone GrpE [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083138|gb|EDZ60564.1| co-chaperone GrpE [Candidatus Pelagibacter sp. HTCC7211]
          Length = 210

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 70/167 (41%), Positives = 101/167 (60%), Gaps = 9/167 (5%)

Query: 21  SSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDM 80
           SS  EEK EI+ PEE ++   E  DK  R  AEMEN RRR ++EK DA  Y    FA++ 
Sbjct: 33  SSGTEEKKEIS-PEEKIS---ELEDKLARTFAEMENQRRRFEKEKNDAFDYGGFAFAKEA 88

Query: 81  LSVSDNLSRALDSAPLDLANSEK-KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKD 139
           L++ DNL+R+     L L N E  K+   LK  +E  ++  ++++ST  +  +K ID  +
Sbjct: 89  LNLIDNLTRS----KLILENDETLKNTEALKKTLEHFDIIEKDLISTFNKNNIKPIDCLN 144

Query: 140 QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           +K +PN+HQAM E   D     TII+ VQ G+ I +R+LRP+LV +S
Sbjct: 145 KKLDPNLHQAMMEIEDDQKEPGTIIQEVQKGFMIKDRLLRPSLVGVS 191


>gi|329114977|ref|ZP_08243732.1| Protein GrpE [Acetobacter pomorum DM001]
 gi|326695420|gb|EGE47106.1| Protein GrpE [Acetobacter pomorum DM001]
          Length = 210

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 61/153 (39%), Positives = 96/153 (62%), Gaps = 5/153 (3%)

Query: 37  LNQS-EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAP 95
           L QS  EF++K+LR  AE +NLR R  R+  DA+ Y++ KFARD++  ++NL RAL S P
Sbjct: 61  LEQSVAEFKEKWLRSEAENQNLRARAKRDLDDARQYAVQKFARDVVEAAENLRRALASLP 120

Query: 96  LDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPH 155
                +++  +SVL  + EGIE T R  +S LER+G+K  D   + F+ N+HQAM E+P 
Sbjct: 121 ----PAQEGEDSVLTKMREGIESTERSFISILERHGIKCDDPAGKPFDANLHQAMAEQPS 176

Query: 156 DTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
                 T+++     + ++ R+L+PA+V ++K 
Sbjct: 177 AEHEPGTVMQAWTPTWTLHGRLLKPAMVVVAKA 209


>gi|329123082|ref|ZP_08251652.1| co-chaperone GrpE [Haemophilus aegyptius ATCC 11116]
 gi|327471637|gb|EGF17079.1| co-chaperone GrpE [Haemophilus aegyptius ATCC 11116]
          Length = 234

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/143 (39%), Positives = 97/143 (67%), Gaps = 7/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+ENLRRRT+++ + A  +++ KF++D+L+  DNL RAL +     AN E 
Sbjct: 98  QDILLRSRAEIENLRRRTEQDVEKAHKFALEKFSKDILNTIDNLERALATP----ANKED 153

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           +S   +K+L +G+E+T +E++ST+ R+GV+ +    + FNP++HQA+  +P +    N I
Sbjct: 154 ES---VKALFDGVELTLKELVSTVGRFGVEAVGVVGEAFNPDLHQAISMQPAEGFETNQI 210

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY ++ RV+RPA+V ++
Sbjct: 211 SVVLQKGYTLSGRVIRPAMVMVA 233


>gi|68248623|ref|YP_247735.1| heat shock protein GrpE [Haemophilus influenzae 86-028NP]
 gi|68056822|gb|AAX87075.1| GrpE [Haemophilus influenzae 86-028NP]
          Length = 234

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/143 (39%), Positives = 97/143 (67%), Gaps = 7/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+ENLRRRT+++ + A  +++ KF++D+L+  DNL RAL +     AN E 
Sbjct: 98  QDILLRSRAEIENLRRRTEQDVEKAHKFALEKFSKDILNTIDNLERALATP----ANKED 153

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           +S   +K+L +G+E+T +E++ST+ R+GV+ +    + FNP++HQA+  +P +    N I
Sbjct: 154 ES---VKALFDGVELTLKELVSTVGRFGVEAVGVVGEAFNPDLHQAISMQPAEGFETNQI 210

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY ++ RV+RPA+V ++
Sbjct: 211 SVVLQKGYTLSGRVIRPAMVMVA 233


>gi|332162707|ref|YP_004299284.1| heat shock protein GrpE [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|318606815|emb|CBY28313.1| heat shock protein GrpE [Yersinia enterocolitica subsp. palearctica
           Y11]
 gi|325666937|gb|ADZ43581.1| heat shock protein GrpE [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|330859471|emb|CBX69815.1| protein grpE [Yersinia enterocolitica W22703]
          Length = 192

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/148 (40%), Positives = 97/148 (65%), Gaps = 10/148 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           R+  LR  AE+EN+RRRT+++ + A  +++ KF+ ++L V DNL RALD+A  D  N+E 
Sbjct: 54  RESLLRAKAEVENIRRRTEQDVEKAHKFALEKFSAELLPVIDNLERALDTA--DKTNAE- 110

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                L ++IEG+E+T + ++  + +YG++ +   +  FNP +HQAM   E  D  P N 
Sbjct: 111 -----LTAMIEGVELTLKSLLDAVGKYGIQVVSETNVPFNPEVHQAMTMLESADHEP-NH 164

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ V+Q GY +N R+LRPA+V++SK K 
Sbjct: 165 VMMVMQKGYTLNGRLLRPAMVAVSKAKA 192


>gi|123441346|ref|YP_001005333.1| heat shock protein GrpE [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|166215291|sp|A1JKI6|GRPE_YERE8 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|122088307|emb|CAL11098.1| heat shock protein GrpE [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 192

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/148 (40%), Positives = 97/148 (65%), Gaps = 10/148 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           R+  LR  AE+EN+RRRT+++ + A  +++ KF+ ++L V DNL RALD+A  D  N+E 
Sbjct: 54  RESLLRAKAEVENIRRRTEQDVEKAHKFALEKFSAELLPVIDNLERALDTA--DKTNAE- 110

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                L ++IEG+E+T + ++  + +YG++ +   +  FNP +HQAM   E  D  P N 
Sbjct: 111 -----LAAMIEGVELTLKSLLDAVGKYGIQVVSETNVPFNPEVHQAMTMLESADHEP-NH 164

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ V+Q GY +N R+LRPA+V++SK K 
Sbjct: 165 VMMVMQKGYTLNGRLLRPAMVAVSKAKA 192


>gi|85708634|ref|ZP_01039700.1| molecular chaperone GrpE [Erythrobacter sp. NAP1]
 gi|85690168|gb|EAQ30171.1| molecular chaperone GrpE [Erythrobacter sp. NAP1]
          Length = 195

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/141 (41%), Positives = 91/141 (64%), Gaps = 7/141 (4%)

Query: 47  YLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSE 106
           Y R  AE +N+RRR +++  DA++Y+   FARD+LSV DNLSRA+D+ P  L   +K   
Sbjct: 59  YAR--AETQNVRRRAEKDIADARNYAATGFARDILSVWDNLSRAVDAIPDSLREDDK--- 113

Query: 107 SVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKV 166
             +K L+ GIE T+RE+    +++GV+++ A     +PN HQAM E P       T+I+ 
Sbjct: 114 --MKGLVTGIEATQRELEKVFKQHGVERVAAVGLPLDPNQHQAMMEIPSADHEPGTVIQE 171

Query: 167 VQDGYAINERVLRPALVSISK 187
           +Q G+ I +R+LRPA+V ++K
Sbjct: 172 MQSGWMIKDRLLRPAMVGVAK 192


>gi|114330432|ref|YP_746654.1| GrpE protein [Nitrosomonas eutropha C91]
 gi|122314549|sp|Q0AIY2|GRPE_NITEC RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|114307446|gb|ABI58689.1| GrpE protein [Nitrosomonas eutropha C91]
          Length = 196

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 105/178 (58%), Gaps = 16/178 (8%)

Query: 17  SNANSSTAEEKSEINIPEESLNQSE----EFRDKYLRVIAEMENLRRRTDREKKDAQSYS 72
           S  N+  AEE   I   E+ L ++E    E  D +LR  AE EN+R+R   +  +A  Y+
Sbjct: 30  STENTERAEEGVVIPDLEQQLKEAEIRAAEHHDAWLRAKAETENIRKRAQTDIANAHKYA 89

Query: 73  IAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGV 132
           I  FA  +L+V D+L  AL               S ++SL +G+E+TR+++ +  E++ +
Sbjct: 90  IDNFATQLLAVMDSLDAAL-----------AVENSTIESLKDGVELTRKQLAAVFEKFNI 138

Query: 133 KKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
             I+ + +KF+P+ H+AM     D +P NT+ +V+Q GY ++ERV+RPA+V++SK K+
Sbjct: 139 HTINPQGEKFDPHQHEAMCTVESD-IPPNTVTQVMQKGYVLHERVIRPAMVAVSKAKS 195


>gi|297181545|gb|ADI17731.1| molecular chaperone grpe (heat shock protein) [uncultured
           Oceanospirillales bacterium HF0130_25G24]
          Length = 205

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 97/150 (64%), Gaps = 9/150 (6%)

Query: 40  SEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLA 99
           +E  +D  LRV AEM+NLRRRT+++ + A  Y I KF+ ++L V DNL RAL SA     
Sbjct: 64  AERAKDDLLRVQAEMQNLRRRTEQDVEKAHKYGIEKFSVELLVVMDNLERALTSA----- 118

Query: 100 NSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMF-EEPHDTV 158
            SE K ESV K++ +G+ +T +       ++ +  +D   + F+P +HQA+  +E  D+ 
Sbjct: 119 -SESKDESV-KAIQDGVSLTLKSFNDCFAKFSIVAVDPLGEPFDPQLHQAIATQESPDSE 176

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISKG 188
           P N++I+V+Q GY +N RV+RPA+V +SKG
Sbjct: 177 P-NSVIEVIQKGYTLNGRVIRPAMVMVSKG 205


>gi|302923480|ref|XP_003053685.1| hypothetical protein NECHADRAFT_98880 [Nectria haematococca mpVI
           77-13-4]
 gi|256734626|gb|EEU47972.1| hypothetical protein NECHADRAFT_98880 [Nectria haematococca mpVI
           77-13-4]
          Length = 247

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 105/177 (59%), Gaps = 5/177 (2%)

Query: 13  EKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYS 72
           EK+ +    + AE K  +   E    ++ +++DK LR +A+  NL+ RT RE K A+ ++
Sbjct: 72  EKSTNGETDAVAELKKALEAKE---TEARDWKDKCLRTVADFRNLQERTQREVKTARDFA 128

Query: 73  IAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESV--LKSLIEGIEMTRREMMSTLERY 130
           I KFA+D++   DNL RAL   P +  N ++K E +  L +L EG++MT   +MSTL+++
Sbjct: 129 IQKFAKDLVDSVDNLDRALGMVPQEKLNVDEKPEHLQDLANLYEGLKMTEDILMSTLKKH 188

Query: 131 GVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           G+++ + +  KFNPN  +A F  P      NT+  V Q G+ +N RVLR A V + K
Sbjct: 189 GLERTNPEGDKFNPNEQEATFMAPQPDKEDNTVFFVQQKGFKLNGRVLRAAKVGVVK 245


>gi|90416141|ref|ZP_01224073.1| heat shock protein GrpE [marine gamma proteobacterium HTCC2207]
 gi|90331866|gb|EAS47080.1| heat shock protein GrpE [marine gamma proteobacterium HTCC2207]
          Length = 195

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 94/150 (62%), Gaps = 8/150 (5%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           Q  E  D+ LRV AEM+N+RRR +R+ ++A  Y++ KF+ D+L V DNL RAL S     
Sbjct: 53  QVTEANDQVLRVQAEMQNVRRRVERDVENAHKYALDKFSADLLPVVDNLERALSSIS--- 109

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
           A+ E +     K++ EGIE+T +  +  L R+ ++ +D   Q F+ N+HQA+   P+  +
Sbjct: 110 ADDEGQ-----KAVAEGIELTLKSFVDVLARFKIEPVDPAGQPFDANLHQAVSMVPNPDL 164

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISKG 188
             NT++ V Q GY +N R++RPA+V +SK 
Sbjct: 165 EPNTVMDVFQKGYTLNGRLIRPAMVIVSKA 194


>gi|289741947|gb|ADD19721.1| molecular chaperone [Glossina morsitans morsitans]
          Length = 237

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 105/174 (60%), Gaps = 4/174 (2%)

Query: 15  NPSNANSSTAEEKSEINIPEESLN-QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
           NP++     A++   +    ESL  Q+ +  DKY R +AE ENLR R  ++  DA+ + I
Sbjct: 67  NPADQIKKLAQDLEVLGKEVESLKEQNIQLLDKYRRSLAESENLRSRLSKQIADAKLFGI 126

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
             F +++L V+D L  A +S P +    +      LKSL EG+ MT+  +    +R+G++
Sbjct: 127 QGFCKELLDVADILGHATNSVPQEELTDKNPH---LKSLYEGLSMTQASLFQVFKRHGLE 183

Query: 134 KIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            ++   +KF+PN+H+A+F++   +V  NTII+V + GY ++ RV+RPALV +SK
Sbjct: 184 TMNPLKEKFDPNLHEALFQKEDSSVDPNTIIEVTKLGYKLHNRVIRPALVGVSK 237


>gi|296412896|ref|XP_002836155.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295629962|emb|CAZ80346.1| unnamed protein product [Tuber melanosporum]
          Length = 255

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/169 (35%), Positives = 105/169 (62%), Gaps = 3/169 (1%)

Query: 11  DKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQS 70
           D++++P +AN  T E ++     EE   ++ +++D++ R  A+  NL+ RT+REKK A+ 
Sbjct: 78  DQQRSPEDANELTKEVETLKKDVEERAKEARDYKDRFQRAAADFRNLQDRTEREKKIARD 137

Query: 71  YSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERY 130
           ++I KFA+D++   DNL RAL + P +    E K    L +L  G++MT   +++TL+R+
Sbjct: 138 FAIQKFAKDLVESVDNLDRALSAVPAESRTEENKD---LMNLYNGLKMTEEILLNTLKRH 194

Query: 131 GVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
           G++K+D   + F+PN H+A+F+ P       T+  V Q G+A+N R +R
Sbjct: 195 GLEKVDPMGEAFDPNKHEAVFQVPMPDKEPGTVFNVQQTGFALNGRTIR 243


>gi|221134953|ref|ZP_03561256.1| heat shock protein GrpE [Glaciecola sp. HTCC2999]
          Length = 217

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 63/155 (40%), Positives = 104/155 (67%), Gaps = 11/155 (7%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR +AE EN +RR + E + A+ +++ +FA D+L V DNL  A+  A       ++
Sbjct: 72  KDGALRAVAEGENAKRRAEAEIEKARKFALERFAGDLLPVIDNLENAIRFA-------DR 124

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
           ++E+ LK +++GI+MT++  +ST+E+ G++ ++ + + FNP+ HQAM  +E  D  P NT
Sbjct: 125 ENET-LKPILDGIDMTQKSFISTVEKNGLEVLNPEGEAFNPDQHQAMSMQESADVAP-NT 182

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKTQNPTEEK 197
           ++ V+Q GY IN R+LRPA+V +SK  TQ+ TE K
Sbjct: 183 VLAVMQKGYVINGRLLRPAMVMVSKAPTQD-TEAK 216


>gi|308272163|emb|CBX28770.1| Protein grpE [uncultured Desulfobacterium sp.]
          Length = 208

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 113/203 (55%), Gaps = 24/203 (11%)

Query: 5   MSEKN-----IDKEKNPSNANSSTAEEKSEINIPE------ESLNQSE----EFRDKYLR 49
           M++KN     ID +  P+   +   E K+E  IP+      E L  +E    +  +++LR
Sbjct: 14  MTDKNKIDISIDSD-GPNEETTDKCEMKNETKIPDTIEELKEKLKNAELEAKQSYERFLR 72

Query: 50  VIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVL 109
           V A+ EN ++R+ RE  + + Y+      ++L V DNL RA++S+  D        E V 
Sbjct: 73  VSADFENYKKRSSREVSEFKKYANESILSELLCVMDNLERAINSSATD--------EKVN 124

Query: 110 KSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQD 169
             +++G+++T  E     E YGVK I++  + F+PN HQAM +E  D  P NT++   Q 
Sbjct: 125 SCIVDGVKITLNEFKKVFENYGVKPIESLCKPFDPNFHQAMMQEETDEHPENTVMSEFQK 184

Query: 170 GYAINERVLRPALVSISKGKTQN 192
           GY I++R+LRP++V +SK KT N
Sbjct: 185 GYTIHDRLLRPSMVVVSKAKTDN 207


>gi|304311947|ref|YP_003811545.1| HSP-70 cofactor [gamma proteobacterium HdN1]
 gi|301797680|emb|CBL45902.1| HSP-70 cofactor [gamma proteobacterium HdN1]
          Length = 180

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 96/153 (62%), Gaps = 9/153 (5%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           E++ + +   +D+ LRV AEM+NLRRR DR+ ++A+ +++ KF+ D+L V DNL R L +
Sbjct: 33  EQTRSGAANLQDQLLRVSAEMQNLRRRADRDVENARKFALEKFSTDLLPVVDNLERGLQA 92

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
           A  D A+   +         EG+E+T R +M  L ++GV+ +D   Q F+P +H+AM   
Sbjct: 93  AGTDEAHIAVR---------EGVELTLRLLMDVLRKHGVEVVDPIGQAFDPALHEAMSMA 143

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           P      NT++ V+Q GY ++ R++RPA+V ++
Sbjct: 144 PSPDHAPNTVMAVLQKGYTLSGRLVRPAMVIVA 176


>gi|258541388|ref|YP_003186821.1| heat shock protein GrpE [Acetobacter pasteurianus IFO 3283-01]
 gi|256632466|dbj|BAH98441.1| heat shock protein GrpE [Acetobacter pasteurianus IFO 3283-01]
 gi|256635523|dbj|BAI01492.1| heat shock protein GrpE [Acetobacter pasteurianus IFO 3283-03]
 gi|256638578|dbj|BAI04540.1| heat shock protein GrpE [Acetobacter pasteurianus IFO 3283-07]
 gi|256641632|dbj|BAI07587.1| heat shock protein GrpE [Acetobacter pasteurianus IFO 3283-22]
 gi|256644687|dbj|BAI10635.1| heat shock protein GrpE [Acetobacter pasteurianus IFO 3283-26]
 gi|256647742|dbj|BAI13683.1| heat shock protein GrpE [Acetobacter pasteurianus IFO 3283-32]
 gi|256650795|dbj|BAI16729.1| heat shock protein GrpE [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256653786|dbj|BAI19713.1| heat shock protein GrpE [Acetobacter pasteurianus IFO 3283-12]
          Length = 198

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 94/149 (63%), Gaps = 4/149 (2%)

Query: 40  SEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLA 99
           + +F++K+LR  AE +NLR R  R+  DA+ Y++ KFARD++  ++NL RAL S P    
Sbjct: 53  AADFKEKWLRSEAENQNLRARAKRDLDDARQYAVQKFARDVVEAAENLRRALASLP---- 108

Query: 100 NSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVP 159
            +++  +SVL  + EGIE T R  +S LER+G+K  D   + F+ N+HQAM E+P     
Sbjct: 109 PAQEGEDSVLTKMREGIESTERSFISILERHGIKCDDPAGKPFDANLHQAMAEQPSPEHE 168

Query: 160 ANTIIKVVQDGYAINERVLRPALVSISKG 188
             T+++     + ++ R+L+PA+V ++K 
Sbjct: 169 PGTVMQAWTPTWTLHGRLLKPAMVVVAKA 197


>gi|170727814|ref|YP_001761840.1| heat shock protein GrpE [Shewanella woodyi ATCC 51908]
 gi|226737183|sp|B1KQY9|GRPE_SHEWM RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|169813161|gb|ACA87745.1| GrpE protein [Shewanella woodyi ATCC 51908]
          Length = 209

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 107/182 (58%), Gaps = 16/182 (8%)

Query: 17  SNANSSTAEEKSEINIPEESLNQS--------EEFRDKYLRVIAEMENLRRRTDREKKDA 68
            N  +S  +E ++ N   E L Q+        EE +D   R  A   N+RRR  ++ + A
Sbjct: 30  GNDEASLMDELTQANFRVEELEQALAEANAKIEEQKDSVTRAAASEANIRRRAAQDVEKA 89

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
             +++ KFA ++L V DN+ RAL        N+E +     K++ EG+E+T +  +ST++
Sbjct: 90  HKFALEKFANELLPVIDNMERALQGT-----NAEAEE---TKAIYEGVELTLKSFVSTVD 141

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           ++G+K+++   + FNP  HQA+  +P    PANT++ V+Q GY +N+R+LRPA+V +S+G
Sbjct: 142 KFGLKEVNPHGESFNPEHHQAIGMQPSPEFPANTVMMVMQKGYILNDRLLRPAMVMVSQG 201

Query: 189 KT 190
            +
Sbjct: 202 GS 203


>gi|307129654|ref|YP_003881670.1| heat shock protein [Dickeya dadantii 3937]
 gi|306527183|gb|ADM97113.1| heat shock protein [Dickeya dadantii 3937]
          Length = 195

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 64/158 (40%), Positives = 98/158 (62%), Gaps = 11/158 (6%)

Query: 34  EESLNQSEEF-RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALD 92
           E  LN +++  R+  LR  AEMEN+RRR + + + A  +++ KFA +ML V DNL RAL+
Sbjct: 46  EAQLNDAQQRERESALRARAEMENIRRRAELDVEKAHKFALEKFAGEMLPVIDNLERALE 105

Query: 93  SAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-F 151
            A         KS   L  +IEG+E+T + M+S + ++G++ +   +  FNP +HQAM  
Sbjct: 106 MA--------DKSNEALSGMIEGVELTLKAMLSAVNKFGIEVVADVNVPFNPEIHQAMTL 157

Query: 152 EEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
            E  D  P N ++ V+Q GY +N R+LRPA+V++SK K
Sbjct: 158 LESADHAP-NHVMMVMQKGYTLNGRLLRPAMVAVSKAK 194


>gi|152997962|ref|YP_001342797.1| GrpE protein [Marinomonas sp. MWYL1]
 gi|150838886|gb|ABR72862.1| GrpE protein [Marinomonas sp. MWYL1]
          Length = 192

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 97/151 (64%), Gaps = 9/151 (5%)

Query: 36  SLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAP 95
           +L +  ++++  LR  A+ +N+RRR +++ + A  + + KFA+ +++V+DNL RAL SAP
Sbjct: 48  ALEEVAQYKEAALRAHADAQNVRRRAEQDVEKAHKFGLEKFAKSIVNVADNLERALASAP 107

Query: 96  LDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPH 155
            D    +         + EG+E+T ++++ TL R+ VK +D   + FNP +HQA+   P+
Sbjct: 108 -DTGEPD--------PVREGVELTLKDLLETLARFEVKMVDPHGEPFNPELHQAITMVPN 158

Query: 156 DTVPANTIIKVVQDGYAINERVLRPALVSIS 186
             + ANT++ VVQ GY IN R+LRPA+V +S
Sbjct: 159 PELEANTVMDVVQKGYTINGRLLRPAMVVVS 189


>gi|238762782|ref|ZP_04623751.1| hypothetical protein ykris0001_9610 [Yersinia kristensenii ATCC
           33638]
 gi|238699087|gb|EEP91835.1| hypothetical protein ykris0001_9610 [Yersinia kristensenii ATCC
           33638]
          Length = 192

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 60/148 (40%), Positives = 96/148 (64%), Gaps = 10/148 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           R+  LR  AE+EN+RRRT+++ + A  +++ KF+ ++L V DNL RALD+A  D  N E 
Sbjct: 54  RESLLRAKAEVENIRRRTEQDVEKAHKFALEKFSSELLPVIDNLERALDTA--DKTNEE- 110

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                L ++IEG+E+T + ++  + +YG++ +   +  FNP +HQAM   E  D  P N 
Sbjct: 111 -----LTAMIEGVELTLKSLLDAVGKYGIQVVSETNVPFNPEVHQAMTMLESADHEP-NH 164

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ V+Q GY +N R+LRPA+V++SK K 
Sbjct: 165 VMMVMQKGYTLNGRLLRPAMVAVSKAKA 192


>gi|54307899|ref|YP_128919.1| putative heat shock protein GrpE [Photobacterium profundum SS9]
 gi|52782874|sp|Q6LUA8|GRPE_PHOPR RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|46912325|emb|CAG19117.1| putative heat shock protein GrpE [Photobacterium profundum SS9]
          Length = 206

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 97/148 (65%), Gaps = 10/148 (6%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E +D  LR  AE EN+RRR++ E   A+ +++ KF  ++L V DNL RA+++A       
Sbjct: 59  EAQDNVLRARAEGENVRRRSEVEIDKARKFALNKFTEELLPVIDNLERAIETA------- 111

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPA 160
             K++  LKS+IEG+E+T + M +T+E++G+K+ +   + FNP  HQAM  +E  D  P 
Sbjct: 112 -DKNDEALKSMIEGVELTLKTMTATVEKFGLKQHNPVGEVFNPEFHQAMSIQESADHEP- 169

Query: 161 NTIIKVVQDGYAINERVLRPALVSISKG 188
           NT++ V+Q GY +N R++RPA+V +SK 
Sbjct: 170 NTVMLVMQKGYELNGRIIRPAMVMVSKA 197


>gi|152978562|ref|YP_001344191.1| GrpE protein [Actinobacillus succinogenes 130Z]
 gi|171704267|sp|A6VMQ9|GRPE_ACTSZ RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|150840285|gb|ABR74256.1| GrpE protein [Actinobacillus succinogenes 130Z]
          Length = 199

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 94/143 (65%), Gaps = 7/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE++N+RRR +++ + A  +++ KFA+D+L+  DNL RAL + P   AN E 
Sbjct: 63  QDALLRARAEVDNMRRRAEQDVEKAHKFALEKFAKDLLNTIDNLERAL-ATP---ANVED 118

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           +S   +K L +G+E+T +E+++T+ R+G++ +    + FNP  HQA+  +P +    N I
Sbjct: 119 ES---VKGLFDGVELTLKELLATVARFGIEPVGLVGESFNPEFHQAISMQPTEGFETNQI 175

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY +N RV+RPA+V ++
Sbjct: 176 TTVLQKGYLLNSRVIRPAMVMVA 198


>gi|219125360|ref|XP_002182951.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217405745|gb|EEC45687.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 157

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 58/149 (38%), Positives = 92/149 (61%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           Q ++ +D+ LR +AE EN R    R+ ++ + Y+I  FA+ +L VSDNL+RA+++ P D 
Sbjct: 7   QVQQLKDQLLRSLAEQENTRSIAKRDVENGKLYAIKSFAKSLLDVSDNLTRAMEAVPEDA 66

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
              +++S  VL +L EGI MT R ++   E  G+ K     + F+PN H+A++E      
Sbjct: 67  RVDQQESNHVLHNLYEGIAMTERGLLKAFESNGLVKFGQAGEAFDPNRHEALYEYVDPDK 126

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISK 187
              T+ +VV+DG+ +N+RVLRPA V I K
Sbjct: 127 EPGTVGQVVKDGFLLNKRVLRPAEVGIVK 155


>gi|114563956|ref|YP_751470.1| GrpE protein [Shewanella frigidimarina NCIMB 400]
 gi|122299141|sp|Q07ZD3|GRPE_SHEFN RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|114335249|gb|ABI72631.1| GrpE protein [Shewanella frigidimarina NCIMB 400]
          Length = 201

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 95/148 (64%), Gaps = 10/148 (6%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSA-PLDLAN 100
           E +D  +R  AE +N+R R  ++ + A+ +++ KFA ++L V DN+ RAL    P D A 
Sbjct: 55  ERKDVEMRAAAETQNIRTRAAKDVEQARKFALEKFANELLPVIDNMERALQGTNPEDEAT 114

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
                    K++ EG+E+T +  ++++E++GV +++ + Q FNP  HQA+  +P    PA
Sbjct: 115 ---------KAIYEGVELTMKGFLTSVEKFGVTQVNPQGQAFNPEHHQAIGMQPSAEYPA 165

Query: 161 NTIIKVVQDGYAINERVLRPALVSISKG 188
           NT++ V+Q GY +N+R+LRPA+V +S+G
Sbjct: 166 NTVMMVMQKGYLLNDRLLRPAMVMVSQG 193


>gi|226499250|ref|NP_001140305.1| hypothetical protein LOC100272350 [Zea mays]
 gi|194698920|gb|ACF83544.1| unknown [Zea mays]
          Length = 303

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 98/150 (65%), Gaps = 5/150 (3%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS-----APL 96
           + +DK LR  AEMEN+  RT RE ++++ Y++  F++ +L V+DNL+RA        + +
Sbjct: 132 DMKDKVLRSYAEMENIIARTKRESENSKKYAVQNFSKSLLDVADNLARASSVVKESFSKI 191

Query: 97  DLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHD 156
           D +     +  +LK+L+EG++MT +++    +++GV+K D  +++F+PN H A+F+ P  
Sbjct: 192 DTSKDSAGAVPLLKTLLEGVDMTEKQLAEVFKKFGVEKFDPLNEEFDPNRHCAVFQIPDP 251

Query: 157 TVPANTIIKVVQDGYAINERVLRPALVSIS 186
           + P  T+  VV+ GY +++RVLRPA V ++
Sbjct: 252 SKPPGTVASVVKVGYMLHDRVLRPAEVGVT 281


>gi|330504844|ref|YP_004381713.1| heat shock protein GrpE [Pseudomonas mendocina NK-01]
 gi|328919130|gb|AEB59961.1| heat shock protein GrpE [Pseudomonas mendocina NK-01]
          Length = 189

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 68/191 (35%), Positives = 116/191 (60%), Gaps = 16/191 (8%)

Query: 7   EKNIDKE--KNPSNANSSTAEE-KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDR 63
           E+N+D +  + P+  N++++++  + +   EE L  ++   D+ LRV AE++N+RRR ++
Sbjct: 4   EQNLDTQNPETPAAENAASSDDLAARVQALEEQLAAAQ---DQSLRVAAELQNVRRRAEQ 60

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALD-SAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           + + A  +++ KFA D+L V D+L R L+ S+P D A         +K++ EG+++T + 
Sbjct: 61  DVEKAHKFALEKFANDLLPVVDSLERGLELSSPDDEA---------IKAVREGMQLTLKL 111

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
            + TL R+ ++ ID     FNP  HQAM  E    V  N+++KV Q GY +N R+LRPA+
Sbjct: 112 FLDTLARHQLEAIDPHGAPFNPEHHQAMAMEESINVEPNSVLKVFQKGYLLNGRLLRPAM 171

Query: 183 VSISKGKTQNP 193
           V +SK  T  P
Sbjct: 172 VVVSKAPTTPP 182


>gi|99082714|ref|YP_614868.1| GrpE protein [Ruegeria sp. TM1040]
 gi|99038994|gb|ABF65606.1| GrpE protein [Ruegeria sp. TM1040]
          Length = 187

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 99/147 (67%), Gaps = 8/147 (5%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           ++++D+++R +A+ EN R+R D+ +++A+ Y  +K ARDML V DN+ RA+++     A 
Sbjct: 43  DDYKDRFMRALADAENARKRGDKARREAEQYGGSKLARDMLPVYDNMKRAVEA-----AT 97

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVP 159
            E+K+ S   +LIEG+E+T R ++   +++G++ +  +   +F+P +H+AMFE P     
Sbjct: 98  EEQKAVSA--ALIEGVELTMRALLDVFQKHGIQVVSPEVGDRFDPQVHEAMFEAPVPGTK 155

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
           A  II+V  +G+ +++R+LRPA V +S
Sbjct: 156 AGDIIQVSAEGFMLHDRLLRPAQVGVS 182


>gi|261493837|ref|ZP_05990351.1| HSP-70 cofactor [Mannheimia haemolytica serotype A2 str. BOVINE]
 gi|261495062|ref|ZP_05991529.1| HSP-70 cofactor [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261309304|gb|EEY10540.1| HSP-70 cofactor [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261310540|gb|EEY11729.1| HSP-70 cofactor [Mannheimia haemolytica serotype A2 str. BOVINE]
          Length = 198

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 98/143 (68%), Gaps = 6/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE++N+RRR +++ + A  +++ KF++++L+V DNL R LD+  LD A +++
Sbjct: 61  QDIQLRAQAEIQNIRRRAEQDVEKAHKFALEKFSKELLTVVDNLERGLDA--LDKAVTDE 118

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
            +    ++L++G+EMT +E ++TL ++GV  I    + FNP +H+A+  +P + + AN +
Sbjct: 119 TT----QALVDGVEMTHKEFINTLAKFGVVAIGEVGEAFNPELHEAISMQPAEGIEANHV 174

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY ++ RV+RPA+V ++
Sbjct: 175 STVLQKGYTLHGRVIRPAMVMVA 197


>gi|145629060|ref|ZP_01784859.1| anaerobic ribonucleoside triphosphate reductase [Haemophilus
           influenzae 22.1-21]
 gi|144978563|gb|EDJ88286.1| anaerobic ribonucleoside triphosphate reductase [Haemophilus
           influenzae 22.1-21]
          Length = 244

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 96/140 (68%), Gaps = 7/140 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+ENLRRRT+++ + A  +++ KF++D+L+  DNL RAL + P   AN E 
Sbjct: 103 QDILLRSRAEIENLRRRTEQDVEKAHKFALEKFSKDILNTIDNLERAL-ATP---ANKED 158

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           +S   +K+L +G+E+T +E++ST+ R+GV+ +    + FNP++HQA+  +P +    N I
Sbjct: 159 ES---VKALFDGVELTLKELVSTVGRFGVEAVGVVGEAFNPDLHQAISMQPAEGFETNQI 215

Query: 164 IKVVQDGYAINERVLRPALV 183
             V+Q GY ++ RV+RPA+V
Sbjct: 216 SVVLQKGYTLSGRVIRPAMV 235


>gi|315126867|ref|YP_004068870.1| nucleotide exchange factor [Pseudoalteromonas sp. SM9913]
 gi|315015381|gb|ADT68719.1| nucleotide exchange factor [Pseudoalteromonas sp. SM9913]
          Length = 203

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 55/145 (37%), Positives = 97/145 (66%), Gaps = 8/145 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  +R  A+++N+RRR  ++ + A  +++ KFA ++L V DNL RA++        S+K
Sbjct: 64  KDSVVRAAADVDNMRRRAAQDVEKAHKFALEKFANELLPVIDNLERAIEF-------SDK 116

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           ++E+ LK L+EGI+MT +     + ++GV+ ++ + ++FNP+ HQAM  +P + V  NT+
Sbjct: 117 ENET-LKPLLEGIDMTVKSFNDAVAKFGVEIVNPQGEQFNPDFHQAMSIQPSNDVTPNTV 175

Query: 164 IKVVQDGYAINERVLRPALVSISKG 188
           + V+Q GY +N R+LRPA+V +SK 
Sbjct: 176 LAVMQKGYTLNGRLLRPAMVMVSKA 200


>gi|15602199|ref|NP_245271.1| hypothetical protein PM0334 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12720574|gb|AAK02418.1| GrpE [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 201

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 57/143 (39%), Positives = 95/143 (66%), Gaps = 7/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AEM+N+RRR +++ + A  + + KF++D+L+  DNL RAL + P   AN E 
Sbjct: 65  QDFLLRSRAEMDNIRRRAEQDVEKAHKFGLEKFSKDILNTIDNLERAL-ATP---ANLED 120

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           +S   +KSL +G+E+T +E+++T+ R+GV+ +    + FNP +HQA+  +P +    N I
Sbjct: 121 ES---IKSLFDGVELTLKELLATVSRFGVEAVGVVGETFNPEVHQAISMQPMEGFETNQI 177

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY +N RV+RPA+V ++
Sbjct: 178 TVVLQKGYLLNGRVIRPAMVMVA 200


>gi|238796723|ref|ZP_04640229.1| hypothetical protein ymoll0001_29400 [Yersinia mollaretii ATCC
           43969]
 gi|238719454|gb|EEQ11264.1| hypothetical protein ymoll0001_29400 [Yersinia mollaretii ATCC
           43969]
          Length = 192

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 60/148 (40%), Positives = 97/148 (65%), Gaps = 10/148 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           R+  LR  AE+EN+RRRT+ + + A  +++ +F+ ++L V DNL RALD+A  D AN+E 
Sbjct: 54  RESLLRAKAEVENIRRRTELDVEKAHKFALERFSAELLPVIDNLERALDTA--DKANTE- 110

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                L S+IEG+E+T + ++  + ++G++ +   +  FNP +HQAM   E  D  P N 
Sbjct: 111 -----LTSMIEGVELTLKSLLDAVGKFGIEVVSDTNVPFNPEVHQAMTMLESADHEP-NN 164

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ V+Q GY +N R+LRPA+V++SK K 
Sbjct: 165 VMMVMQKGYTLNGRLLRPAMVAVSKAKA 192


>gi|114326687|ref|YP_743844.1| grpE protein [Granulibacter bethesdensis CGDNIH1]
 gi|114314861|gb|ABI60921.1| grpE protein [Granulibacter bethesdensis CGDNIH1]
          Length = 226

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 53/148 (35%), Positives = 89/148 (60%), Gaps = 4/148 (2%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           ++FR++++R  AEM N+R R  R+  DA++Y++ KFA D++  ++NL R L + P     
Sbjct: 83  DDFRERWMRAEAEMANVRARAKRDADDARNYAVQKFAADIVEAAENLRRGLSALPA---- 138

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
           +E+   + L  + EG+E   R  +S LER G+   D     F+PN+HQAM E+P    P 
Sbjct: 139 AEEGEPASLTRVREGLEGVERNFISILERNGISGTDPTGAVFDPNLHQAMSEQPSAEHPP 198

Query: 161 NTIIKVVQDGYAINERVLRPALVSISKG 188
            T+I+     + +N R+L+PA+V ++K 
Sbjct: 199 GTVIQAWTSAWTLNGRLLKPAMVVVAKA 226


>gi|254566553|ref|XP_002490387.1| GrpE protein homolog, mitochondrial [Pichia pastoris GS115]
 gi|238030183|emb|CAY68106.1| GrpE protein homolog, mitochondrial [Pichia pastoris GS115]
          Length = 295

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 60/155 (38%), Positives = 90/155 (58%), Gaps = 4/155 (2%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            +D+YLR +A+  NL+  T RE + A+ +++ KFARD+L   DN   AL +   +   + 
Sbjct: 90  LKDRYLRSVADFRNLQETTKREIQKARDFALQKFARDLLESLDNFGHALSAVKDETLAAN 149

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
           K+    +  L +G+EMT+     TL R+G+ KID  D++F+PN H+A FE P       T
Sbjct: 150 KE----VSQLYDGVEMTKNIFEKTLVRHGINKIDPVDERFDPNRHEATFEVPQPDKEPGT 205

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKTQNPTEEK 197
           +  V Q GY +N RVLR A V + KG T+N   +K
Sbjct: 206 VFHVQQPGYELNGRVLRAAKVGVVKGGTENLNSDK 240


>gi|291228671|ref|XP_002734301.1| PREDICTED: GrpE-like 1, mitochondrial-like [Saccoglossus
           kowalevskii]
          Length = 216

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 100/172 (58%), Gaps = 10/172 (5%)

Query: 17  SNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKF 76
           S A     EEKS++        Q +E  DKY R +AE EN+R +  ++ +D + Y+I  F
Sbjct: 54  SQAEKQLQEEKSKLQ------KQLDELTDKYKRALAETENVRNQNKKQLEDIRLYAIQGF 107

Query: 77  ARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID 136
            +D+L ++D L +A +S    +  SE  S    KSL EG++MT  +++    R+G+ KI+
Sbjct: 108 CKDLLEIADILGQATES----VQKSELDSSPSFKSLFEGLKMTESQLLKVFSRHGLTKIE 163

Query: 137 AKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
              +KFNPN+H+A+FE P       T+  V + GY +++R +RPA+V ++K 
Sbjct: 164 PLGEKFNPNLHEALFELPVPDKTPGTVAVVSKIGYKLHDRTVRPAIVGVAKA 215


>gi|238784174|ref|ZP_04628187.1| hypothetical protein yberc0001_30110 [Yersinia bercovieri ATCC
           43970]
 gi|238714883|gb|EEQ06882.1| hypothetical protein yberc0001_30110 [Yersinia bercovieri ATCC
           43970]
          Length = 192

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 60/147 (40%), Positives = 97/147 (65%), Gaps = 10/147 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           R+  LR  AE+EN+RRRT+ + + A  +++ +F+ ++L V DNL RALD+A  D AN+E 
Sbjct: 54  RESLLRAKAEVENIRRRTELDVEKAHKFALERFSAELLPVIDNLERALDTA--DKANTE- 110

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                L S+IEG+E+T + ++  + ++G++ +   +  FNP +HQAM   E  D  P N 
Sbjct: 111 -----LTSMIEGVELTLKSLLDAVGKFGIEVVSDTNVPFNPEVHQAMTMLESADHEP-NN 164

Query: 163 IIKVVQDGYAINERVLRPALVSISKGK 189
           ++ V+Q GY +N R+LRPA+V++SK K
Sbjct: 165 VMMVMQKGYTLNGRLLRPAMVAVSKAK 191


>gi|52788295|sp|Q9CNU1|GRPE_PASMU RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
          Length = 197

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 57/143 (39%), Positives = 95/143 (66%), Gaps = 7/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AEM+N+RRR +++ + A  + + KF++D+L+  DNL RAL + P   AN E 
Sbjct: 61  QDFLLRSRAEMDNIRRRAEQDVEKAHKFGLEKFSKDILNTIDNLERAL-ATP---ANLED 116

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           +S   +KSL +G+E+T +E+++T+ R+GV+ +    + FNP +HQA+  +P +    N I
Sbjct: 117 ES---IKSLFDGVELTLKELLATVSRFGVEAVGVVGETFNPEVHQAISMQPMEGFETNQI 173

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY +N RV+RPA+V ++
Sbjct: 174 TVVLQKGYLLNGRVIRPAMVMVA 196


>gi|195047721|ref|XP_001992399.1| GH24729 [Drosophila grimshawi]
 gi|193893240|gb|EDV92106.1| GH24729 [Drosophila grimshawi]
          Length = 200

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 105/172 (61%), Gaps = 10/172 (5%)

Query: 19  ANSSTAEEKS---EINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAK 75
             +STAE +    E+N+ + +   +     KY R +AE EN+R R +++  DA+ + I  
Sbjct: 35  GGASTAEIEWLTLELNVTKRA---NAGLLHKYKRTLAEGENMRNRLNKQIGDARIFGIQG 91

Query: 76  FARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI 135
           F +D++ V+D L +A ++ P D  ++       L+SL EG+++TR  +    +R+G++  
Sbjct: 92  FCKDLIDVADVLGQATEAVPKDRLDTNPD----LQSLYEGLQLTRASLQQVFKRHGLETR 147

Query: 136 DAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           D  +QKF+PN H+A+F+    TV A+T+++V + GY ++ R +RPALV +SK
Sbjct: 148 DPINQKFDPNQHEALFQTVGATVEADTVVQVTKLGYQLHNRCIRPALVGVSK 199


>gi|95117615|gb|ABF57012.1| GrpE [Pseudoalteromonas sp. SM9913]
          Length = 203

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 55/145 (37%), Positives = 97/145 (66%), Gaps = 8/145 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  +R  A+++N+RRR  ++ + A  +++ KFA ++L V DNL RA++        S+K
Sbjct: 64  KDSVVRAAADVDNMRRRAAQDVEKAHKFALEKFANELLPVIDNLERAIEF-------SDK 116

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           ++E+ LK L+EGI+MT +     + ++GV+ ++ + ++FNP+ HQAM  +P + V  NT+
Sbjct: 117 ENET-LKPLLEGIDMTVKSFNDAVAKFGVEIVNPQGEQFNPDFHQAMSIQPSNDVTPNTV 175

Query: 164 IKVVQDGYAINERVLRPALVSISKG 188
           + V+Q GY +N R+LRPA+V +SK 
Sbjct: 176 LAVMQKGYTLNGRLLRPAMVMVSKA 200


>gi|323499772|ref|ZP_08104731.1| heat shock protein GrpE [Vibrio sinaloensis DSM 21326]
 gi|323315013|gb|EGA68065.1| heat shock protein GrpE [Vibrio sinaloensis DSM 21326]
          Length = 204

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 96/147 (65%), Gaps = 8/147 (5%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           +E +D  LR  AE+EN+RRRT++E   A+ Y++ KFA ++L V DNL RA+ +A  +   
Sbjct: 66  QEQQDGVLRAKAEVENMRRRTEQEIDKARKYALNKFAEELLPVIDNLERAIQAADTEA-- 123

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
                  V+K L+EG+E+T +  + T+ ++G+K+I+ + + FNP  HQAM  +      +
Sbjct: 124 ------EVVKPLLEGVELTHKTFVDTVSKFGLKEINPEGEAFNPEQHQAMSIQESPDHES 177

Query: 161 NTIIKVVQDGYAINERVLRPALVSISK 187
           NT++ V+Q GY +N RV+RPA+V ++K
Sbjct: 178 NTVMFVMQKGYELNGRVIRPAMVMVAK 204


>gi|283835677|ref|ZP_06355418.1| co-chaperone GrpE [Citrobacter youngae ATCC 29220]
 gi|291068891|gb|EFE07000.1| co-chaperone GrpE [Citrobacter youngae ATCC 29220]
          Length = 197

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 90/146 (61%), Gaps = 8/146 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LR+ AEMENLRRRT+ + + A  +++ KF  ++L V D+L RAL+ A         
Sbjct: 59  RDSVLRIKAEMENLRRRTELDVEKAHKFALEKFVNELLPVLDSLDRALEVA--------D 110

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           K    + ++IEGIE+TR+ M+  + ++GV+ +   D   +PN+HQA+     D V A  +
Sbjct: 111 KDNEAMAAMIEGIELTRKSMLDVVAKFGVQVVADIDVPMDPNVHQAIAMVESDDVAAGNV 170

Query: 164 IKVVQDGYAINERVLRPALVSISKGK 189
           + V+Q GY +N R +R A+VS++K K
Sbjct: 171 LMVMQKGYTLNGRTIRAAMVSVAKAK 196


>gi|237729529|ref|ZP_04560010.1| heat shock protein GrpE [Citrobacter sp. 30_2]
 gi|226908135|gb|EEH94053.1| heat shock protein GrpE [Citrobacter sp. 30_2]
          Length = 197

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 90/146 (61%), Gaps = 8/146 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LR+ AEMENLRRRT+ + + A  +++ KF  ++L V D+L RAL+ A         
Sbjct: 59  RDSVLRIKAEMENLRRRTELDVEKAHKFALEKFVNELLPVLDSLDRALEVA--------D 110

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           K    + +++EGIE+TR+ M+  + ++GV+ +   D   +PN+HQA+     D V A  +
Sbjct: 111 KGNDAMAAMVEGIELTRKSMLDVVAKFGVQVVADIDVPMDPNVHQAIAMVESDDVAAGNV 170

Query: 164 IKVVQDGYAINERVLRPALVSISKGK 189
           + V+Q GY +N R +R A+VS++K K
Sbjct: 171 LMVMQKGYTLNGRTIRAAMVSVAKAK 196


>gi|118777122|ref|XP_307508.3| Anopheles gambiae str. PEST AGAP012770-PA [Anopheles gambiae str.
           PEST]
 gi|116133044|gb|EAA03306.3| AGAP012770-PA [Anopheles gambiae str. PEST]
          Length = 204

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 92/140 (65%), Gaps = 3/140 (2%)

Query: 45  DKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKK 104
           DKY R +AE EN+RRR  ++  DA+ + I  F +D+L V+D L  A ++ P D   S+K 
Sbjct: 68  DKYKRALAESENIRRRLTKQIDDAKLFGIQGFCKDLLEVADILGHATEAVPKD-EISDKN 126

Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTII 164
               LK+L EG+ MTR+++ S  +R+G++ ++  ++KFNPN+H+A+F++    V  NT +
Sbjct: 127 PH--LKNLFEGLSMTRQQLNSVFKRHGLETVNPMNEKFNPNLHEALFQQEVANVEPNTGV 184

Query: 165 KVVQDGYAINERVLRPALVS 184
            V + GY +++R +RPALV 
Sbjct: 185 VVSKIGYKLHDRCIRPALVG 204


>gi|238788238|ref|ZP_04632033.1| hypothetical protein yfred0001_36880 [Yersinia frederiksenii ATCC
           33641]
 gi|238723825|gb|EEQ15470.1| hypothetical protein yfred0001_36880 [Yersinia frederiksenii ATCC
           33641]
          Length = 192

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 60/148 (40%), Positives = 97/148 (65%), Gaps = 10/148 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           R+  LR  AE+EN+RRRT+ + + A  +++ +F+ ++L V DNL RALD+A  D +N+E 
Sbjct: 54  RESLLRAKAEVENIRRRTELDIEKAHKFALERFSAELLPVIDNLERALDTA--DKSNAE- 110

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                L S+IEG+E+T + ++  + +YG++ +   +  FNP +HQAM   E  D  P N 
Sbjct: 111 -----LTSMIEGVELTLKSLLDAVGKYGIEVVGDTNVPFNPEVHQAMTMLESADHEP-NQ 164

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ V+Q GY +N R+LRPA+V++SK K 
Sbjct: 165 VMMVMQKGYTLNGRLLRPAMVAVSKAKA 192


>gi|110677818|ref|YP_680825.1| GrpE protein HSP-70 cofactor, putative [Roseobacter denitrificans
           OCh 114]
 gi|109453934|gb|ABG30139.1| GrpE protein HSP-70 cofactor, putative [Roseobacter denitrificans
           OCh 114]
          Length = 187

 Score =  115 bits (289), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 101/147 (68%), Gaps = 8/147 (5%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           ++ +D+++R +A+ EN R+R++R++++A++Y  +K +RDML V DN+ RAL++       
Sbjct: 43  DQLKDRFMRALADAENARKRSERDRREAENYGGSKLSRDMLPVYDNMKRALEA-----VT 97

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVP 159
            E++ ++   +L+EGIE+T RE++S  +++G++ +  +   +F+P  HQAMFE P     
Sbjct: 98  DEQREQNA--ALLEGIELTMRELLSVFKKHGIEIVAPEVGDRFDPQYHQAMFEAPLPGTK 155

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
           A  II+V  +G+ +++R+LRPA V +S
Sbjct: 156 AGDIIQVSAEGFMLHDRLLRPAQVGVS 182


>gi|260428971|ref|ZP_05782948.1| co-chaperone GrpE [Citreicella sp. SE45]
 gi|260419594|gb|EEX12847.1| co-chaperone GrpE [Citreicella sp. SE45]
          Length = 185

 Score =  115 bits (289), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 99/163 (60%), Gaps = 14/163 (8%)

Query: 29  EINIPEESLN----QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVS 84
           EI+  E  L+    + ++F+D+++R +A+ EN R+R D+++++AQ Y   + ARD+L V 
Sbjct: 27  EIDSAEAELDALRAERDQFKDRFMRALADAENARKRADKDRREAQQYGGTRLARDLLPVY 86

Query: 85  DNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFN 143
           DN+ RAL  A         + E    +LIEG+E+T RE+++   ++G+  I  +   KF+
Sbjct: 87  DNMQRALSVA---------REEKAGDALIEGVELTLRELLNVFSKHGMTAIKPEVGDKFD 137

Query: 144 PNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           P  H+AMFE P     A  II+V  +G+ + +R+LRPA V +S
Sbjct: 138 PQQHEAMFEAPVPGTRAGEIIQVSAEGFMLYDRLLRPAQVGVS 180


>gi|149190059|ref|ZP_01868336.1| GrpE [Vibrio shilonii AK1]
 gi|148836089|gb|EDL53049.1| GrpE [Vibrio shilonii AK1]
          Length = 202

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 60/147 (40%), Positives = 100/147 (68%), Gaps = 10/147 (6%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E +D  LR  A++EN+RRRT++E   A+ Y++ KFA ++L V DNL RA+       A +
Sbjct: 65  EQQDAVLRAKADVENMRRRTEQEIDKARKYALNKFAEELLPVIDNLERAI-------AAA 117

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPA 160
           + ++E+V K ++EG+E+T +  +  + ++G+K+I+ + + FNP +HQAM  +E  D  P 
Sbjct: 118 DTENEAV-KPIVEGVELTHKTFVDVVAKFGLKEINPEGEAFNPELHQAMSIQESADHEP- 175

Query: 161 NTIIKVVQDGYAINERVLRPALVSISK 187
           NT++ V+Q GY +N RV+RPA+V +SK
Sbjct: 176 NTVMFVMQKGYELNGRVIRPAMVMVSK 202


>gi|37679009|ref|NP_933618.1| molecular chaperone GrpE [Vibrio vulnificus YJ016]
 gi|320157238|ref|YP_004189617.1| heat shock protein GrpE [Vibrio vulnificus MO6-24/O]
 gi|52782902|sp|Q7MN92|GRPE_VIBVY RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|37197751|dbj|BAC93589.1| molecular chaperone GrpE [Vibrio vulnificus YJ016]
 gi|319932550|gb|ADV87414.1| heat shock protein GrpE [Vibrio vulnificus MO6-24/O]
          Length = 198

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 97/146 (66%), Gaps = 8/146 (5%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E +D  LR  AE+EN+RRRT++E   A+ Y++ +FA ++L V DNL RA+ +A       
Sbjct: 61  EQQDSVLRAKAEVENMRRRTEQEIDKARKYALNRFAEELLPVIDNLERAIQAA------- 113

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
           + +SE+V K L+EG+E+T +  +  + ++G+K+I+ + Q FNP  HQAM  +      +N
Sbjct: 114 DAESEAV-KPLLEGVELTHKTFVDVVSKFGLKEINPEGQPFNPEWHQAMSIQESPDHESN 172

Query: 162 TIIKVVQDGYAINERVLRPALVSISK 187
           T++ V+Q GY +N RV+RPA+V ++K
Sbjct: 173 TVMFVMQKGYELNGRVIRPAMVMVAK 198


>gi|253687130|ref|YP_003016320.1| GrpE protein [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|259647654|sp|C6D9J8|GRPE_PECCP RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|251753708|gb|ACT11784.1| GrpE protein [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 195

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 113/194 (58%), Gaps = 21/194 (10%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEES-----------LNQSEEFRDKYLRVIAEME 55
           E+ +D+++      +  A E +++  P ++           L Q E  RD  LRV AE +
Sbjct: 11  EQVLDQKEAAKGQQADAAPETADVADPRDARIAELEAQLSELQQRE--RDNMLRVRAEAD 68

Query: 56  NLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEG 115
           N+RRR + + + A  +++ KFA +ML V DNL RALD+A       +K +ES L ++IEG
Sbjct: 69  NVRRRAEMDVEKAHKFAVEKFASEMLPVIDNLERALDTA-------DKANES-LAAMIEG 120

Query: 116 IEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINE 175
           +E+T + ++  + ++G++ +   +  FNP +HQAM   P      N ++ V+Q GY +N 
Sbjct: 121 VELTLKSLLDAVRKFGIEVVGDVNVPFNPEVHQAMTMLPSADHQPNHVMMVMQKGYTLNG 180

Query: 176 RVLRPALVSISKGK 189
           R+LRPA+V++SK +
Sbjct: 181 RLLRPAMVAVSKAQ 194


>gi|329297614|ref|ZP_08254950.1| heat shock protein GrpE [Plautia stali symbiont]
          Length = 192

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 94/147 (63%), Gaps = 8/147 (5%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            RD  LR  AE+EN+RRR + + + A  +++ KFA ++L V D+L RAL+ A  D  N+E
Sbjct: 53  VRDAQLRAQAEIENIRRRAEMDVEKAHKFALEKFANELLPVIDSLERALEVA--DKENTE 110

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
                 L S+IEGIE+T + ++  + ++GV+ +   +  FNP++HQAM     + V  N 
Sbjct: 111 ------LASMIEGIELTLKSLLGAVRKFGVEVVGETNVPFNPDVHQAMSMMESEEVAPNH 164

Query: 163 IIKVVQDGYAINERVLRPALVSISKGK 189
           ++ V+Q GY +N R+LRPA+V++SK K
Sbjct: 165 VLMVMQRGYTLNGRLLRPAMVAVSKAK 191


>gi|251790872|ref|YP_003005593.1| heat shock protein GrpE [Dickeya zeae Ech1591]
 gi|247539493|gb|ACT08114.1| GrpE protein [Dickeya zeae Ech1591]
          Length = 195

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 92/147 (62%), Gaps = 10/147 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           R+  LR  AEMEN+RRR + + + A  +++ KFA +ML V DNL RAL+ A         
Sbjct: 57  RENALRARAEMENVRRRAELDVEKAHKFALEKFAGEMLPVIDNLERALEMA--------D 108

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
           KS   L  +IEG+E+T + M+S + ++G++ +   +  FNP +HQAM   E  D  P N 
Sbjct: 109 KSNETLSGMIEGVELTLKAMLSAVSKFGIEVVAEVNVPFNPEIHQAMTLIESADHEP-NH 167

Query: 163 IIKVVQDGYAINERVLRPALVSISKGK 189
           ++ V+Q GY +N R+LRPA+V++SK K
Sbjct: 168 VMMVMQKGYTLNGRLLRPAMVAVSKAK 194


>gi|119469574|ref|ZP_01612478.1| Hsp 24 DnaK nucleotide exchange factor; probable member of the
           DnaK/DnaJ/GrpE foldase complex [Alteromonadales
           bacterium TW-7]
 gi|119447109|gb|EAW28379.1| Hsp 24 DnaK nucleotide exchange factor; probable member of the
           DnaK/DnaJ/GrpE foldase complex [Alteromonadales
           bacterium TW-7]
          Length = 205

 Score =  115 bits (288), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 55/145 (37%), Positives = 96/145 (66%), Gaps = 8/145 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  +R  A+++N+RRR  ++ + A  +++ KFA ++L V DNL RA++        S+K
Sbjct: 66  KDGVIRAAADVDNIRRRAAQDVEKAHKFALEKFANELLPVIDNLERAIEF-------SDK 118

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           ++E+ LK L+EGI+MT +     + ++GV+ ++ + ++FNP  HQAM  +P + V  NT+
Sbjct: 119 ENET-LKPLLEGIDMTVKSFNDAVAKFGVEIVNPQGEQFNPEFHQAMSIQPSNDVTPNTV 177

Query: 164 IKVVQDGYAINERVLRPALVSISKG 188
           + V+Q GY +N R+LRPA+V +SK 
Sbjct: 178 LAVMQKGYTLNGRLLRPAMVMVSKA 202


>gi|332534004|ref|ZP_08409855.1| heat shock protein GrpE [Pseudoalteromonas haloplanktis ANT/505]
 gi|332036553|gb|EGI73020.1| heat shock protein GrpE [Pseudoalteromonas haloplanktis ANT/505]
          Length = 183

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 55/145 (37%), Positives = 97/145 (66%), Gaps = 8/145 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  +R  A+++N+RRR  ++ + A  +++ KFA ++L V DNL RA++        S+K
Sbjct: 44  KDGVVRAAADVDNIRRRAAQDVEKAHKFALEKFANELLPVIDNLERAIEF-------SDK 96

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           ++E+ LK L+EGI+MT +     + ++GV+ ++ + ++FNP+ HQAM  +P + V  NT+
Sbjct: 97  ENET-LKPLLEGIDMTVKSFNDAVAKFGVEIVNPQGEQFNPDFHQAMSIQPSNDVTPNTV 155

Query: 164 IKVVQDGYAINERVLRPALVSISKG 188
           + V+Q GY +N R+LRPA+V +SK 
Sbjct: 156 LAVMQKGYTLNGRLLRPAMVMVSKA 180


>gi|293394815|ref|ZP_06639105.1| co-chaperone GrpE [Serratia odorifera DSM 4582]
 gi|291422566|gb|EFE95805.1| co-chaperone GrpE [Serratia odorifera DSM 4582]
          Length = 193

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 92/147 (62%), Gaps = 8/147 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LR  AEMEN+RRRT+ + + A  +++ KF+ D+L V DNL RAL+ A  D  N E 
Sbjct: 55  RDSLLRAKAEMENVRRRTELDIEKAHKFALEKFSADLLPVIDNLERALELA--DRNNPE- 111

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
                L ++IEGIE+T + +   + +YG++ +   +  FNP++HQAM     D    N +
Sbjct: 112 -----LAAMIEGIELTLKSLQDAVRKYGIEIVGDVNVPFNPDVHQAMSLMESDQHQPNHV 166

Query: 164 IKVVQDGYAINERVLRPALVSISKGKT 190
           + V+Q GY +N R+LRPA+V++SK K 
Sbjct: 167 MMVMQKGYTLNGRLLRPAMVAVSKAKA 193


>gi|261252217|ref|ZP_05944790.1| heat shock protein GrpE [Vibrio orientalis CIP 102891]
 gi|260935608|gb|EEX91597.1| heat shock protein GrpE [Vibrio orientalis CIP 102891]
          Length = 198

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 99/145 (68%), Gaps = 10/145 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+EN+RRRT+ E   A+ Y++ KF+ ++L V DNL RA+ +A       + 
Sbjct: 63  QDGVLRAKAEVENMRRRTESEIDKARKYALNKFSEELLPVIDNLERAIQAA-------DT 115

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
           ++E+V K L+EG+E+T +  + T+ ++G+K+I+ + + FNP +HQAM  +E  D  P NT
Sbjct: 116 ENEAV-KPLLEGVELTYKTFVDTVSKFGLKEINPEGETFNPELHQAMSIQESPDHEP-NT 173

Query: 163 IIKVVQDGYAINERVLRPALVSISK 187
           ++ V+Q GY +N RV+RPA+V +SK
Sbjct: 174 VMFVMQKGYELNGRVIRPAMVMVSK 198


>gi|323492391|ref|ZP_08097541.1| heat shock protein GrpE [Vibrio brasiliensis LMG 20546]
 gi|323313352|gb|EGA66466.1| heat shock protein GrpE [Vibrio brasiliensis LMG 20546]
          Length = 198

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 97/144 (67%), Gaps = 8/144 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+EN+RRRT+ E   A+ Y++ KFA ++L V DNL RA+ +A       + 
Sbjct: 63  QDGVLRAKAEVENMRRRTETEIDKARKYALNKFAEELLPVIDNLERAIQAA-------DT 115

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           ++E+V K L+EG+E+T +  + T+ ++G+K+I+ + + FNP +HQAM  +      +NT+
Sbjct: 116 ENEAV-KPLLEGVELTHKTFVDTVSKFGLKEINPEGEAFNPELHQAMSIQESPDHESNTV 174

Query: 164 IKVVQDGYAINERVLRPALVSISK 187
           + V+Q GY +N RV+RPA+V ++K
Sbjct: 175 MFVMQKGYELNGRVVRPAMVMVAK 198


>gi|227328447|ref|ZP_03832471.1| heat shock protein [Pectobacterium carotovorum subsp. carotovorum
           WPP14]
          Length = 195

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 112/194 (57%), Gaps = 21/194 (10%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEES-----------LNQSEEFRDKYLRVIAEME 55
           E+ +D+++      +  A E +++  P ++           L Q E  RD  LRV AE +
Sbjct: 11  EQVLDQKEAAKGQQADAAPETADVADPRDARIAELETQLSELQQRE--RDNMLRVRAEAD 68

Query: 56  NLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEG 115
           N+RRR + + + A  +++ KFA +ML V DNL RALD+A       +K +ES L ++IEG
Sbjct: 69  NIRRRAEMDVEKAHKFAVEKFASEMLPVIDNLERALDTA-------DKANES-LAAMIEG 120

Query: 116 IEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINE 175
           +E+T + ++  + ++G++ +      FNP +HQAM   P      N ++ V+Q GY +N 
Sbjct: 121 VELTLKSLLDAVRKFGIEVVGDVGIPFNPEVHQAMTMLPSADHQPNHVMMVMQKGYTLNG 180

Query: 176 RVLRPALVSISKGK 189
           R+LRPA+V++SK +
Sbjct: 181 RLLRPAMVAVSKAQ 194


>gi|148237623|ref|NP_001089487.1| GrpE-like 1, mitochondrial [Xenopus laevis]
 gi|66911547|gb|AAH97708.1| MGC115379 protein [Xenopus laevis]
          Length = 216

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 103/182 (56%), Gaps = 12/182 (6%)

Query: 9   NIDKEKNPSNAN-SSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           N DK KN +  +    A EK+++        Q ++  DKY R +A+ ENLR+R+ +   +
Sbjct: 44  NEDKSKNQAEESPDQAAAEKAKLE------EQIKDLTDKYKRALADTENLRQRSKKLVDE 97

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSES-VLKSLIEGIEMTRREMMST 126
           A+ Y I  F +DML V+D L +A +S P      E K+E+  LKSL EG+ MT  +M   
Sbjct: 98  AKLYGIQGFCKDMLEVADILEKATESVP----KEEIKAENPHLKSLYEGLIMTEVQMQKV 153

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
            E++GV K++    KFNP  H+A+F  P       T+  V + GY ++ER LRPALV + 
Sbjct: 154 FEKHGVLKLNPVGAKFNPYEHEALFHSPVAGKEPGTVALVTKVGYKLHERTLRPALVGVV 213

Query: 187 KG 188
           KG
Sbjct: 214 KG 215


>gi|260912965|ref|ZP_05919450.1| co-chaperone GrpE [Pasteurella dagmatis ATCC 43325]
 gi|260632955|gb|EEX51121.1| co-chaperone GrpE [Pasteurella dagmatis ATCC 43325]
          Length = 197

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 97/143 (67%), Gaps = 7/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AEM+N+RRR +++ + A  +++ KF++++L+  DNL RAL +      N+  
Sbjct: 61  QDFALRSRAEMDNIRRRAEQDVEKAHKFALEKFSKEILNTIDNLERALST------NANV 114

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           + ESV K+L +G+E+T +E++ST+ R+GV+ + ++ + FNP +HQA+  +P +    N I
Sbjct: 115 EDESV-KALFDGVELTLKELLSTVGRFGVEAVGSEGEVFNPELHQAISMQPTEGFETNQI 173

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY +N RV+RPA+V ++
Sbjct: 174 TVVLQKGYLLNGRVIRPAMVMVA 196


>gi|225460859|ref|XP_002277588.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 324

 Score =  115 bits (287), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 100/160 (62%), Gaps = 5/160 (3%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRAL-----DSAP 95
           E+ +DK LR  AEMEN+  R  RE ++++ ++I  FA+ +L V+DNL RA        + 
Sbjct: 164 EKMQDKVLRSYAEMENVMERARREAENSKKFAIQNFAKSLLDVADNLGRASLVVKESFSK 223

Query: 96  LDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPH 155
           +D +     +  +LK+L+EG+EMT +++     ++G++K D  +++F+P+ H A F+ P 
Sbjct: 224 IDESKDTAGAVPLLKTLLEGVEMTEKQLGEVFRKFGMEKFDPTNEQFDPHRHNAAFQIPD 283

Query: 156 DTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTE 195
            + P+ T+  V++ GY +++RV+RPA V +++    N TE
Sbjct: 284 PSKPSGTVAVVLKAGYMLHDRVIRPAEVGVTQAVDNNETE 323


>gi|50119785|ref|YP_048952.1| heat shock protein GrpE [Pectobacterium atrosepticum SCRI1043]
 gi|52782860|sp|Q6D8X9|GRPE_ERWCT RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|49610311|emb|CAG73755.1| heat shock protein [Pectobacterium atrosepticum SCRI1043]
          Length = 195

 Score =  115 bits (287), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 58/146 (39%), Positives = 93/146 (63%), Gaps = 8/146 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LRV AE +N+RRR + + + A  +++ KFA +ML V DNL RALD+A       +K
Sbjct: 57  RDNMLRVRAEADNVRRRAEMDIEKAHKFAVEKFASEMLPVIDNLERALDTA-------DK 109

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
            +ES L ++IEG+E+T + ++  + ++G++ +      FNP +HQAM   P      N +
Sbjct: 110 ANES-LAAMIEGVELTLKSLLDAVHKFGIEVVGDVGVPFNPEVHQAMTMLPSADHQPNHV 168

Query: 164 IKVVQDGYAINERVLRPALVSISKGK 189
           + V+Q GY +N R+LRPA+V++SK +
Sbjct: 169 MMVMQKGYTLNGRLLRPAMVAVSKAQ 194


>gi|320539200|ref|ZP_08038871.1| putative heat shock protein [Serratia symbiotica str. Tucson]
 gi|320030838|gb|EFW12846.1| putative heat shock protein [Serratia symbiotica str. Tucson]
          Length = 197

 Score =  115 bits (287), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 94/148 (63%), Gaps = 10/148 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LR  AEMEN+RRRT+ + + A  +++ +F+ D+L V DNL RAL+ A  D  N E 
Sbjct: 59  RDSLLRAKAEMENVRRRTELDIEKAHKFALERFSGDLLPVLDNLERALELA--DKNNPE- 115

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                L ++IEGIE+T + +   + +YG++ +   D  FNP++HQAM   E  D  P N 
Sbjct: 116 -----LTAMIEGIELTLKSLQDVVHKYGIEIVSDVDVPFNPDVHQAMSLIESADHQP-NH 169

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ V+Q GY +N R+LRPA+V++SK K 
Sbjct: 170 VMMVMQKGYTLNGRLLRPAMVAVSKAKA 197


>gi|157371919|ref|YP_001479908.1| heat shock protein GrpE [Serratia proteamaculans 568]
 gi|167008735|sp|A8GI40|GRPE_SERP5 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|157323683|gb|ABV42780.1| GrpE protein [Serratia proteamaculans 568]
          Length = 190

 Score =  115 bits (287), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 93/148 (62%), Gaps = 10/148 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LR  AEMEN+RRRT+ + + A  +++ KF+ D+L V DNL RAL+ A  D  N E 
Sbjct: 52  RDSLLRAKAEMENVRRRTELDIEKAHKFALEKFSGDLLPVLDNLERALELA--DKNNPE- 108

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                L ++IEGIE+T + +   + +YG++ +   +  FNP +HQAM   E  D  P N 
Sbjct: 109 -----LTAMIEGIELTLKSLQDVVRKYGIEIVGDTNVPFNPEVHQAMSLMESADHQP-NH 162

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ V+Q GY +N R+LRPA+V++SK K 
Sbjct: 163 VMMVMQKGYTLNGRLLRPAMVAVSKAKA 190


>gi|227113544|ref|ZP_03827200.1| heat shock protein [Pectobacterium carotovorum subsp. brasiliensis
           PBR1692]
          Length = 195

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 65/194 (33%), Positives = 109/194 (56%), Gaps = 21/194 (10%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEES-----------LNQSEEFRDKYLRVIAEME 55
           E+ +D+++      +  A E +++  P ++           L Q E  RD  LRV AE +
Sbjct: 11  EQVLDQKEAAKGQQADAAPETADVADPRDARIAELETQLSELQQRE--RDNMLRVRAEAD 68

Query: 56  NLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEG 115
           N+RRR + + + A  +++ KFA +ML V DNL RALD+A         KS   L ++IEG
Sbjct: 69  NIRRRAEMDVEKAHKFAVEKFASEMLPVIDNLERALDTA--------DKSNESLVAMIEG 120

Query: 116 IEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINE 175
           +E+T + ++  + ++G++ +      FNP +HQAM   P      N ++ V+Q GY +N 
Sbjct: 121 VELTLKSLLDAVRKFGIEVVGDVGVPFNPEVHQAMTMLPSADHQPNHVMMVMQKGYTLNG 180

Query: 176 RVLRPALVSISKGK 189
           R+LRPA+V++SK +
Sbjct: 181 RLLRPAMVAVSKAQ 194


>gi|85706902|ref|ZP_01037992.1| co-chaperone GrpE [Roseovarius sp. 217]
 gi|85668513|gb|EAQ23384.1| co-chaperone GrpE [Roseovarius sp. 217]
          Length = 186

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 56/145 (38%), Positives = 95/145 (65%), Gaps = 8/145 (5%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            RDK++R +A+ EN R+R+++++++A++Y  +K +RDML V DNL RAL++        E
Sbjct: 45  LRDKFMRALADAENARKRSEKDRREAENYGGSKLSRDMLPVYDNLKRALET-----VTEE 99

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPAN 161
           +++ S   +L EGIE+T RE+ +   ++G+  ID +   +F+P  H+AMFE P     A 
Sbjct: 100 QRAGSA--ALFEGIELTLRELRNVFTKHGITVIDPQVGDRFDPQQHEAMFEVPLPGTKAG 157

Query: 162 TIIKVVQDGYAINERVLRPALVSIS 186
            II+V   G+ +++R+LRPA V +S
Sbjct: 158 EIIQVSTQGFMLHDRILRPAQVGVS 182


>gi|182413487|ref|YP_001818553.1| GrpE protein [Opitutus terrae PB90-1]
 gi|177840701|gb|ACB74953.1| GrpE protein [Opitutus terrae PB90-1]
          Length = 198

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 56/144 (38%), Positives = 85/144 (59%), Gaps = 8/144 (5%)

Query: 45  DKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKK 104
           D+YLR +A++EN RRRT REK D + ++ A+   D+L V DNLS AL +A        K 
Sbjct: 54  DRYLRAVADLENFRRRTTREKDDLRQFAAARVLEDLLPVMDNLSLALKAA--------KH 105

Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTII 164
             +   S+  G+EM   ++ + L  +G+K++D   Q F+ N H+A+  +P   VP   + 
Sbjct: 106 PGADAASVASGVEMVLTQLKTGLANHGLKEVDPAGQLFDANFHEAVSAQPSQDVPEGHVQ 165

Query: 165 KVVQDGYAINERVLRPALVSISKG 188
            VV+ GY +N R+LRPA V +S G
Sbjct: 166 TVVRTGYVLNGRLLRPATVVVSSG 189


>gi|297737494|emb|CBI26695.3| unnamed protein product [Vitis vinifera]
          Length = 298

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 100/160 (62%), Gaps = 5/160 (3%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRAL-----DSAP 95
           E+ +DK LR  AEMEN+  R  RE ++++ ++I  FA+ +L V+DNL RA        + 
Sbjct: 138 EKMQDKVLRSYAEMENVMERARREAENSKKFAIQNFAKSLLDVADNLGRASLVVKESFSK 197

Query: 96  LDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPH 155
           +D +     +  +LK+L+EG+EMT +++     ++G++K D  +++F+P+ H A F+ P 
Sbjct: 198 IDESKDTAGAVPLLKTLLEGVEMTEKQLGEVFRKFGMEKFDPTNEQFDPHRHNAAFQIPD 257

Query: 156 DTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTE 195
            + P+ T+  V++ GY +++RV+RPA V +++    N TE
Sbjct: 258 PSKPSGTVAVVLKAGYMLHDRVIRPAEVGVTQAVDNNETE 297


>gi|328780331|ref|XP_624159.2| PREDICTED: grpE protein homolog, mitochondrial [Apis mellifera]
          Length = 237

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 54/151 (35%), Positives = 95/151 (62%), Gaps = 3/151 (1%)

Query: 38  NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD 97
           N   +  DKY R +A+ ENLR R +++ +DA+ + I  F +D+L V+D L +A +S P  
Sbjct: 90  NHKNDLEDKYKRALADGENLRVRLNKQIQDAKMFGIQGFCKDLLEVADILGKATESVP-- 147

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
             N   +    LK+L EG++MT  ++    +++G+  ++  ++KF+PN H+A+F++  + 
Sbjct: 148 -KNELTEKNPHLKTLYEGLKMTEAQLHKVFKKHGLVSLNPLNEKFDPNQHEALFQQEVEG 206

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISKG 188
               TI+ V + GY ++ERV+RPALV ++KG
Sbjct: 207 KEPGTIVVVSKLGYKLHERVVRPALVGVAKG 237


>gi|262276577|ref|ZP_06054386.1| heat shock protein GrpE [Grimontia hollisae CIP 101886]
 gi|262220385|gb|EEY71701.1| heat shock protein GrpE [Grimontia hollisae CIP 101886]
          Length = 201

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 59/156 (37%), Positives = 103/156 (66%), Gaps = 10/156 (6%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E +D  LR  A++EN+RRRT++E   A+ +++ +FA ++L V DN+ RA++     +A+ 
Sbjct: 54  EQQDSVLRARADVENMRRRTEQEIDKARKFALERFANELLPVIDNMERAVE-----MADR 108

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPA 160
           E ++   LK ++EG+E+T + M   +E++G+K+++ + + FNP  HQAM  +E  +  P 
Sbjct: 109 ENET---LKPMVEGVELTLKTMKDAVEKFGLKELNPQGEPFNPEFHQAMSIQESEEHAP- 164

Query: 161 NTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEE 196
           NT++ V+Q GY +N RV+RPA+V +SK    N  E+
Sbjct: 165 NTVMLVMQKGYELNGRVVRPAMVMVSKAPAGNVDEQ 200


>gi|147811306|emb|CAN76715.1| hypothetical protein VITISV_018795 [Vitis vinifera]
          Length = 413

 Score =  114 bits (286), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 100/160 (62%), Gaps = 5/160 (3%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRAL-----DSAP 95
           E+ +DK LR  AEMEN+  R  RE ++++ ++I  FA+ +L V+DNL RA        + 
Sbjct: 253 EKMQDKVLRSYAEMENVMERARREAENSKKFAIQNFAKSLLDVADNLGRASLVVKESFSK 312

Query: 96  LDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPH 155
           +D +     +  +LK+L+EG+EMT +++     ++G++K D  +++F+P+ H A F+ P 
Sbjct: 313 IDESKDTAGAVPLLKTLLEGVEMTEKQLGEVFRKFGMEKFDPTNEQFDPHRHNAAFQIPD 372

Query: 156 DTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTE 195
            + P+ T+  V++ GY +++RV+RPA V +++    N TE
Sbjct: 373 PSKPSGTVAVVLKAGYMLHDRVIRPAEVGVTQAVDNNETE 412


>gi|153802062|ref|ZP_01956648.1| heat shock protein GrpE [Vibrio cholerae MZO-3]
 gi|153824596|ref|ZP_01977263.1| heat shock protein GrpE [Vibrio cholerae MZO-2]
 gi|153828290|ref|ZP_01980957.1| heat shock protein GrpE [Vibrio cholerae 623-39]
 gi|254225096|ref|ZP_04918710.1| heat shock protein GrpE [Vibrio cholerae V51]
 gi|297581243|ref|ZP_06943167.1| heat shock protein GrpE [Vibrio cholerae RC385]
 gi|124122421|gb|EAY41164.1| heat shock protein GrpE [Vibrio cholerae MZO-3]
 gi|125622483|gb|EAZ50803.1| heat shock protein GrpE [Vibrio cholerae V51]
 gi|148876244|gb|EDL74379.1| heat shock protein GrpE [Vibrio cholerae 623-39]
 gi|149741814|gb|EDM55843.1| heat shock protein GrpE [Vibrio cholerae MZO-2]
 gi|297534559|gb|EFH73396.1| heat shock protein GrpE [Vibrio cholerae RC385]
 gi|327483599|gb|AEA78006.1| Heat shock protein GrpE [Vibrio cholerae LMA3894-4]
          Length = 200

 Score =  114 bits (286), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 96/145 (66%), Gaps = 10/145 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+EN+RRR+++E   A+ +++++FA ++L V DNL RA+ +A  ++     
Sbjct: 65  QDSVLRARAEVENMRRRSEQEVDKARKFALSRFAEELLPVIDNLERAIQAADGEV----- 119

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                +K L+EG+E+T +  + T+ ++G+K+I+   + FNP  HQAM  +E  +  P NT
Sbjct: 120 ---EAIKPLLEGVELTHKTFVDTIAKFGLKEINPHGEAFNPEFHQAMSIQESAEHEP-NT 175

Query: 163 IIKVVQDGYAINERVLRPALVSISK 187
           ++ V+Q GY +N RVLRPA+V +SK
Sbjct: 176 VMFVMQKGYELNGRVLRPAMVMVSK 200


>gi|254453526|ref|ZP_05066963.1| co-chaperone GrpE [Octadecabacter antarcticus 238]
 gi|198267932|gb|EDY92202.1| co-chaperone GrpE [Octadecabacter antarcticus 238]
          Length = 190

 Score =  114 bits (286), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 95/146 (65%), Gaps = 8/146 (5%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           + +D Y+R +A++EN R+R DR++++A++Y  ++ ARD+L + DNL RAL     D  + 
Sbjct: 47  QLKDGYMRALADVENSRKRADRDRREAENYGGSRLARDLLPIYDNLERALKMNKEDGKDG 106

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPA 160
           +       K+L+EG+E+T R ++   +++G+  I A+  ++F+P +H+AMFE P     A
Sbjct: 107 D-------KALLEGVELTMRALVGVFKKHGIDPIVAEVGERFDPQIHEAMFEAPLPGTKA 159

Query: 161 NTIIKVVQDGYAINERVLRPALVSIS 186
             II+V   G+ +++R+LRPA V +S
Sbjct: 160 GDIIQVASTGFMLHDRLLRPAQVGVS 185


>gi|163749510|ref|ZP_02156758.1| heat shock protein GrpE [Shewanella benthica KT99]
 gi|161330919|gb|EDQ01846.1| heat shock protein GrpE [Shewanella benthica KT99]
          Length = 209

 Score =  114 bits (286), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 98/154 (63%), Gaps = 8/154 (5%)

Query: 35  ESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSA 94
           ES  + EE  D   R  A   N+RRR  ++ + A+ +++ KFA ++L V DN+ RAL+  
Sbjct: 56  ESQTKVEEQVDSVTRAAASEANIRRRAAQDVEKARKFALEKFANELLPVIDNMERALE-- 113

Query: 95  PLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEP 154
                 ++ ++E   K++ EG+E+T +  +ST++++G+K ID + + FNP  HQA+  +P
Sbjct: 114 -----GTDAEAEEA-KAIYEGVELTLKNFISTVDKFGLKVIDPQGEAFNPEHHQAIGMQP 167

Query: 155 HDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
               P NT++ V+Q GY +N+R+LRPA+V +S+G
Sbjct: 168 SPDFPENTVMMVMQKGYILNDRLLRPAMVMVSQG 201


>gi|163802500|ref|ZP_02196393.1| GrpE [Vibrio sp. AND4]
 gi|159173801|gb|EDP58616.1| GrpE [Vibrio sp. AND4]
          Length = 198

 Score =  114 bits (286), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 56/144 (38%), Positives = 93/144 (64%), Gaps = 8/144 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+EN+RRRT++E   A+ Y++ KFA ++L V DNL RA+ +A  +      
Sbjct: 63  QDAVLRAKAEVENMRRRTEQEVDKARKYALNKFAEELLPVIDNLERAIQAADAE------ 116

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
               V+K +IEG+E+T +  +  + ++G+K+I+ + + FNP  HQAM  +      +NT+
Sbjct: 117 --HEVVKPIIEGVELTHKTFVGAVSKFGLKEINPEGEVFNPEFHQAMSIQESPDHESNTV 174

Query: 164 IKVVQDGYAINERVLRPALVSISK 187
           + V+Q GY +N RV+RPA+V ++K
Sbjct: 175 MFVMQKGYELNGRVIRPAMVMVAK 198


>gi|52424798|ref|YP_087935.1| GrpE protein [Mannheimia succiniciproducens MBEL55E]
 gi|52306850|gb|AAU37350.1| GrpE protein [Mannheimia succiniciproducens MBEL55E]
          Length = 204

 Score =  114 bits (286), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 92/143 (64%), Gaps = 7/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE++N+RRR +++ + A  +++ KF++D+L+  DNL RAL       A    
Sbjct: 68  QDLLLRSRAELDNMRRRAEQDVEKAHKFALEKFSKDILNTIDNLERAL-------ATPAN 120

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           K +  +KSL +G+E+T +E+++T+ R+GV+ + A  + FNP +HQA+  +  +    N I
Sbjct: 121 KEDEAVKSLFDGVELTLKELLATVARFGVEPVGAVGETFNPELHQAISMQSAEGFETNQI 180

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY +N RV+RPA+V ++
Sbjct: 181 TVVLQKGYLLNGRVIRPAMVMVA 203


>gi|330958065|gb|EGH58325.1| heat shock protein GrpE [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 187

 Score =  114 bits (285), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 112/185 (60%), Gaps = 12/185 (6%)

Query: 7   EKNIDKEKNPSNANSSTAEE-KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
           E+N+D +     A + T EE  + + + EE L  ++   D+ LRV A+++N+RRR +++ 
Sbjct: 4   EQNLDAQAQDQAAEAGTGEELTTRVQVLEEQLAAAQ---DQSLRVAADLQNVRRRAEQDV 60

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
           + A  +++ KFA D+L + D+L R LD     L+N + +S   ++ + EGIE+T +    
Sbjct: 61  EKAHKFALEKFAGDLLPIIDSLERGLD-----LSNPDDES---IRPMREGIELTLKMFQD 112

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
           TL+RY ++ ID   Q F+ + HQAM  +    V  NT++KV Q GY +N R+LRPA+V +
Sbjct: 113 TLKRYQLEAIDPHGQPFSADQHQAMAMQESADVEPNTVLKVFQKGYQLNGRLLRPAMVVV 172

Query: 186 SKGKT 190
           SK  +
Sbjct: 173 SKAPS 177


>gi|77360165|ref|YP_339740.1| nucleotide exchange factor [Pseudoalteromonas haloplanktis TAC125]
 gi|123589346|sp|Q3IKR2|GRPE_PSEHT RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|76875076|emb|CAI86297.1| Hsp 24 DnaK nucleotide exchange factor; probable member of the
           DnaK/DnaJ/GrpE foldase complex [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 203

 Score =  114 bits (285), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 55/145 (37%), Positives = 95/145 (65%), Gaps = 8/145 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  +R  A++EN+RRR  ++ + A  +++ KFA ++L V DNL RA++        S+K
Sbjct: 64  KDGVVRAAADVENMRRRAAQDVEKAHKFALEKFANELLPVIDNLERAIEF-------SDK 116

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           ++E+ LK ++EGI MT +     + ++GV+ ++ + ++FNP  HQAM  +P + V  NT+
Sbjct: 117 ENET-LKPVLEGISMTVKSFNDAVAKFGVEIVNPQGEQFNPEFHQAMSIQPSNDVSPNTV 175

Query: 164 IKVVQDGYAINERVLRPALVSISKG 188
           + V+Q GY +N R+LRPA+V +SK 
Sbjct: 176 LAVMQKGYTLNGRLLRPAMVMVSKA 200


>gi|261820283|ref|YP_003258389.1| heat shock protein GrpE [Pectobacterium wasabiae WPP163]
 gi|261604296|gb|ACX86782.1| GrpE protein [Pectobacterium wasabiae WPP163]
          Length = 195

 Score =  114 bits (285), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 58/146 (39%), Positives = 92/146 (63%), Gaps = 8/146 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LRV AE +N+RRR + + + A  +++ KFA +ML V DNL RALD+A       +K
Sbjct: 57  RDNMLRVRAEADNVRRRAEMDIEKAHKFAVEKFANEMLPVIDNLERALDTA-------DK 109

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
            +ES L ++IEG+E+T + ++  + ++G+  +      FNP +HQAM   P      N +
Sbjct: 110 ANES-LAAMIEGVELTLKSLLDAVHKFGIDVVGDVGVPFNPEVHQAMTMLPSADHQPNHV 168

Query: 164 IKVVQDGYAINERVLRPALVSISKGK 189
           + V+Q GY +N R+LRPA+V++SK +
Sbjct: 169 MMVMQKGYTLNGRLLRPAMVAVSKAQ 194


>gi|271499343|ref|YP_003332368.1| GrpE protein [Dickeya dadantii Ech586]
 gi|270342898|gb|ACZ75663.1| GrpE protein [Dickeya dadantii Ech586]
          Length = 195

 Score =  114 bits (285), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 60/147 (40%), Positives = 93/147 (63%), Gaps = 10/147 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           R+  LR  AEMEN+RRR + + + A  +++ KFA +ML V DNL RAL+ A         
Sbjct: 57  RENALRARAEMENVRRRAELDVEKAHKFALEKFAGEMLPVIDNLERALEMA--------D 108

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
           KS   L  +IEG+E+T + M+S + ++G++ +   +  FNP++HQAM   E  +  P N 
Sbjct: 109 KSNEALSGMIEGVELTLKAMLSAVSKFGIEVVAEVNVPFNPDVHQAMTLLESAEHEP-NH 167

Query: 163 IIKVVQDGYAINERVLRPALVSISKGK 189
           ++ V+Q GY +N R+LRPA+V++SK K
Sbjct: 168 VMMVMQKGYTLNGRLLRPAMVAVSKAK 194


>gi|229513042|ref|ZP_04402508.1| heat shock protein GrpE [Vibrio cholerae TMA 21]
 gi|229349935|gb|EEO14889.1| heat shock protein GrpE [Vibrio cholerae TMA 21]
          Length = 206

 Score =  114 bits (285), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 96/145 (66%), Gaps = 10/145 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+EN+RRR+++E   A+ +++++FA ++L V DNL RA+ +A  ++     
Sbjct: 71  QDSVLRARAEVENMRRRSEQEVDKARKFALSRFAEELLPVIDNLERAIQAADGEV----- 125

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                +K L+EG+E+T +  + T+ ++G+K+I+   + FNP  HQAM  +E  +  P NT
Sbjct: 126 ---EAIKPLLEGVELTHKTFVDTIAKFGLKEINPHGEAFNPEFHQAMSIQESAEHEP-NT 181

Query: 163 IIKVVQDGYAINERVLRPALVSISK 187
           ++ V+Q GY +N RVLRPA+V +SK
Sbjct: 182 VMFVMQKGYELNGRVLRPAMVMVSK 206


>gi|45440883|ref|NP_992422.1| heat shock protein GrpE [Yersinia pestis biovar Microtus str.
           91001]
 gi|51595485|ref|YP_069676.1| heat shock protein GrpE [Yersinia pseudotuberculosis IP 32953]
 gi|145599855|ref|YP_001163931.1| heat shock protein GrpE [Yersinia pestis Pestoides F]
 gi|153947129|ref|YP_001401850.1| heat shock protein GrpE [Yersinia pseudotuberculosis IP 31758]
 gi|162419727|ref|YP_001605904.1| heat shock protein GrpE [Yersinia pestis Angola]
 gi|166211740|ref|ZP_02237775.1| co-chaperone GrpE [Yersinia pestis biovar Antiqua str. B42003004]
 gi|170025196|ref|YP_001721701.1| heat shock protein GrpE [Yersinia pseudotuberculosis YPIII]
 gi|186894538|ref|YP_001871650.1| heat shock protein GrpE [Yersinia pseudotuberculosis PB1/+]
 gi|229893984|ref|ZP_04509170.1| heat shock protein [Yersinia pestis Pestoides A]
 gi|81691854|sp|Q66DA8|GRPE_YERPS RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|166215292|sp|A4TNU6|GRPE_YERPP RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|167008737|sp|A7FKS2|GRPE_YERP3 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737239|sp|B2K8E3|GRPE_YERPB RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737240|sp|A9R2E4|GRPE_YERPG RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737241|sp|B1JG65|GRPE_YERPY RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|45435741|gb|AAS61299.1| heat shock protein GrpE [Yersinia pestis biovar Microtus str.
           91001]
 gi|51588767|emb|CAH20381.1| heat shock protein GrpE [Yersinia pseudotuberculosis IP 32953]
 gi|145211551|gb|ABP40958.1| heat shock protein GrpE [Yersinia pestis Pestoides F]
 gi|152958624|gb|ABS46085.1| co-chaperone GrpE [Yersinia pseudotuberculosis IP 31758]
 gi|162352542|gb|ABX86490.1| co-chaperone GrpE [Yersinia pestis Angola]
 gi|166207511|gb|EDR51991.1| co-chaperone GrpE [Yersinia pestis biovar Antiqua str. B42003004]
 gi|169751730|gb|ACA69248.1| GrpE protein [Yersinia pseudotuberculosis YPIII]
 gi|186697564|gb|ACC88193.1| GrpE protein [Yersinia pseudotuberculosis PB1/+]
 gi|229703869|gb|EEO90882.1| heat shock protein [Yersinia pestis Pestoides A]
          Length = 192

 Score =  114 bits (285), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 59/148 (39%), Positives = 96/148 (64%), Gaps = 10/148 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           R+  LR  AE+EN+RRRT+ + + A  +++ +F+ ++L V DNL RALD+A  D  N+E 
Sbjct: 54  RESLLRAKAEVENIRRRTELDVEKAHKFALERFSSELLPVIDNLERALDTA--DKTNTE- 110

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                L S+IEG+E+T + ++  + ++G++ +      FNP +HQAM   E  D  P N 
Sbjct: 111 -----LTSMIEGVELTLKSLLDAVGKFGIEVVGETHVPFNPEVHQAMTMLESADHEP-NH 164

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ V+Q GY +N R+LRPA+V++SK K+
Sbjct: 165 VMMVMQKGYTLNGRLLRPAMVAVSKAKS 192


>gi|229523341|ref|ZP_04412748.1| heat shock protein GrpE [Vibrio cholerae TM 11079-80]
 gi|229525477|ref|ZP_04414882.1| heat shock protein GrpE [Vibrio cholerae bv. albensis VL426]
 gi|229530038|ref|ZP_04419428.1| heat shock protein GrpE [Vibrio cholerae 12129(1)]
 gi|229333812|gb|EEN99298.1| heat shock protein GrpE [Vibrio cholerae 12129(1)]
 gi|229339058|gb|EEO04075.1| heat shock protein GrpE [Vibrio cholerae bv. albensis VL426]
 gi|229339704|gb|EEO04719.1| heat shock protein GrpE [Vibrio cholerae TM 11079-80]
          Length = 206

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 96/145 (66%), Gaps = 10/145 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+EN+RRR+++E   A+ +++++FA ++L V DNL RA+ +A  ++     
Sbjct: 71  QDSVLRARAEVENMRRRSEQEVDKARKFALSRFAEELLPVIDNLERAIQAADGEV----- 125

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                +K L+EG+E+T +  + T+ ++G+K+I+   + FNP  HQAM  +E  +  P NT
Sbjct: 126 ---EAIKPLLEGVELTHKTFVDTIAKFGLKEINPHGEAFNPEFHQAMSIQESAEHEP-NT 181

Query: 163 IIKVVQDGYAINERVLRPALVSISK 187
           ++ V+Q GY +N RVLRPA+V +SK
Sbjct: 182 VMFVMQKGYELNGRVLRPAMVMVSK 206


>gi|254465145|ref|ZP_05078556.1| co-chaperone GrpE [Rhodobacterales bacterium Y4I]
 gi|206686053|gb|EDZ46535.1| co-chaperone GrpE [Rhodobacterales bacterium Y4I]
          Length = 187

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 54/147 (36%), Positives = 96/147 (65%), Gaps = 8/147 (5%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           +E +D+++R +A+ EN R+R D+ +++A+ Y  +K ARDML V DN+ RA+++     A 
Sbjct: 43  DELKDRFMRALADAENARKRGDKARREAEQYGGSKLARDMLPVYDNMKRAIEA-----AT 97

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVP 159
            E++  S   +LIEG+E+T R ++   E++G++ +  +   KF+P +H+AMFE P     
Sbjct: 98  DEQREVSA--ALIEGVELTMRSLLGVFEKHGIRVVSPEVGDKFDPQVHEAMFEAPVPGTK 155

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
           A  II+V  +G+ +++R+LR A V +S
Sbjct: 156 AGDIIQVSAEGFMLHDRLLRAAQVGVS 182


>gi|238750399|ref|ZP_04611900.1| hypothetical protein yrohd0001_21100 [Yersinia rohdei ATCC 43380]
 gi|238711330|gb|EEQ03547.1| hypothetical protein yrohd0001_21100 [Yersinia rohdei ATCC 43380]
          Length = 192

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 59/148 (39%), Positives = 98/148 (66%), Gaps = 10/148 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           R+  LR  AE+EN+RRRT+ + + A  +++ +F+ ++L V DNL RA+D+A  D  N+E 
Sbjct: 54  RESLLRAKAEVENIRRRTELDVEKAHKFALERFSAELLPVIDNLERAIDTA--DKNNAE- 110

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                L S+IEG+E+T + ++  + +YG++ +   +  FNP++HQAM   E  D  P N 
Sbjct: 111 -----LTSMIEGVELTLKSLLDAVGKYGIEVVSDTNVPFNPDVHQAMTMLESADHEP-NH 164

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ V+Q GY +N R+LRPA+V++SK K+
Sbjct: 165 VMMVMQKGYTLNGRLLRPAMVAVSKAKS 192


>gi|256996829|dbj|BAI22705.1| GrpE protein [Acetobacter pasteurianus]
          Length = 198

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 93/149 (62%), Gaps = 4/149 (2%)

Query: 40  SEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLA 99
           + +F++K LR  AE +NLR R  R+  DA+ Y++ KFARD++  ++NL RAL S P    
Sbjct: 53  AADFKEKLLRSEAENQNLRARAKRDLDDARQYAVQKFARDVVEAAENLRRALASLP---- 108

Query: 100 NSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVP 159
            +++  +SVL  + EGIE T R  +S LER+G+K  D   + F+ N+HQAM E+P     
Sbjct: 109 PAQEGEDSVLTKMREGIESTERSFISILERHGIKCDDPAGKPFDANLHQAMAEQPSAEHE 168

Query: 160 ANTIIKVVQDGYAINERVLRPALVSISKG 188
             T+++     + ++ R+L+PA+V ++K 
Sbjct: 169 PGTVMQAWTPTWTLHGRLLKPAMVVVAKA 197


>gi|126140064|ref|XP_001386554.1| hypothetical protein PICST_64096 [Scheffersomyces stipitis CBS
           6054]
 gi|126093838|gb|ABN68525.1| predicted protein [Scheffersomyces stipitis CBS 6054]
          Length = 188

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 105/182 (57%), Gaps = 11/182 (6%)

Query: 11  DKEKNPSNANSSTAEEKSEINIPEESLNQSEE----FRDKYLRVIAEMENLRRRTDREKK 66
           +KE+ P  A S  AEE++ IN  +E L+  ++     ++ Y R IA+  NL+  T  E +
Sbjct: 11  NKEEKPVEAIS--AEEQA-INELKEKLDAKDKELANMKNHYARSIADFRNLQDTTKLEVQ 67

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
            A+ +++ KFA+D+L   DN S AL+S    +     K+   +KSL EG+ MTR     T
Sbjct: 68  KAKDFALQKFAKDLLESLDNFSLALES----VKEETLKTNEEVKSLYEGVNMTRNIFEKT 123

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           L R+G++KID   Q+F+PN H+A F+ P       T+  V Q GY +N RVLRPA V + 
Sbjct: 124 LSRHGIEKIDPIGQQFDPNQHEATFQVPQPDKEPGTVFHVQQHGYTLNSRVLRPAKVGLV 183

Query: 187 KG 188
           KG
Sbjct: 184 KG 185


>gi|288941112|ref|YP_003443352.1| GrpE protein [Allochromatium vinosum DSM 180]
 gi|288896484|gb|ADC62320.1| GrpE protein [Allochromatium vinosum DSM 180]
          Length = 218

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 55/150 (36%), Positives = 90/150 (60%), Gaps = 8/150 (5%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           E+ RD+ LR  AE+ENLRRR  +E + A  +++  F R++L V D+L            N
Sbjct: 75  EDSRDQVLRARAELENLRRRHAQELEKAHKFALDGFVRELLQVRDSLELG--------CN 126

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
           + +++ + +  L EG E+T + +   +E++GV  +D  +Q F+P  HQAM  +P + VP 
Sbjct: 127 AAQEASADVDKLREGTELTLKLLGDVMEKFGVGVVDPANQPFDPEFHQAMSMQPREDVPP 186

Query: 161 NTIIKVVQDGYAINERVLRPALVSISKGKT 190
           NT++ V+Q GY +N R+ RPALV +S+   
Sbjct: 187 NTVVLVIQKGYTLNGRLARPALVMVSQAAV 216


>gi|238759666|ref|ZP_04620826.1| hypothetical protein yaldo0001_24710 [Yersinia aldovae ATCC 35236]
 gi|238702094|gb|EEP94651.1| hypothetical protein yaldo0001_24710 [Yersinia aldovae ATCC 35236]
          Length = 192

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 96/147 (65%), Gaps = 10/147 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           R+  LR  AE+EN+RRRT+ + + A  +++ +F+ ++L V DNL RALD+A  D +N+E 
Sbjct: 54  RESLLRAKAEVENIRRRTELDVEKAHKFALERFSAELLPVIDNLERALDTA--DKSNTE- 110

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                L S+IEG+E+T + ++  + ++G++ +      FNP +HQAM   E  D  P N 
Sbjct: 111 -----LTSMIEGVELTLKSLLDAVGKFGIEVVGETHVPFNPEVHQAMTMLESADHEP-NH 164

Query: 163 IIKVVQDGYAINERVLRPALVSISKGK 189
           ++ V+Q GY +N R+LRPA+V++SK K
Sbjct: 165 VMMVMQKGYTLNGRLLRPAMVAVSKAK 191


>gi|148260644|ref|YP_001234771.1| GrpE protein [Acidiphilium cryptum JF-5]
 gi|326403838|ref|YP_004283920.1| GrpE protein [Acidiphilium multivorum AIU301]
 gi|146402325|gb|ABQ30852.1| GrpE protein [Acidiphilium cryptum JF-5]
 gi|325050700|dbj|BAJ81038.1| GrpE protein [Acidiphilium multivorum AIU301]
          Length = 202

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 63/198 (31%), Positives = 107/198 (54%), Gaps = 10/198 (5%)

Query: 2   ETFMSEKNIDKEKNPSNANS--STAEEKSEINIPEESLN----QSEEFRDKYLRVIAEME 55
           +T  +E  +D   +P  A S  + A E  ++    E +     +S + RDK++R  AEME
Sbjct: 4   DTLNAEPVLDAGADPLEAGSERAPASEAEQLAAARERIAALEAESADLRDKWVRAQAEME 63

Query: 56  NLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEG 115
           NLR RT RE +DA+ Y++ KFA D+   ++NL R LD+ P      ++    +L  L +G
Sbjct: 64  NLRARTRREVEDARLYAVQKFAADVAETAENLRRGLDALP----PPQEGESPLLARLRDG 119

Query: 116 IEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINE 175
                R  ++ LER+G++  +A    F+ + HQAM E+     P  T+I+     + +N 
Sbjct: 120 FAGVERSFIAMLERHGIRAEEAMGATFDADKHQAMGEQETSDAPPGTVIQAWSRTWTLNG 179

Query: 176 RVLRPALVSISKGKTQNP 193
           R+L+PA+V +++ +   P
Sbjct: 180 RLLKPAMVVVARAQAGKP 197


>gi|90412549|ref|ZP_01220552.1| putative heat shock protein GrpE [Photobacterium profundum 3TCK]
 gi|90326586|gb|EAS42992.1| putative heat shock protein GrpE [Photobacterium profundum 3TCK]
          Length = 206

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 60/148 (40%), Positives = 96/148 (64%), Gaps = 10/148 (6%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E +D  LR  AE EN+RRR++ E   A+ +++ KF  ++L V DNL RA++ A       
Sbjct: 59  EAQDNVLRARAEGENVRRRSEVEIDKARKFALNKFTEELLPVIDNLERAIEMA------- 111

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPA 160
             K++  LKS+IEG+E+T + M +T+E++G+K+ +   + FNP  HQAM  +E  +  P 
Sbjct: 112 -DKNDEALKSMIEGVELTLKTMTATVEKFGLKQHNPVGEAFNPEFHQAMSIQESAEHEP- 169

Query: 161 NTIIKVVQDGYAINERVLRPALVSISKG 188
           NT++ V+Q GY +N R++RPA+V +SK 
Sbjct: 170 NTVMLVMQKGYELNGRIIRPAMVMVSKA 197


>gi|307824249|ref|ZP_07654475.1| GrpE protein [Methylobacter tundripaludum SV96]
 gi|307734629|gb|EFO05480.1| GrpE protein [Methylobacter tundripaludum SV96]
          Length = 203

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 70/195 (35%), Positives = 107/195 (54%), Gaps = 14/195 (7%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPE--ESLNQSE----EFRDKYLRVIAEMENLRRR 60
           E  +  E   +N    T   + E+ I E  ++L Q+E    E  DK +R  AEMENL+RR
Sbjct: 9   ESQVKAENGTANEQPHTELAEHELTIEELQQALAQAEHKAQENWDKAVRAQAEMENLKRR 68

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T ++ +DA  +++  FA+++L V D+L   L +A  D       SE V K   EG E+T 
Sbjct: 69  TQKDLEDAHKFALTGFAKELLPVLDSLVLGLQAATGD-------SEEV-KKFREGSELTI 120

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           ++  S   ++ ++ ID   Q FN   HQAM  +  D V  NT++ V Q GY +N R+LRP
Sbjct: 121 KQFESVFAKFKIETIDPIGQPFNAEQHQAMAMQAVDGVEPNTVVNVFQKGYMLNGRLLRP 180

Query: 181 ALVSISKGKTQNPTE 195
           A+V ++K   + PT+
Sbjct: 181 AMVLVAKAAEKKPTD 195


>gi|62859157|ref|NP_001016179.1| GrpE-like 1, mitochondrial [Xenopus (Silurana) tropicalis]
 gi|60688505|gb|AAH91625.1| GrpE-like 1, mitochondrial (E. coli) [Xenopus (Silurana)
           tropicalis]
 gi|89268263|emb|CAJ83537.1| GrpE like 1 mitochondrial (E.coli) [Xenopus (Silurana) tropicalis]
          Length = 216

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 94/152 (61%), Gaps = 5/152 (3%)

Query: 38  NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD 97
           +Q ++  DKY R +A+ ENLR+R+ +   +A+ Y I  F +D+L V+D L +A +S P  
Sbjct: 68  DQIKDLTDKYKRALADTENLRQRSKKLVDEAKLYGIQGFCKDLLEVADILEKATESVP-- 125

Query: 98  LANSEKKSESV-LKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHD 156
              +E K+E+  LK+L EG+ MT  +M   L+++GV K++    KFNP  H+A+F  P +
Sbjct: 126 --KAEIKAENPHLKNLYEGLIMTEVQMQKVLKKHGVVKLNPVGDKFNPYEHEALFHSPVE 183

Query: 157 TVPANTIIKVVQDGYAINERVLRPALVSISKG 188
                T+  V + GY ++ER LRPALV + KG
Sbjct: 184 GKEPGTVALVTKVGYKLHERTLRPALVGVVKG 215


>gi|15640870|ref|NP_230501.1| heat shock protein GrpE [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121585724|ref|ZP_01675519.1| heat shock protein GrpE [Vibrio cholerae 2740-80]
 gi|147673276|ref|YP_001216335.1| heat shock protein GrpE [Vibrio cholerae O395]
 gi|227081030|ref|YP_002809581.1| heat shock protein GrpE [Vibrio cholerae M66-2]
 gi|254847991|ref|ZP_05237341.1| HSP-70 cofactor grpE [Vibrio cholerae MO10]
 gi|255744654|ref|ZP_05418605.1| heat shock protein GrpE [Vibrio cholera CIRS 101]
 gi|262161215|ref|ZP_06030326.1| heat shock protein GrpE [Vibrio cholerae INDRE 91/1]
 gi|262168719|ref|ZP_06036414.1| heat shock protein GrpE [Vibrio cholerae RC27]
 gi|298499017|ref|ZP_07008824.1| co-chaperone GrpE [Vibrio cholerae MAK 757]
 gi|12644057|sp|O30862|GRPE_VIBCH RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|172047432|sp|A5F369|GRPE_VIBC3 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|254799622|sp|C3LTA4|GRPE_VIBCM RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|9655306|gb|AAF94016.1| heat shock protein GrpE [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121550087|gb|EAX60103.1| heat shock protein GrpE [Vibrio cholerae 2740-80]
 gi|146315159|gb|ABQ19698.1| heat shock protein GrpE [Vibrio cholerae O395]
 gi|227008918|gb|ACP05130.1| heat shock protein GrpE [Vibrio cholerae M66-2]
 gi|227012674|gb|ACP08884.1| heat shock protein GrpE [Vibrio cholerae O395]
 gi|254843696|gb|EET22110.1| HSP-70 cofactor grpE [Vibrio cholerae MO10]
 gi|255737685|gb|EET93079.1| heat shock protein GrpE [Vibrio cholera CIRS 101]
 gi|262022837|gb|EEY41543.1| heat shock protein GrpE [Vibrio cholerae RC27]
 gi|262028965|gb|EEY47618.1| heat shock protein GrpE [Vibrio cholerae INDRE 91/1]
 gi|297543350|gb|EFH79400.1| co-chaperone GrpE [Vibrio cholerae MAK 757]
          Length = 200

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 96/145 (66%), Gaps = 10/145 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+EN+RRR+++E   A+ +++++FA ++L V DNL RA+ +A  ++     
Sbjct: 65  QDSVLRARAEVENMRRRSEQEVDKARKFALSRFAEELLPVIDNLERAIQAADGEV----- 119

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                +K L+EG+E+T +  + T+ ++G+K+I+   + FNP  HQAM  +E  +  P NT
Sbjct: 120 ---EAIKPLLEGVELTHKTFVDTIAKFGLKEINPHGEVFNPEFHQAMSIQESAEHEP-NT 175

Query: 163 IIKVVQDGYAINERVLRPALVSISK 187
           ++ V+Q GY +N RVLRPA+V +SK
Sbjct: 176 VMFVMQKGYELNGRVLRPAMVMVSK 200


>gi|258625217|ref|ZP_05720130.1| heat shock protein GrpE [Vibrio mimicus VM603]
 gi|262165114|ref|ZP_06032851.1| heat shock protein GrpE [Vibrio mimicus VM223]
 gi|262172126|ref|ZP_06039804.1| heat shock protein GrpE [Vibrio mimicus MB-451]
 gi|258582507|gb|EEW07343.1| heat shock protein GrpE [Vibrio mimicus VM603]
 gi|261893202|gb|EEY39188.1| heat shock protein GrpE [Vibrio mimicus MB-451]
 gi|262024830|gb|EEY43498.1| heat shock protein GrpE [Vibrio mimicus VM223]
          Length = 200

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 99/145 (68%), Gaps = 10/145 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+EN+RRR+++E   A+ +++++FA ++L V DNL RA+ +A     +SE 
Sbjct: 65  QDNVLRARAEVENMRRRSEQEVDKARKFALSRFAEELLPVIDNLERAIQAA-----DSEV 119

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
           ++   +K L+EG+E+T +  + T+ ++G+K+I+   + FNP  HQAM  +E  +  P NT
Sbjct: 120 EA---IKPLLEGVELTHKTFVDTIAKFGLKEINPHGEAFNPEFHQAMSIQESAEHEP-NT 175

Query: 163 IIKVVQDGYAINERVLRPALVSISK 187
           ++ V+Q GY +N RV+RPA+V +SK
Sbjct: 176 VMFVMQKGYELNGRVVRPAMVMVSK 200


>gi|332140812|ref|YP_004426550.1| heat shock protein GrpE [Alteromonas macleodii str. 'Deep ecotype']
 gi|327550834|gb|AEA97552.1| heat shock protein GrpE [Alteromonas macleodii str. 'Deep ecotype']
          Length = 207

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 97/147 (65%), Gaps = 10/147 (6%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E +D  LR  A+ +N RRR + E + A+ +++ +FA ++L V DNL RA++        +
Sbjct: 60  EQQDGVLRARADADNARRRAEGEVEKARKFALERFAGELLPVIDNLERAIEM-------T 112

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPA 160
           +  +E+V K L+EG+EMT +  + T+E++G+  ID + + FNP++HQAM  +E  D  P 
Sbjct: 113 DGDNEAV-KPLLEGVEMTHKTFLGTIEKFGLSLIDPQGETFNPDLHQAMSMQESADHEP- 170

Query: 161 NTIIKVVQDGYAINERVLRPALVSISK 187
           NT++ V+Q GY IN R+LRPA+V +S+
Sbjct: 171 NTVMAVMQKGYQINGRLLRPAMVMVSR 197


>gi|161615613|ref|YP_001589578.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|198246197|ref|YP_002216690.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|161364977|gb|ABX68745.1| hypothetical protein SPAB_03396 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|197940713|gb|ACH78046.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|320087159|emb|CBY96926.1| Protein grpE HSP-70 cofactor [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
          Length = 250

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 94/146 (64%), Gaps = 8/146 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LR+ AEMENLRRRT+++ + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 113 RDTVLRIKAEMENLRRRTEQDIEKAHKFALEKFVNELLPVIDSLDRALEVA--DKANPD- 169

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
                + +++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+     + VPA  +
Sbjct: 170 -----MAAMVEGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESEEVPAGNV 224

Query: 164 IKVVQDGYAINERVLRPALVSISKGK 189
           + ++Q GY +N R +R A+V+++K K
Sbjct: 225 LGIMQKGYTLNGRTIRAAMVTVAKAK 250


>gi|200388944|ref|ZP_03215556.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|199606042|gb|EDZ04587.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
          Length = 253

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 94/146 (64%), Gaps = 8/146 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LR+ AEMENLRRRT+++ + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 116 RDTVLRIKAEMENLRRRTEQDIEKAHKFALEKFVNELLPVIDSLDRALEVA--DKANPD- 172

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
                + +++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+     + VPA  +
Sbjct: 173 -----MAAMVEGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESEEVPAGNV 227

Query: 164 IKVVQDGYAINERVLRPALVSISKGK 189
           + ++Q GY +N R +R A+V+++K K
Sbjct: 228 LGIMQKGYTLNGRTIRAAMVTVAKAK 253


>gi|156973442|ref|YP_001444349.1| molecular chaperone GrpE [Vibrio harveyi ATCC BAA-1116]
 gi|156525036|gb|ABU70122.1| hypothetical protein VIBHAR_01132 [Vibrio harveyi ATCC BAA-1116]
          Length = 212

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 96/147 (65%), Gaps = 14/147 (9%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+EN+RRRT++E   A+ Y++ KFA ++L V DNL RA+ +A  +      
Sbjct: 77  QDAVLRAKAEVENMRRRTEQEIDKARKYALNKFAEELLPVIDNLERAIQAADAE------ 130

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMF--EEP-HDTVPA 160
               V+K ++EG+E+T +  +  + ++G+K+I+ + + FNP  HQAM   E P HD+   
Sbjct: 131 --HEVVKPILEGVELTHKTFVDAVSKFGLKEINPEGEAFNPEFHQAMSIQESPDHDS--- 185

Query: 161 NTIIKVVQDGYAINERVLRPALVSISK 187
           NT++ V+Q GY +N RV+RPA+V ++K
Sbjct: 186 NTVMFVMQKGYELNGRVVRPAMVMVAK 212


>gi|197250981|ref|YP_002147617.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|205360169|ref|ZP_02835041.2| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|224584533|ref|YP_002638331.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|197214684|gb|ACH52081.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|205340646|gb|EDZ27410.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|224469060|gb|ACN46890.1| molecular chaparone; heat shock protein [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
          Length = 241

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 94/146 (64%), Gaps = 8/146 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LR+ AEMENLRRRT+++ + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 104 RDTVLRIKAEMENLRRRTEQDIEKAHKFALEKFVNELLPVIDSLDRALEVA--DKANPD- 160

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
                + +++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+     + VPA  +
Sbjct: 161 -----MAAMVEGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESEEVPAGNV 215

Query: 164 IKVVQDGYAINERVLRPALVSISKGK 189
           + ++Q GY +N R +R A+V+++K K
Sbjct: 216 LGIMQKGYTLNGRTIRAAMVTVAKAK 241


>gi|28897425|ref|NP_797030.1| heat shock protein GrpE [Vibrio parahaemolyticus RIMD 2210633]
 gi|153837715|ref|ZP_01990382.1| co-chaperone GrpE [Vibrio parahaemolyticus AQ3810]
 gi|260876388|ref|ZP_05888743.1| co-chaperone GrpE [Vibrio parahaemolyticus AN-5034]
 gi|260898659|ref|ZP_05907155.1| co-chaperone GrpE [Vibrio parahaemolyticus Peru-466]
 gi|260899247|ref|ZP_05907642.1| co-chaperone GrpE [Vibrio parahaemolyticus AQ4037]
 gi|52782932|sp|Q87RX5|GRPE_VIBPA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|28805637|dbj|BAC58914.1| GrpE [Vibrio parahaemolyticus RIMD 2210633]
 gi|149748910|gb|EDM59741.1| co-chaperone GrpE [Vibrio parahaemolyticus AQ3810]
 gi|308086958|gb|EFO36653.1| co-chaperone GrpE [Vibrio parahaemolyticus Peru-466]
 gi|308092973|gb|EFO42668.1| co-chaperone GrpE [Vibrio parahaemolyticus AN-5034]
 gi|308106601|gb|EFO44141.1| co-chaperone GrpE [Vibrio parahaemolyticus AQ4037]
 gi|328472562|gb|EGF43425.1| heat shock protein GrpE [Vibrio parahaemolyticus 10329]
          Length = 198

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/144 (39%), Positives = 94/144 (65%), Gaps = 8/144 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+EN+RRRT++E   A+ Y++ KFA ++L V DNL RA+ +A  D  N   
Sbjct: 63  QDAVLRAKAEVENMRRRTEQEIDKARKYALNKFAEELLPVIDNLERAIQAA--DTENE-- 118

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
               V+K ++EG+E+T +  +  + ++G+K+I+ + + FNP  HQAM  +      +NT+
Sbjct: 119 ----VIKPILEGVELTHKTFVDVVAKFGLKEINPEGETFNPEFHQAMSIQESPDHESNTV 174

Query: 164 IKVVQDGYAINERVLRPALVSISK 187
           + V+Q GY +N RV+RPA+V ++K
Sbjct: 175 MFVMQKGYELNGRVIRPAMVMVAK 198


>gi|326624447|gb|EGE30792.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Dublin str. 3246]
          Length = 253

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 94/146 (64%), Gaps = 8/146 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LR+ AEMENLRRRT+++ + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 116 RDTVLRIKAEMENLRRRTEQDIEKAHKFALEKFVNELLPVIDSLDRALEVA--DKANPD- 172

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
                + +++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+     + VPA  +
Sbjct: 173 -----MAAMVEGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESEEVPAGNV 227

Query: 164 IKVVQDGYAINERVLRPALVSISKGK 189
           + ++Q GY +N R +R A+V+++K K
Sbjct: 228 LGIMQKGYTLNGRTIRAAMVTVAKAK 253


>gi|62128886|gb|AAX66589.1| molecular chaparone; heat shock protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
          Length = 260

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 94/146 (64%), Gaps = 8/146 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LR+ AEMENLRRRT+++ + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 123 RDTVLRIKAEMENLRRRTEQDIEKAHKFALEKFVNELLPVIDSLDRALEVA--DKANPD- 179

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
                + +++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+     + VPA  +
Sbjct: 180 -----MAAMVEGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESEEVPAGNV 234

Query: 164 IKVVQDGYAINERVLRPALVSISKGK 189
           + ++Q GY +N R +R A+V+++K K
Sbjct: 235 LGIMQKGYTLNGRTIRAAMVTVAKAK 260


>gi|85059776|ref|YP_455478.1| heat shock protein GrpE [Sodalis glossinidius str. 'morsitans']
 gi|123766410|sp|Q2NS02|GRPE_SODGM RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|84780296|dbj|BAE75073.1| heat shock protein GrpE [Sodalis glossinidius str. 'morsitans']
          Length = 195

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 61/158 (38%), Positives = 100/158 (63%), Gaps = 9/158 (5%)

Query: 34  EESLNQSEEF-RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALD 92
           E +L+Q+++   D  LR  AEMEN+RRR++++ + A  +++ +FA ++L V DNL RALD
Sbjct: 46  EAALSQAQQREHDSVLRAKAEMENVRRRSEQDVEKAHKFALERFAGELLPVIDNLERALD 105

Query: 93  SAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFE 152
            +  D AN+E      L S IEGIE+T + ++  + ++G+  +      FNP +HQAM  
Sbjct: 106 MS--DKANAE------LASTIEGIELTLKSLLDAVRKFGLDVVGDTHVPFNPEVHQAMTM 157

Query: 153 EPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
              D    N ++ V+Q GY +N R++RPA+V++SK K+
Sbjct: 158 LESDEHEPNQVMMVMQKGYTLNGRLIRPAMVAVSKAKS 195


>gi|88857852|ref|ZP_01132494.1| Hsp 24 DnaK nucleotide exchange factor; probable member of the
           DnaK/DnaJ/GrpE foldase complex [Pseudoalteromonas
           tunicata D2]
 gi|88819469|gb|EAR29282.1| Hsp 24 DnaK nucleotide exchange factor; probable member of the
           DnaK/DnaJ/GrpE foldase complex [Pseudoalteromonas
           tunicata D2]
          Length = 194

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 53/145 (36%), Positives = 91/145 (62%), Gaps = 8/145 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  +R  AE++N+RRR  ++ + A  +++ KF+ ++L V DNL RA++ A         
Sbjct: 56  KDSVIRAAAEVDNVRRRAAQDIEKAHKFALEKFSNELLPVIDNLERAIEFA--------D 107

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           KS   L  L+EGI+MT +  ++ + ++GV+ ++ + + FNP  HQAM  +P   V  NT+
Sbjct: 108 KSNDALTPLLEGIDMTVKSFVTAVAKFGVEVVNPQGESFNPEYHQAMALQPSAEVEPNTV 167

Query: 164 IKVVQDGYAINERVLRPALVSISKG 188
           + V+Q GY ++ R+LRPA+V +SK 
Sbjct: 168 LAVMQKGYTLHGRLLRPAMVMVSKA 192


>gi|77917726|ref|YP_355541.1| heat shock protein nucleotide exchange factor GrpE [Pelobacter
           carbinolicus DSM 2380]
 gi|77543809|gb|ABA87371.1| heat shock protein nucleotide exchange factor GrpE [Pelobacter
           carbinolicus DSM 2380]
          Length = 198

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 56/144 (38%), Positives = 89/144 (61%), Gaps = 8/144 (5%)

Query: 45  DKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKK 104
           D YLR  AE+EN R+R  REK+D   ++     R++L+V DNL RA++ A        ++
Sbjct: 58  DLYLRERAELENFRKRMQREKEDLVRFANENLLREILTVVDNLERAIEHA--------RQ 109

Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTII 164
           ++  +K L+EG+EMT  +    LE++GV  + A  + F+P  H+AM +      P NT++
Sbjct: 110 TDETVKGLLEGVEMTLSQCQKLLEKFGVTPVVAVGEPFDPTWHEAMGQMESAEHPPNTVM 169

Query: 165 KVVQDGYAINERVLRPALVSISKG 188
           + +Q GY +N+R+LRPA+V ISK 
Sbjct: 170 QEMQKGYVLNDRLLRPAMVMISKA 193


>gi|205357376|ref|ZP_02347267.2| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|205322053|gb|EDZ09892.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
          Length = 241

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 94/146 (64%), Gaps = 8/146 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LR+ AEMENLRRRT+++ + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 104 RDTVLRIKAEMENLRRRTEQDIEKAHKFALEKFVNELLPVIDSLDRALEVA--DKANPD- 160

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
                + +++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+     + VPA  +
Sbjct: 161 -----MAAMVEGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESEEVPAGNV 215

Query: 164 IKVVQDGYAINERVLRPALVSISKGK 189
           + ++Q GY +N R +R A+V+++K K
Sbjct: 216 LGIMQKGYTLNGRTIRAAMVTVAKAK 241


>gi|121726051|ref|ZP_01679350.1| heat shock protein GrpE [Vibrio cholerae V52]
 gi|229505536|ref|ZP_04395046.1| heat shock protein GrpE [Vibrio cholerae BX 330286]
 gi|229510793|ref|ZP_04400272.1| heat shock protein GrpE [Vibrio cholerae B33]
 gi|229517914|ref|ZP_04407358.1| heat shock protein GrpE [Vibrio cholerae RC9]
 gi|229608556|ref|YP_002879204.1| heat shock protein GrpE [Vibrio cholerae MJ-1236]
 gi|121631533|gb|EAX63903.1| heat shock protein GrpE [Vibrio cholerae V52]
 gi|229344629|gb|EEO09603.1| heat shock protein GrpE [Vibrio cholerae RC9]
 gi|229350758|gb|EEO15699.1| heat shock protein GrpE [Vibrio cholerae B33]
 gi|229357759|gb|EEO22676.1| heat shock protein GrpE [Vibrio cholerae BX 330286]
 gi|229371211|gb|ACQ61634.1| heat shock protein GrpE [Vibrio cholerae MJ-1236]
          Length = 206

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 96/145 (66%), Gaps = 10/145 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+EN+RRR+++E   A+ +++++FA ++L V DNL RA+ +A  ++     
Sbjct: 71  QDSVLRARAEVENMRRRSEQEVDKARKFALSRFAEELLPVIDNLERAIQAADGEV----- 125

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                +K L+EG+E+T +  + T+ ++G+K+I+   + FNP  HQAM  +E  +  P NT
Sbjct: 126 ---EAIKPLLEGVELTHKTFVDTIAKFGLKEINPHGEVFNPEFHQAMSIQESAEHEP-NT 181

Query: 163 IIKVVQDGYAINERVLRPALVSISK 187
           ++ V+Q GY +N RVLRPA+V +SK
Sbjct: 182 VMFVMQKGYELNGRVLRPAMVMVSK 206


>gi|22126949|ref|NP_670372.1| heat shock protein GrpE [Yersinia pestis KIM 10]
 gi|108806582|ref|YP_650498.1| heat shock protein GrpE [Yersinia pestis Antiqua]
 gi|108813051|ref|YP_648818.1| heat shock protein GrpE [Yersinia pestis Nepal516]
 gi|149366893|ref|ZP_01888927.1| heat shock protein GrpE [Yersinia pestis CA88-4125]
 gi|165924334|ref|ZP_02220166.1| co-chaperone GrpE [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165938295|ref|ZP_02226853.1| co-chaperone GrpE [Yersinia pestis biovar Orientalis str. IP275]
 gi|166011530|ref|ZP_02232428.1| co-chaperone GrpE [Yersinia pestis biovar Antiqua str. E1979001]
 gi|167399986|ref|ZP_02305504.1| co-chaperone GrpE [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167419737|ref|ZP_02311490.1| co-chaperone GrpE [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167423879|ref|ZP_02315632.1| co-chaperone GrpE [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|218928275|ref|YP_002346150.1| heat shock protein GrpE [Yersinia pestis CO92]
 gi|229841043|ref|ZP_04461202.1| heat shock protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229843147|ref|ZP_04463293.1| heat shock protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229903492|ref|ZP_04518605.1| heat shock protein [Yersinia pestis Nepal516]
 gi|270487274|ref|ZP_06204348.1| co-chaperone GrpE [Yersinia pestis KIM D27]
 gi|294503115|ref|YP_003567177.1| heat shock protein GrpE [Yersinia pestis Z176003]
 gi|52782898|sp|Q7CH40|GRPE_YERPE RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|123245957|sp|Q1CAG9|GRPE_YERPA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|123373002|sp|Q1CFL2|GRPE_YERPN RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|21959990|gb|AAM86623.1|AE013908_6 heat shock protein [Yersinia pestis KIM 10]
 gi|108776699|gb|ABG19218.1| heat shock protein GrpE [Yersinia pestis Nepal516]
 gi|108778495|gb|ABG12553.1| heat shock protein GrpE [Yersinia pestis Antiqua]
 gi|115346886|emb|CAL19773.1| heat shock protein GrpE [Yersinia pestis CO92]
 gi|149291267|gb|EDM41342.1| heat shock protein GrpE [Yersinia pestis CA88-4125]
 gi|165913673|gb|EDR32292.1| co-chaperone GrpE [Yersinia pestis biovar Orientalis str. IP275]
 gi|165923394|gb|EDR40526.1| co-chaperone GrpE [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165989478|gb|EDR41779.1| co-chaperone GrpE [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166962478|gb|EDR58499.1| co-chaperone GrpE [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167050694|gb|EDR62102.1| co-chaperone GrpE [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167056728|gb|EDR66491.1| co-chaperone GrpE [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|229679262|gb|EEO75365.1| heat shock protein [Yersinia pestis Nepal516]
 gi|229689494|gb|EEO81555.1| heat shock protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229697409|gb|EEO87456.1| heat shock protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|262361151|gb|ACY57872.1| heat shock protein GrpE [Yersinia pestis D106004]
 gi|262365295|gb|ACY61852.1| heat shock protein GrpE [Yersinia pestis D182038]
 gi|270335778|gb|EFA46555.1| co-chaperone GrpE [Yersinia pestis KIM D27]
 gi|294353574|gb|ADE63915.1| heat shock protein GrpE [Yersinia pestis Z176003]
 gi|320014246|gb|ADV97817.1| heat shock protein [Yersinia pestis biovar Medievalis str. Harbin
           35]
          Length = 192

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 59/148 (39%), Positives = 96/148 (64%), Gaps = 10/148 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           R+  LR  AE+EN+RRRT+ + + A  +++ +F+ ++L V DNL RALD+A  D  N+E 
Sbjct: 54  RESLLRAKAEVENIRRRTELDVEKAHKFALERFSSELLPVIDNLERALDTA--DKTNTE- 110

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                L S+IEG+E+T + ++  + ++G++ +      FNP +HQAM   E  D  P N 
Sbjct: 111 -----LISMIEGVELTLKSLLDAVGKFGIEVVGETHVPFNPEVHQAMTMLESADHEP-NH 164

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ V+Q GY +N R+LRPA+V++SK K+
Sbjct: 165 VMMVMQKGYTLNGRLLRPAMVAVSKAKS 192


>gi|146417047|ref|XP_001484493.1| hypothetical protein PGUG_03874 [Meyerozyma guilliermondii ATCC
           6260]
 gi|146391618|gb|EDK39776.1| hypothetical protein PGUG_03874 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 236

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 59/149 (39%), Positives = 91/149 (61%), Gaps = 8/149 (5%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD--LA 99
           + ++ Y R +A+  NL+  T +E + A+ +++ KFA+D+L   DN S AL++   D   A
Sbjct: 93  DMKNHYARAVADFRNLQESTKKEVQKARDFALQKFAKDLLESLDNFSLALNAVKEDTLAA 152

Query: 100 NSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVP 159
           N+E      +K+L EG++MTR     TL ++G++KID   ++F+PNMH+A FE P     
Sbjct: 153 NNE------VKNLYEGVDMTRNVFEKTLAKHGIEKIDPMGEQFDPNMHEATFEIPQPDKE 206

Query: 160 ANTIIKVVQDGYAINERVLRPALVSISKG 188
             T+  V Q GY +N RVLRPA V + KG
Sbjct: 207 PGTVFHVQQPGYTLNARVLRPAKVGLVKG 235


>gi|297799314|ref|XP_002867541.1| hypothetical protein ARALYDRAFT_492124 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297313377|gb|EFH43800.1| hypothetical protein ARALYDRAFT_492124 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 324

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 100/159 (62%), Gaps = 9/159 (5%)

Query: 48  LRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS-----APLDLANSE 102
           LR  AEMEN+  RT R+ ++ + Y++  FA+ +L V+DNL RA        + LD +   
Sbjct: 167 LRTYAEMENVMDRTRRDAENTKKYAVQNFAKSLLDVADNLGRASSVVKESFSKLDTSEDS 226

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
             +  +LK+L+EG+EMT +++    +++G++K D  ++ F+PN H A+F+ P  + P  T
Sbjct: 227 AGAAPLLKTLLEGVEMTEKQLAEVFKKFGMEKYDPINEPFDPNRHNAVFQVPDASKPEGT 286

Query: 163 IIKVVQDGYAINERVLRPALVSISK-GKTQNPTEEKKET 200
           +  V++ GY + +RV+RPA V +++ G+ Q   EEKKE+
Sbjct: 287 VAHVLKYGYTLYDRVIRPAEVGVTQAGENQ---EEKKES 322


>gi|50549019|ref|XP_501980.1| YALI0C18513p [Yarrowia lipolytica]
 gi|49647847|emb|CAG82300.1| YALI0C18513p [Yarrowia lipolytica]
          Length = 248

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 92/150 (61%), Gaps = 1/150 (0%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           +  +F++ Y R I +  +L+  T RE K A  +++AKFA+D+L   DN  RAL   P ++
Sbjct: 99  ECAQFKEHYQRAITDFRHLQETTKREIKKAHDFALAKFAKDLLDSVDNFDRALGVVPDEI 158

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
            N  + ++ ++ +  +GI+MT+     TL ++G+KK++   + F+PNMH+A+FE P    
Sbjct: 159 KNDRENNKEIM-NFYDGIKMTQDIFEKTLGKHGMKKLEPVGEVFDPNMHEAVFEAPQPDK 217

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISKG 188
            A T+  V Q G+ +N+R+LR A V + KG
Sbjct: 218 EAGTVFFVQQTGFTLNDRILRAAKVGVVKG 247


>gi|329847445|ref|ZP_08262473.1| grpE family protein [Asticcacaulis biprosthecum C19]
 gi|328842508|gb|EGF92077.1| grpE family protein [Asticcacaulis biprosthecum C19]
          Length = 205

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 85/139 (61%), Gaps = 7/139 (5%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            +++ LR  AE EN +RR +RE  DA+++ I +FA  +L V+D L RAL S P ++A+  
Sbjct: 38  LKEQALRYAAEAENTKRRAEREANDARAFGIQRFATSLLGVADVLQRALSSVPGEVAD-- 95

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDA-KDQKFNPNMHQAMFEEPHDTVPAN 161
                  K+ ++GI MT RE+    ++ G+KKI   K  KF+P++HQA+ E+P   V   
Sbjct: 96  ----PAFKNFVDGIAMTERELAGAFDKNGIKKISPLKGDKFDPHLHQAVMEQPSTEVEGG 151

Query: 162 TIIKVVQDGYAINERVLRP 180
            ++ V+Q GY +  RV+RP
Sbjct: 152 AVLFVMQAGYELFGRVIRP 170


>gi|326628824|gb|EGE35167.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
          Length = 253

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 94/146 (64%), Gaps = 8/146 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LR+ AEMENLRRRT+++ + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 116 RDTVLRIKAEMENLRRRTEQDIEKAHKFALEKFVNELLPVIDSLDRALEVA--DKANPD- 172

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
                + +++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+     + VPA  +
Sbjct: 173 -----MAAMVEGIELTLKSMLDVVRKFGVEVIAETNVPMDPNVHQAIAMVESEEVPAGNV 227

Query: 164 IKVVQDGYAINERVLRPALVSISKGK 189
           + ++Q GY +N R +R A+V+++K K
Sbjct: 228 LGIMQKGYTLNGRTIRAAMVTVAKAK 253


>gi|262402794|ref|ZP_06079355.1| heat shock protein GrpE [Vibrio sp. RC586]
 gi|262351576|gb|EEZ00709.1| heat shock protein GrpE [Vibrio sp. RC586]
          Length = 200

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/145 (38%), Positives = 96/145 (66%), Gaps = 10/145 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+EN+RRR+++E   A+ +++++FA ++L V DNL RA+ +A  ++     
Sbjct: 65  QDNVLRARAEVENMRRRSEQEVDKARKFALSRFAEELLPVIDNLERAIQAADGEV----- 119

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                +K L+EG+E+T +  + T+ ++G+K+I+   + FNP  HQAM  +E  +  P NT
Sbjct: 120 ---EAIKPLLEGVELTHKTFVDTIAKFGLKEINPHGETFNPEFHQAMSIQESAEHEP-NT 175

Query: 163 IIKVVQDGYAINERVLRPALVSISK 187
           ++ V+Q GY +N RV+RPA+V +SK
Sbjct: 176 VMFVMQKGYELNGRVVRPAMVMVSK 200


>gi|52782984|sp|Q9L7Z3|GRPE_VIBPR RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|6746606|gb|AAF27646.1|AF218211_1 GrpE [Vibrio proteolyticus]
          Length = 204

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 64/174 (36%), Positives = 111/174 (63%), Gaps = 12/174 (6%)

Query: 18  NANSSTAEEKSEINIPEESLNQSE----EFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
           N  S+  E +++I   E +L  SE    E +D  LR  AE+EN+RRRT++E   A+ +++
Sbjct: 39  NEESALDETEAKIAQLEAALLSSEAKVKEQQDAVLRAKAEVENMRRRTEQEIDKARKFAL 98

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
            KFA ++L + DNL RA+ +A       + +SE V++ ++EGI +T +  + T+ ++G+K
Sbjct: 99  NKFAEELLPIIDNLERAIQAA-------DTESE-VVQPILEGITLTHKTFIDTISKFGLK 150

Query: 134 KIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +I+ + + FNP +HQAM  +      +NT++ V+Q GY +N RV+RPA+V ++K
Sbjct: 151 EINPEGEAFNPELHQAMSIQESADHESNTVMFVMQKGYELNGRVIRPAMVMVAK 204


>gi|261212088|ref|ZP_05926374.1| heat shock protein GrpE [Vibrio sp. RC341]
 gi|260838696|gb|EEX65347.1| heat shock protein GrpE [Vibrio sp. RC341]
          Length = 200

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/145 (38%), Positives = 96/145 (66%), Gaps = 10/145 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+EN+RRR+++E   A+ +++++FA ++L V DNL RA+ +A  ++     
Sbjct: 65  QDNVLRARAEVENMRRRSEQEVDKARKFALSRFAEELLPVIDNLERAIQAADGEV----- 119

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                +K L+EG+E+T +  + T+ ++G+K+I+   + FNP  HQAM  +E  +  P NT
Sbjct: 120 ---EAIKPLLEGVELTHKTFVDTIAKFGLKEINPHGETFNPEFHQAMSIQESAEHEP-NT 175

Query: 163 IIKVVQDGYAINERVLRPALVSISK 187
           ++ V+Q GY +N RV+RPA+V +SK
Sbjct: 176 VMFVMQKGYELNGRVVRPAMVMVSK 200


>gi|16761534|ref|NP_457151.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16765996|ref|NP_461611.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|29143005|ref|NP_806347.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56414646|ref|YP_151721.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|162139555|ref|YP_217670.2| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|168262146|ref|ZP_02684119.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|168464146|ref|ZP_02698063.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|194445818|ref|YP_002041943.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194450828|ref|YP_002046685.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194470780|ref|ZP_03076764.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194738082|ref|YP_002115691.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197265132|ref|ZP_03165206.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197301207|ref|ZP_03166326.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|197363573|ref|YP_002143210.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|204929659|ref|ZP_03220733.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|205357824|ref|ZP_03223851.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205358805|ref|ZP_03224144.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|205359391|ref|ZP_03224287.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|207858029|ref|YP_002244680.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|213052571|ref|ZP_03345449.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213418037|ref|ZP_03351114.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Typhi str. E01-6750]
 gi|213424858|ref|ZP_03357608.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213621082|ref|ZP_03373865.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
 gi|213647498|ref|ZP_03377551.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213855292|ref|ZP_03383532.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|238909524|ref|ZP_04653361.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|289824179|ref|ZP_06543774.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|52782899|sp|Q7CPZ4|GRPE_SALTY RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|52782962|sp|Q8XEY8|GRPE_SALTI RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|81360093|sp|Q5PFG9|GRPE_SALPA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737167|sp|B5QUG9|GRPE_SALEP RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737169|sp|B4TE57|GRPE_SALHS RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737170|sp|B4T2B9|GRPE_SALNS RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737171|sp|B5BE99|GRPE_SALPK RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737172|sp|B4TS61|GRPE_SALSV RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|25311546|pir||AE0834 heat shock protein GrpE (heat shock protein b25.3) (hsp24)
           [imported] - Salmonella enterica subsp. enterica serovar
           Typhi (strain CT18)
 gi|16421227|gb|AAL21570.1| molecular chaparone [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|16503835|emb|CAD05860.1| heat shock protein GrpE (heat shock protein b25.3) (hsp24)
           [Salmonella enterica subsp. enterica serovar Typhi]
 gi|29138638|gb|AAO70207.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56128903|gb|AAV78409.1| heat shock protein GrpE (heat shock protein b25.3) (hsp24)
           [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. ATCC 9150]
 gi|194404481|gb|ACF64703.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194409132|gb|ACF69351.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194457144|gb|EDX45983.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194713584|gb|ACF92805.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195633329|gb|EDX51743.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|197095050|emb|CAR60596.1| heat shock protein GrpE (heat shock protein b25.3) (hsp24)
           [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. AKU_12601]
 gi|197243387|gb|EDY26007.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197287858|gb|EDY27246.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|204321378|gb|EDZ06578.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|205329342|gb|EDZ16106.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205331832|gb|EDZ18596.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|205336475|gb|EDZ23239.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|205349156|gb|EDZ35787.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|206709832|emb|CAR34184.1| heat shock protein GrpE (heat shock protein b25.3) (hsp24)
           [Salmonella enterica subsp. enterica serovar Enteritidis
           str. P125109]
 gi|261247872|emb|CBG25702.1| heat shock protein GrpE (heat shock protein b25.3) (hsp24)
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. D23580]
 gi|267994825|gb|ACY89710.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301159241|emb|CBW18756.1| heat shock protein GrpE (heat shock protein b25.3) (hsp24)
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. SL1344]
 gi|312913704|dbj|BAJ37678.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|321223473|gb|EFX48538.1| Heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|322614471|gb|EFY11402.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322621464|gb|EFY18317.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322624325|gb|EFY21158.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322629376|gb|EFY26154.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322633616|gb|EFY30358.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322638341|gb|EFY35039.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322639779|gb|EFY36462.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322647360|gb|EFY43856.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322650471|gb|EFY46881.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322656036|gb|EFY52336.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322661430|gb|EFY57655.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322662630|gb|EFY58838.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322667003|gb|EFY63178.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322671372|gb|EFY67495.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322677621|gb|EFY73684.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322681553|gb|EFY77583.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322683953|gb|EFY79963.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|322715738|gb|EFZ07309.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
 gi|323131025|gb|ADX18455.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|323195522|gb|EFZ80700.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323197895|gb|EFZ83018.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323203073|gb|EFZ88105.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323205314|gb|EFZ90289.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323210536|gb|EFZ95420.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323218183|gb|EGA02895.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323221551|gb|EGA05964.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323223771|gb|EGA08076.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323230946|gb|EGA15064.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323234702|gb|EGA18788.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323238741|gb|EGA22791.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323241441|gb|EGA25472.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323246862|gb|EGA30829.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323253261|gb|EGA37091.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323257057|gb|EGA40766.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323260470|gb|EGA44081.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323264473|gb|EGA47979.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323269608|gb|EGA53061.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
 gi|332989605|gb|AEF08588.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 196

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 94/146 (64%), Gaps = 8/146 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LR+ AEMENLRRRT+++ + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 59  RDTVLRIKAEMENLRRRTEQDIEKAHKFALEKFVNELLPVIDSLDRALEVA--DKANPD- 115

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
                + +++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+     + VPA  +
Sbjct: 116 -----MAAMVEGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESEEVPAGNV 170

Query: 164 IKVVQDGYAINERVLRPALVSISKGK 189
           + ++Q GY +N R +R A+V+++K K
Sbjct: 171 LGIMQKGYTLNGRTIRAAMVTVAKAK 196


>gi|257482277|ref|ZP_05636318.1| heat shock protein GrpE [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|331011482|gb|EGH91538.1| heat shock protein GrpE [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 187

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 102/166 (61%), Gaps = 11/166 (6%)

Query: 25  EEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVS 84
           E  + + + EE L  ++   D+ LRV A+++N+RRR +++ + A  +++ KFA D+L + 
Sbjct: 23  ELTTRVQVLEEQLAAAQ---DQSLRVAADLQNVRRRAEQDVEKAHKFALEKFAGDLLPII 79

Query: 85  DNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNP 144
           D+L R LD     L+N E +S   ++ + EGIE+T +    TL+RY ++ ID   Q F+ 
Sbjct: 80  DSLERGLD-----LSNPEDES---IRPMREGIELTLKMFQDTLKRYQLEAIDPHGQPFSA 131

Query: 145 NMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           + HQAM  +    V  NT++KV Q GY +N R+LRPA+V +SK  +
Sbjct: 132 DQHQAMAMQESADVEPNTVLKVFQKGYQLNGRLLRPAMVVVSKAPS 177


>gi|224367523|ref|YP_002601686.1| GrpE [Desulfobacterium autotrophicum HRM2]
 gi|223690239|gb|ACN13522.1| GrpE [Desulfobacterium autotrophicum HRM2]
          Length = 200

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 107/176 (60%), Gaps = 11/176 (6%)

Query: 22  STAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDML 81
           S  +EKSEI   EE  +Q    +DK LR+ AE EN ++R+ +E  + + ++     +  L
Sbjct: 36  SCKQEKSEI---EECQDQLTAEKDKVLRLSAEFENYKKRSSKELSEFRKFANETLLKQFL 92

Query: 82  SVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQK 141
           SV DN+ RA+D+A        KK+ +  K+L+EGIE+T +EM   L  + V  ++A+ + 
Sbjct: 93  SVVDNMERAIDAA--------KKNGNDGKALLEGIELTYKEMQRILTAFNVVPVEAQGKD 144

Query: 142 FNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEK 197
           F+P  HQA+ ++     P NT++  +Q GY  ++R++RP++V +SK  T+N TE+K
Sbjct: 145 FDPVFHQAVTQQESVDHPENTVVAELQKGYLFHDRLIRPSMVVVSKAMTENETEKK 200


>gi|294679010|ref|YP_003579625.1| GrpE protein [Rhodobacter capsulatus SB 1003]
 gi|294477830|gb|ADE87218.1| GrpE protein [Rhodobacter capsulatus SB 1003]
          Length = 182

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 99/147 (67%), Gaps = 8/147 (5%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           +E RD+++R +A+ EN R+R DR++++A+ Y  +K +RDML V D L RALD+     A 
Sbjct: 38  DELRDRFMRALADAENARKRADRDRREAEQYGGSKLSRDMLPVFDALKRALDA-----AG 92

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVP 159
            E ++ +   +LIEG+E+T+RE+++   R+G+  I  K   KF+P +H+AMFE P     
Sbjct: 93  EEVRAAA--PALIEGVELTQRELLNVFARHGIVAIQPKVGDKFDPLLHEAMFEAPLPGTV 150

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
           A  II+V+ DG+ +++R+LRPA V +S
Sbjct: 151 AGDIIQVMDDGFLLHDRLLRPAKVGVS 177


>gi|332290356|ref|YP_004421208.1| heat shock protein GrpE [Gallibacterium anatis UMN179]
 gi|330433252|gb|AEC18311.1| heat shock protein GrpE [Gallibacterium anatis UMN179]
          Length = 196

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/143 (37%), Positives = 96/143 (67%), Gaps = 7/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE++N+RRRT+ + + A  + + KFA+++L+V DNL RA  + P     +  
Sbjct: 60  QDIMLRARAEIDNIRRRTEADVEKAHKFGLEKFAKEILNVIDNLERAA-ATP-----NTS 113

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           + ESV K+L +G+E+T ++++ST+ ++G++ +    + FNP++HQA+  +P +   AN I
Sbjct: 114 EDESV-KALFDGVELTLKDLLSTVAKFGIEPVGVVGETFNPDLHQAISMQPTEGFSANQI 172

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY +N RV+RPA+V ++
Sbjct: 173 TTVLQKGYLLNGRVIRPAMVMVA 195


>gi|320585997|gb|EFW98676.1| mitochondrial co-chaperone [Grosmannia clavigera kw1407]
          Length = 280

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 92/161 (57%), Gaps = 17/161 (10%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAP---LDL 98
           +++DKYLR +A+  NL+ RT RE K A+ ++I +FA+D++   DNL RAL   P   L  
Sbjct: 116 DWKDKYLRAVADFRNLQERTQREMKAARDFAITQFAKDLVDSVDNLDRALTIVPAEKLAA 175

Query: 99  ANSEKKSESV--------------LKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNP 144
           A  E   E+               L +L++G++MT   ++ TL+++G+++ D   +KFNP
Sbjct: 176 AEGETAGETAASPEAEVALAVRRDLANLVDGLKMTETVLLQTLKKHGLERFDPVGEKFNP 235

Query: 145 NMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
           N H+A F  P+     NT+    Q G+ +N RVLR A V +
Sbjct: 236 NEHEATFMTPNKDHDHNTVFHTQQKGFRLNGRVLRAAKVGV 276


>gi|238793786|ref|ZP_04637407.1| hypothetical protein yinte0001_6880 [Yersinia intermedia ATCC
           29909]
 gi|238726850|gb|EEQ18383.1| hypothetical protein yinte0001_6880 [Yersinia intermedia ATCC
           29909]
          Length = 192

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 96/147 (65%), Gaps = 10/147 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           R+  LR  AE+EN+RRRT+ + + A  +++ +F+ ++L V DNL RALD+A  D  N+E 
Sbjct: 54  RESLLRAKAEVENIRRRTELDVEKAHKFALERFSSELLPVIDNLERALDTA--DKTNAE- 110

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                L S+IEG+E+T + ++  + ++G++ +      FNP++HQAM   E  D  P N 
Sbjct: 111 -----LTSMIEGVELTLKSLLDAVGKFGIEVVADTHVPFNPDVHQAMTMLESADHEP-NH 164

Query: 163 IIKVVQDGYAINERVLRPALVSISKGK 189
           ++ V+Q GY +N R+LRPA+V++SK K
Sbjct: 165 VMMVMQKGYTLNGRLLRPAMVAVSKAK 191


>gi|320353049|ref|YP_004194388.1| GrpE protein [Desulfobulbus propionicus DSM 2032]
 gi|320121551|gb|ADW17097.1| GrpE protein [Desulfobulbus propionicus DSM 2032]
          Length = 196

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 92/150 (61%), Gaps = 4/150 (2%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           Q +E RD+ +R+ AE EN ++R +RE+     Y+     RD+L+  DNL RA++    + 
Sbjct: 46  QLDESRDQLMRIAAEFENYKKRMERERGKLLKYAGENILRDLLTTLDNLDRAVEQGNAEA 105

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
            +  KK    L+++++GIE+TR+ +++T+ERYGV+ + A    FNP+ H A+  E  D V
Sbjct: 106 EDDSKK----LEAMLQGIELTRKGLVATMERYGVEPLAAIGLSFNPDEHDALTMEASDEV 161

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISKG 188
           PAN +++    GY   +RVLR A V +S G
Sbjct: 162 PANHVLREFAKGYRFKDRVLRHAQVVVSSG 191


>gi|156536983|ref|XP_001608280.1| PREDICTED: similar to conserved hypothetical protein [Nasonia
           vitripennis]
          Length = 231

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 61/166 (36%), Positives = 103/166 (62%), Gaps = 7/166 (4%)

Query: 27  KSEINIPEESLNQSEE----FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLS 82
           KSEI +  + L + +E      DKY R +A+ ENLR R  ++ +DA+ + I  F +D+L 
Sbjct: 69  KSEIELLNKDLTELKEKYSQLDDKYKRALADSENLRVRLMKQIEDAKLFGIQGFCKDLLD 128

Query: 83  VSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKF 142
           V+D L +A +S P D   SE+     LKSL EG+ MT  ++    +++G+  ++  D+KF
Sbjct: 129 VADILGKATESVPKD-EISERNPH--LKSLYEGLIMTEAQLHKVFKKHGLISLNPLDEKF 185

Query: 143 NPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           +PN H+A+F++  +     T++ V + GY ++ER++RPALV ++KG
Sbjct: 186 DPNQHEALFQQEVEGKKPGTVVVVSKVGYKLHERIVRPALVGVAKG 231


>gi|37527246|ref|NP_930590.1| GrpE protein [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|52782904|sp|Q7N1U7|GRPE_PHOLL RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|36786680|emb|CAE15746.1| GrpE protein (HSP-70 cofactor) (heat shock protein B25.3) (HSP24)
           [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 193

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 98/155 (63%), Gaps = 9/155 (5%)

Query: 34  EESLNQSEEF-RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALD 92
           EE L Q+++  RD  LR  AE+EN+RRRT+++ + A  +++ +FA ++L V DNL RAL+
Sbjct: 47  EEQLKQAQQRERDAILRAKAEVENIRRRTEQDVEKAHKFALERFANELLPVIDNLERALE 106

Query: 93  SAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFE 152
            A  D  N+E      +  ++EGIE+T +  +  + ++G++ +   +  FNP +HQAM  
Sbjct: 107 VA--DRTNTE------IAPMVEGIELTLKSFLGAVGKFGIEVVGDTNVPFNPEIHQAMTM 158

Query: 153 EPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
              D    N ++ V+Q GY +N R+LRPA+V++SK
Sbjct: 159 MESDQHEPNHVMMVMQKGYTLNGRLLRPAMVAVSK 193


>gi|145345933|ref|XP_001417453.1| mitochondrial GrpE-like protein [Ostreococcus lucimarinus CCE9901]
 gi|144577680|gb|ABO95746.1| mitochondrial GrpE-like protein [Ostreococcus lucimarinus CCE9901]
          Length = 240

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/145 (38%), Positives = 92/145 (63%), Gaps = 4/145 (2%)

Query: 45  DKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPL-DLANSEK 103
           D+ LR +AEMENLR RT R+ +DA+ ++I  F +D+L V+DNL RA+ +  + D  N  +
Sbjct: 94  DRILRTMAEMENLRERTRRQAEDAKKFAIQGFCKDLLDVADNLDRAIATVTVDDDENDVE 153

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEP---HDTVPA 160
           K ++ LKS  EG+ MT + ++S  +++GV K + + ++F+ N H A+F  P        A
Sbjct: 154 KVKTKLKSFHEGVVMTEKTLLSAFKKHGVTKFNPEGEEFDANSHMALFNVPIPEGSDAKA 213

Query: 161 NTIIKVVQDGYAINERVLRPALVSI 185
            T+  V + GY+++ERV+R A V +
Sbjct: 214 GTVAAVTKTGYSLHERVIRAAEVGV 238


>gi|205353718|ref|YP_002227519.1| heat shock protein GrpE [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|226737168|sp|B5RD90|GRPE_SALG2 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|205273499|emb|CAR38476.1| heat shock protein GrpE (heat shock protein b25.3) (hsp24)
           [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 287/91]
          Length = 196

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 94/146 (64%), Gaps = 8/146 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LR+ AEMENLRRRT+++ + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 59  RDTVLRIKAEMENLRRRTEQDIEKAHKFALEKFVNELLPVIDSLDRALEVA--DKANPD- 115

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
                + +++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+     + VPA  +
Sbjct: 116 -----MAAMVEGIELTLKSMLDVVRKFGVEVIAETNVPMDPNVHQAIAMVESEEVPAGNV 170

Query: 164 IKVVQDGYAINERVLRPALVSISKGK 189
           + ++Q GY +N R +R A+V+++K K
Sbjct: 171 LGIMQKGYTLNGRTIRAAMVTVAKAK 196


>gi|260366307|ref|ZP_05778763.1| co-chaperone GrpE [Vibrio parahaemolyticus K5030]
 gi|308112720|gb|EFO50260.1| co-chaperone GrpE [Vibrio parahaemolyticus K5030]
          Length = 175

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/144 (39%), Positives = 94/144 (65%), Gaps = 8/144 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+EN+RRRT++E   A+ Y++ KFA ++L V DNL RA+ +A  D  N   
Sbjct: 40  QDAVLRAKAEVENMRRRTEQEIDKARKYALNKFAEELLPVIDNLERAIQAA--DTENE-- 95

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
               V+K ++EG+E+T +  +  + ++G+K+I+ + + FNP  HQAM  +      +NT+
Sbjct: 96  ----VIKPILEGVELTHKTFVDVVAKFGLKEINPEGETFNPEFHQAMSIQESPDHESNTV 151

Query: 164 IKVVQDGYAINERVLRPALVSISK 187
           + V+Q GY +N RV+RPA+V ++K
Sbjct: 152 MFVMQKGYELNGRVIRPAMVMVAK 175


>gi|161502222|ref|YP_001569334.1| heat shock protein GrpE [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|160863569|gb|ABX20192.1| hypothetical protein SARI_00246 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 254

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/146 (36%), Positives = 94/146 (64%), Gaps = 8/146 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LR+ AEMENLRRRT+++ + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 116 RDTVLRIKAEMENLRRRTEQDIEKAHKFALEKFVNELLPVIDSLDRALEVA--DKANPD- 172

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
                + +++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+     + +PA  +
Sbjct: 173 -----MAAMVEGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESEEIPAGNV 227

Query: 164 IKVVQDGYAINERVLRPALVSISKGK 189
           + ++Q GY +N R +R A+V+++K K
Sbjct: 228 LGIMQKGYTLNGRTIRAAMVTVAKAK 253


>gi|325981942|ref|YP_004294344.1| GrpE protein [Nitrosomonas sp. AL212]
 gi|325531461|gb|ADZ26182.1| GrpE protein [Nitrosomonas sp. AL212]
          Length = 197

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/152 (35%), Positives = 96/152 (63%), Gaps = 12/152 (7%)

Query: 38  NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD 97
           N++ E +D ++R  AE EN+R+R+  +  +A  Y+I  F+ ++L+V D+L  AL      
Sbjct: 56  NKAAEHQDAWMRAKAETENIRKRSQNDIANAHKYAIENFSTELLTVMDSLEAAL------ 109

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
                    + ++S   G+E+T++++MS  +++ +K ID   +KF+P+ HQAM     + 
Sbjct: 110 -----AVENASVESFKNGVELTQKQLMSVFDKFNIKVIDPAGEKFDPHQHQAMCIVESEL 164

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISKGK 189
            P NTI++V+Q GY ++ER++RPALVS+SK +
Sbjct: 165 TP-NTIVQVMQKGYKLHERIIRPALVSVSKAQ 195


>gi|326428454|gb|EGD74024.1| hypothetical protein PTSG_05721 [Salpingoeca sp. ATCC 50818]
          Length = 263

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 91/148 (61%), Gaps = 3/148 (2%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           ++++ ++KYLR +AEMEN+R R   + +DA+ Y I KFA+DML ++D L  ALD+ P D 
Sbjct: 114 EAKDLKEKYLRALAEMENVRERARHQVEDAKHYGIQKFAKDMLEIADVLQLALDNVPQD- 172

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFE-EPHDT 157
              E      L+ L +G++ T + + +  ER+ +  ++   +KF+PN H A+FE  P D 
Sbjct: 173 -AKEHGDAQALRDLNDGLQTTNKLLHNIFERHQLHLLNPVGEKFDPNHHDALFEVPPSDD 231

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSI 185
             + T+  V + GY++N R +RPA V +
Sbjct: 232 ATSGTVAVVTKAGYSLNGRTIRPAQVGV 259


>gi|307294014|ref|ZP_07573858.1| GrpE protein [Sphingobium chlorophenolicum L-1]
 gi|306880165|gb|EFN11382.1| GrpE protein [Sphingobium chlorophenolicum L-1]
          Length = 184

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 92/150 (61%), Gaps = 5/150 (3%)

Query: 38  NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD 97
           N+    R   L   AE +N+RRR ++E  DA++Y+   FARDMLSV+DNL RAL + P D
Sbjct: 37  NELATARQDVLYAHAETQNVRRRLEKELADARAYAATAFARDMLSVADNLGRALQAIPAD 96

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
           L   EK      K L+ G+E T RE+ +   R G++K+ +  Q  +PN HQAM E P D 
Sbjct: 97  LREDEK-----FKGLVAGLEATGRELEAVFGRNGIEKLVSVGQPLDPNKHQAMMEVPSDE 151

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISK 187
               T++  +Q GY I +R+LRPALVS++K
Sbjct: 152 AEPGTVLVEMQAGYTIKDRLLRPALVSVAK 181


>gi|294139889|ref|YP_003555867.1| heat shock protein GrpE [Shewanella violacea DSS12]
 gi|293326358|dbj|BAJ01089.1| heat shock protein GrpE [Shewanella violacea DSS12]
          Length = 209

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 53/144 (36%), Positives = 93/144 (64%), Gaps = 8/144 (5%)

Query: 45  DKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKK 104
           D   R  A   N+RRR  ++ + A+ +++ KFA ++L V DN+ RALD        ++ +
Sbjct: 66  DSVTRAAASEANIRRRAAQDVEKARKFALEKFANELLPVIDNMERALD-------GTDAE 118

Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTII 164
           +E   K + EG+E+T +  +ST++++G+K ++ + + FNP  HQA+  +P    PANT++
Sbjct: 119 AEET-KVIYEGVELTLKSFISTVDKFGLKIVNPQGETFNPEHHQAIGMQPSPDFPANTVM 177

Query: 165 KVVQDGYAINERVLRPALVSISKG 188
            V+Q GY +N+R+LRPA+V +S+G
Sbjct: 178 MVMQKGYILNDRLLRPAMVMVSQG 201


>gi|86145632|ref|ZP_01063962.1| GrpE [Vibrio sp. MED222]
 gi|218708670|ref|YP_002416291.1| hypothetical protein VS_0649 [Vibrio splendidus LGP32]
 gi|254799623|sp|B7VJW7|GRPE_VIBSL RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|85836603|gb|EAQ54729.1| GrpE [Vibrio sp. MED222]
 gi|218321689|emb|CAV17643.1| Protein grpE (HSP-70 cofactor) [Vibrio splendidus LGP32]
          Length = 193

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 106/170 (62%), Gaps = 12/170 (7%)

Query: 22  STAEEKSEINIPEESLNQSE----EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFA 77
           S  E++++I   E +L  SE    E +D  LR  AE+EN+RRR+++E   A+ +++ KFA
Sbjct: 32  SVDEQEAKIAQLEAALLSSESKVKEQQDSVLRAKAEVENMRRRSEQEIDKARKFALNKFA 91

Query: 78  RDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDA 137
             +L V DNL RA+ +A  D  N       V+K L EG+E+T +  + T+ ++G+K+I+ 
Sbjct: 92  EGLLPVIDNLERAMQAA--DAENE------VVKPLFEGVELTHKTFVDTVAKFGLKEINP 143

Query: 138 KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           + + FNP  HQAM  +      +NT++ V+Q GY +N RV+RPA+V ++K
Sbjct: 144 EGEVFNPEFHQAMSIQESPDHESNTVMFVMQKGYELNGRVVRPAMVMVAK 193


>gi|226328155|ref|ZP_03803673.1| hypothetical protein PROPEN_02046 [Proteus penneri ATCC 35198]
 gi|225203859|gb|EEG86213.1| hypothetical protein PROPEN_02046 [Proteus penneri ATCC 35198]
          Length = 205

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 64/174 (36%), Positives = 111/174 (63%), Gaps = 15/174 (8%)

Query: 18  NANSSTAEEKSEINIPEESLNQSEEF-RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKF 76
           NA +   E  + I+  E+ L QS++  R+   R +AE+EN+RRRT ++ + A  +++ KF
Sbjct: 43  NAQAELVEALARIDSLEKQLEQSQKTEREAMARALAEVENVRRRTQQDIEKAHKFALEKF 102

Query: 77  ARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID 136
           + ++L V DNL RAL +A       + ++ES LK +IEG+E+T +  +  + ++G++ ++
Sbjct: 103 SNELLPVLDNLERALSAA-------DHENES-LKPMIEGLELTLKSFLDAVRKFGIEVVE 154

Query: 137 AKDQKFNPNMHQAM--FEEP-HDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            K+  FNP +HQAM   + P H++   N ++ V+Q GY +N R+LRPA+V +SK
Sbjct: 155 EKNVAFNPEVHQAMTLIDSPEHES---NHVVDVMQKGYTLNGRLLRPAMVIVSK 205


>gi|242240620|ref|YP_002988801.1| heat shock protein GrpE [Dickeya dadantii Ech703]
 gi|242132677|gb|ACS86979.1| GrpE protein [Dickeya dadantii Ech703]
          Length = 195

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 93/147 (63%), Gaps = 10/147 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           R+  LRV AEMEN+RRR++ + + A  +++ KFA +ML V DNL RAL+ A         
Sbjct: 57  RETVLRVRAEMENVRRRSELDVEKAHKFALEKFAGEMLPVIDNLERALEMA--------D 108

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
           KS     S IEG+E+T + M+S + ++G++ +   +  FNP +HQAM   E  +  P N 
Sbjct: 109 KSSEAQASTIEGVELTLKSMLSAVRKFGIEVVADVNVPFNPEVHQAMTMMESAEHQP-NH 167

Query: 163 IIKVVQDGYAINERVLRPALVSISKGK 189
           ++ V+Q GY +N R+LRPA+V++SK K
Sbjct: 168 VMLVMQKGYTLNGRLLRPAMVAVSKAK 194


>gi|326793877|ref|YP_004311697.1| protein grpE [Marinomonas mediterranea MMB-1]
 gi|326544641|gb|ADZ89861.1| Protein grpE [Marinomonas mediterranea MMB-1]
          Length = 189

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 96/147 (65%), Gaps = 9/147 (6%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           ++++  LR  A+ +N+RRR + + + A  +++ KFA+D++ V+DNL RAL S       +
Sbjct: 51  QYKEAALRAQADAQNIRRRAELDVEKAHKFALEKFAKDIVKVADNLERALTS-------T 103

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
           E+ S++   S+ EG+E+T ++++ TL R+ + ++D   + FNP +HQAM   P+  +  N
Sbjct: 104 EQTSDA--DSVREGVELTLKDLIETLARFDIAQVDPHGEPFNPELHQAMTMVPNPEMEPN 161

Query: 162 TIIKVVQDGYAINERVLRPALVSISKG 188
           T++ VVQ GY +N R++RPA+V +S  
Sbjct: 162 TVMDVVQKGYTLNGRLMRPAMVVVSSA 188


>gi|84387683|ref|ZP_00990700.1| GrpE [Vibrio splendidus 12B01]
 gi|84377528|gb|EAP94394.1| GrpE [Vibrio splendidus 12B01]
          Length = 221

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 107/167 (64%), Gaps = 12/167 (7%)

Query: 25  EEKSEINIPEESLNQSE----EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDM 80
           E++S+I   E +L  SE    E +D  LR  AE+EN+RRRT++E   A+ Y++ KFA  +
Sbjct: 63  EQESKIAQLEAALLSSESKVKEQQDSVLRAKAEVENMRRRTEQEVDKARKYALNKFAEGL 122

Query: 81  LSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQ 140
           L V DNL RA+ +A       + ++E+V K ++EG+E+T +  + T+ ++G+ +I+ + +
Sbjct: 123 LPVIDNLERAVQAA-------DAENEAV-KPILEGVELTHKTFVDTVAKFGLTEINPEGE 174

Query: 141 KFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            FNP  HQAM  +      +NT++ V+Q GY +N RV+RPA+V ++K
Sbjct: 175 AFNPEFHQAMSIQESPDHESNTVMFVMQKGYELNGRVIRPAMVMVAK 221


>gi|221133014|ref|XP_002166866.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
          Length = 218

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 51/146 (34%), Positives = 96/146 (65%), Gaps = 4/146 (2%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           EF+DKY+R +AE EN+RRR  +   DA+ +++  F++D+L V+D L +A+ S P+D    
Sbjct: 77  EFKDKYIRSLAECENVRRRGVKMVSDAKLFAVQGFSKDLLEVADILEKAMLSVPID---- 132

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
           E +   +LK+L +G+ MT   +     ++G++K++  ++KF+PN H+A+F++      + 
Sbjct: 133 ELQKNELLKNLYDGLVMTEAHLQKVFLKHGLQKVNPINEKFDPNFHEALFQKSIPGKASG 192

Query: 162 TIIKVVQDGYAINERVLRPALVSISK 187
           T+++V + GY +N R +R ALV +++
Sbjct: 193 TVVEVNKPGYLLNGRPVRAALVGVAQ 218


>gi|197334733|ref|YP_002156827.1| co-chaperone GrpE [Vibrio fischeri MJ11]
 gi|226737236|sp|B5FA13|GRPE_VIBFM RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|197316223|gb|ACH65670.1| co-chaperone GrpE [Vibrio fischeri MJ11]
          Length = 194

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 63/171 (36%), Positives = 107/171 (62%), Gaps = 14/171 (8%)

Query: 23  TAEEKSEINIPE------ESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKF 76
           +AE+  E  I E       S  Q +E +D  LR  AE +N+RRR + +   A+ Y++ KF
Sbjct: 32  SAEDSQEAKIAELEAALLASQAQIKEQQDTVLRAKAEEQNVRRRAEEDVDKARKYALKKF 91

Query: 77  ARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID 136
           A ++L V DNL RAL+       N +K++E+  K+L+EG+E+T +  +ST+E++G+  I+
Sbjct: 92  AGELLPVLDNLERALE-------NGDKENEAA-KALLEGVELTLQTFVSTVEKFGLTVIN 143

Query: 137 AKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
              + FNP +HQA+  +      +NT++ V+Q GY +N++VLRPA+V +++
Sbjct: 144 PMGEAFNPELHQAIGMQASPDHESNTVMIVMQKGYTLNDQVLRPAMVMVAQ 194


>gi|269962376|ref|ZP_06176726.1| heat shock protein GrpE [Vibrio harveyi 1DA3]
 gi|269832872|gb|EEZ86981.1| heat shock protein GrpE [Vibrio harveyi 1DA3]
          Length = 198

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 93/144 (64%), Gaps = 8/144 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+EN+RRRT++E   A+ Y++ KFA ++L V DNL RA+ +A  +      
Sbjct: 63  QDAVLRSKAEVENMRRRTEQEIDKARKYALNKFAEELLPVIDNLERAIQAADAE------ 116

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
               V+K ++EG+E+T +  +  + ++G+K+I+ + + FNP  HQAM  +      +NT+
Sbjct: 117 --HEVVKPILEGVELTHKTFVDAVSKFGLKEINPEGEAFNPEFHQAMSIQESPDHESNTV 174

Query: 164 IKVVQDGYAINERVLRPALVSISK 187
           + V+Q GY +N RV+RPA+V ++K
Sbjct: 175 MFVMQKGYELNGRVIRPAMVMVAK 198


>gi|189199616|ref|XP_001936145.1| mitochondrial co-chaperone GrpE [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187983244|gb|EDU48732.1| mitochondrial co-chaperone GrpE [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 229

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 63/166 (37%), Positives = 101/166 (60%), Gaps = 9/166 (5%)

Query: 28  SEINIPEESLNQSE----EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSV 83
           SE+   +E+L + +    + +DKYLR +AE  NL+ RT RE K A+ ++I +FARD++  
Sbjct: 65  SEVTQLKEALEKKDKEVIDLKDKYLRSVAEFRNLQERTQREIKAAKDFAIQRFARDLVES 124

Query: 84  SDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQ--K 141
            DNL RAL +   D   S+      L +L +GI+MT   +++TL+++G+++ D  +Q  K
Sbjct: 125 VDNLDRALGTVSEDKLKSDNTD---LIALHDGIKMTDSILINTLKKHGLERFDPSEQAEK 181

Query: 142 FNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           F+PN+H+A+F+ P       T     Q G+ +N RVLRPA V + K
Sbjct: 182 FDPNVHEAVFQAPQPDKEDGTCFHTQQKGFRLNGRVLRPAKVGVVK 227


>gi|322514241|ref|ZP_08067302.1| chaperone GrpE [Actinobacillus ureae ATCC 25976]
 gi|322119853|gb|EFX91867.1| chaperone GrpE [Actinobacillus ureae ATCC 25976]
          Length = 198

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 99/143 (69%), Gaps = 6/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE++N+RRR +++ + A  +++ KF++++L+V DNL R L++  LD A +++
Sbjct: 61  KDIQLRAQAEIQNVRRRAEQDMEKAHKFALEKFSKELLTVVDNLERGLNA--LDTAVTDE 118

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           K+    ++L++G+EMT +E +STL ++GV+ +    + FNP +HQA+  +P + + AN I
Sbjct: 119 KT----QALVDGVEMTHKEFISTLAKFGVEAVGVVGEVFNPELHQAISMQPAEGIEANHI 174

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY +  RVLRPA+V ++
Sbjct: 175 SVVLQKGYTLQGRVLRPAMVMVA 197


>gi|59712603|ref|YP_205379.1| heat shock protein [Vibrio fischeri ES114]
 gi|75506949|sp|Q5E3A5|GRPE_VIBF1 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|59480704|gb|AAW86491.1| heat shock protein [Vibrio fischeri ES114]
          Length = 194

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 63/171 (36%), Positives = 107/171 (62%), Gaps = 14/171 (8%)

Query: 23  TAEEKSEINIPE------ESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKF 76
           +AE+  E  I E       S  Q +E +D  LR  AE +N+RRR + +   A+ Y++ KF
Sbjct: 32  SAEDSQEAKIAELEAALLASQAQVKEQQDTVLRAKAEEQNVRRRAEEDVDKARKYALKKF 91

Query: 77  ARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID 136
           A ++L V DNL RAL+S        +K++E+  K+L+EG+E+T +  +ST+E++G+  I+
Sbjct: 92  AGELLPVLDNLERALES-------GDKENEAA-KALLEGVELTLQTFVSTVEKFGLTVIN 143

Query: 137 AKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
              + FNP +HQA+  +      +NT++ V+Q GY +N++VLRPA+V +++
Sbjct: 144 PMGEAFNPELHQAIGMQASPDHESNTVMIVMQKGYTLNDQVLRPAMVMVAQ 194


>gi|52782871|sp|Q6IT00|GRPE_VIBHA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|47933948|gb|AAT39534.1| GrpE [Vibrio harveyi]
          Length = 198

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 93/144 (64%), Gaps = 8/144 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+EN+RRRT++E   A+ Y++ KFA ++L V DNL RA+ +A  +      
Sbjct: 63  QDAVLRSKAEVENMRRRTEQEIDKARKYALNKFAEELLPVIDNLERAIQAADAE------ 116

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
               V+K ++EG+E+T +  +  + ++G+K+I+ + + FNP  HQAM  +      +NT+
Sbjct: 117 --HEVVKPILEGVELTHKTFVDAVSKFGLKEINPEGEAFNPEFHQAMSIQESPDHESNTV 174

Query: 164 IKVVQDGYAINERVLRPALVSISK 187
           + V+Q GY +N RV+RPA+V ++K
Sbjct: 175 MFVMQKGYELNGRVVRPAMVMVAK 198


>gi|91093058|ref|XP_967697.1| PREDICTED: similar to GrpE-like 1, mitochondrial [Tribolium
           castaneum]
 gi|270002666|gb|EEZ99113.1| hypothetical protein TcasGA2_TC005006 [Tribolium castaneum]
          Length = 222

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 54/146 (36%), Positives = 95/146 (65%), Gaps = 3/146 (2%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E  DKY R +A+ ENLR R  ++  +A+ + I  F +D+L V+D L +A ++ P +   S
Sbjct: 80  ELLDKYKRALADGENLRNRLTKQISEAKLFGIQGFCKDLLDVADVLGKATETVPKE-EIS 138

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
           +K     LKSL EG+ MT  ++ S  +R+G++ ++  ++KFNPN H+A+F++  +   + 
Sbjct: 139 DKNPH--LKSLYEGLVMTEAQLQSVFKRHGLECVNPLNEKFNPNYHEALFQQEVEGKESG 196

Query: 162 TIIKVVQDGYAINERVLRPALVSISK 187
           T++ V + GY +++RV+RPALV ++K
Sbjct: 197 TVVVVSKIGYKLHDRVIRPALVGVAK 222


>gi|311695973|gb|ADP98846.1| GrpE nucleotide exchange factor [marine bacterium HP15]
          Length = 199

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 98/151 (64%), Gaps = 5/151 (3%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           Q +EF+++ LR +AEM+N+RRR + + + A  +++ KF +++L V+D+L +A++S     
Sbjct: 45  QVQEFQEQMLRSLAEMQNVRRRAEIDVEKAHKFALEKFVKELLPVADSLEKAVEST---- 100

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
                +S  ++ S+ EG+EMT    MS+L+++ V++I+   + F+P  H+AM   P    
Sbjct: 101 -EGHDESGELVASIREGVEMTLSLFMSSLKKFNVEQINPVGEPFDPQHHEAMSMVPAPDA 159

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISKGK 189
             N+++ VVQ GY +N RV+RPA+V ++K +
Sbjct: 160 EPNSVVAVVQKGYLLNGRVVRPAMVVVAKAE 190


>gi|30249898|ref|NP_841968.1| GrpE protein, molecular chaperone [Nitrosomonas europaea ATCC
           19718]
 gi|6226626|sp|O08384|GRPE_NITEU RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|3777486|dbj|BAA33934.1| GrpE [Nitrosomonas europaea]
 gi|30180935|emb|CAD85861.1| GrpE protein, molecular chaperone [Nitrosomonas europaea ATCC
           19718]
          Length = 195

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 57/160 (35%), Positives = 97/160 (60%), Gaps = 16/160 (10%)

Query: 34  EESLNQSE----EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSR 89
           E+ L ++E    E  D +LR  AE EN+R+R   +   A  Y+I  F+  +L+V D+L  
Sbjct: 46  EQQLKEAEIRAAEHHDAWLRAKAETENIRKRAQTDIASAHKYAIDNFSVQLLAVMDSLDA 105

Query: 90  ALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQA 149
           AL +             S L++L +G+E+TR+++ +  E++ +  ID + +KF+P+ H+A
Sbjct: 106 ALAT-----------ENSTLENLRDGVELTRKQLAAVFEKFNIHTIDPQGEKFDPHQHEA 154

Query: 150 MFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
           M     D  P NT+I+V+Q GY +++RV+RPA+V++SK K
Sbjct: 155 MCAVESDFAP-NTVIQVMQKGYMLHDRVIRPAMVTVSKAK 193


>gi|251772541|gb|EES53107.1| putative GrpE protein [Leptospirillum ferrodiazotrophum]
          Length = 187

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 107/179 (59%), Gaps = 20/179 (11%)

Query: 15  NPSNANSSTA-EEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
           +P  A+S  A EEKS    PE+       ++DKY+R++A+ +N R+RT R+ +D + Y+ 
Sbjct: 25  SPDGASSEAAPEEKS----PEDV------WKDKYVRLLADFDNHRKRTVRDLEDGRRYAN 74

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSE--SVLKSLIEGIEMTRREMMSTLERYG 131
               RD L V DNL RAL       A+++  SE     + L EG+ +T ++ +  LE+ G
Sbjct: 75  EALLRDFLPVLDNLERAL-------AHAKDGSELGPACQGLFEGLRLTAKQFLEMLEKNG 127

Query: 132 VKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           V +I ++ Q F+P++H+A+      T P  T+++V Q GY +  R++RPA+V++S+G +
Sbjct: 128 VTRIPSEGQPFDPSVHEAVGYAESTTHPEGTVVEVYQQGYRLQNRLVRPAMVTVSRGSS 186


>gi|28871640|ref|NP_794259.1| heat shock protein GrpE [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|52782933|sp|Q87WN9|GRPE_PSESM RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|28854892|gb|AAO57954.1| heat shock protein GrpE [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|330963959|gb|EGH64219.1| heat shock protein GrpE [Pseudomonas syringae pv. actinidiae str.
           M302091]
          Length = 187

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 61/166 (36%), Positives = 102/166 (61%), Gaps = 11/166 (6%)

Query: 25  EEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVS 84
           E  + + + EE L  ++   D+ LRV A+++N+RRR +++ + A  +++ KFA D+L + 
Sbjct: 23  ELTTRVQVLEEQLAAAQ---DQSLRVAADLQNVRRRAEQDVEKAHKFALEKFAGDLLPII 79

Query: 85  DNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNP 144
           D+L R LD     L+N + +S   ++ + EGIE+T +    TL+RY ++ ID   Q F+ 
Sbjct: 80  DSLERGLD-----LSNPDDES---IRPMREGIELTLKMFQDTLKRYQLEAIDPHGQPFSA 131

Query: 145 NMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           + HQAM  +    V  NT++KV Q GY +N R+LRPA+V +SK  +
Sbjct: 132 DQHQAMAMQESADVEPNTVLKVFQKGYQLNGRLLRPAMVVVSKAPS 177


>gi|114777594|ref|ZP_01452575.1| Molecular chaperone GrpE (heat shock protein) [Mariprofundus
           ferrooxydans PV-1]
 gi|114552065|gb|EAU54582.1| Molecular chaperone GrpE (heat shock protein) [Mariprofundus
           ferrooxydans PV-1]
          Length = 181

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 96/157 (61%), Gaps = 13/157 (8%)

Query: 33  PEESLNQ-SEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRAL 91
           P E L Q + E +D+ LR  AEMENLR+R++R+  DA  + I KFA  +L V+DN+ RAL
Sbjct: 34  PLEQLQQENNELKDRLLRTHAEMENLRKRSERQVADAHKFGIEKFASALLDVADNMERAL 93

Query: 92  DSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMF 151
           +   ++  N E        +L EG+++T       ++R+ V++IDA  Q+F+PN H+A+ 
Sbjct: 94  E---VEAGNEE--------ALREGVQLTLNSWHDLMKRFHVERIDAVGQQFDPNWHEALT 142

Query: 152 EEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           + P D  P  T++     GY+++ R++RPA V +S G
Sbjct: 143 QMPSDE-PEGTVVAQHVAGYSLHGRLIRPAKVLVSSG 178


>gi|289626204|ref|ZP_06459158.1| heat shock protein GrpE [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289646945|ref|ZP_06478288.1| heat shock protein GrpE [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|298488440|ref|ZP_07006471.1| Heat shock protein GrpE [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|298157065|gb|EFH98154.1| Heat shock protein GrpE [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|320322544|gb|EFW78637.1| heat shock protein GrpE [Pseudomonas syringae pv. glycinea str.
           B076]
 gi|320329987|gb|EFW85974.1| heat shock protein GrpE [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330868230|gb|EGH02939.1| heat shock protein GrpE [Pseudomonas syringae pv. aesculi str.
           0893_23]
 gi|330875241|gb|EGH09390.1| heat shock protein GrpE [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330877249|gb|EGH11398.1| heat shock protein GrpE [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
 gi|330987039|gb|EGH85142.1| heat shock protein GrpE [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 187

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 61/166 (36%), Positives = 102/166 (61%), Gaps = 11/166 (6%)

Query: 25  EEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVS 84
           E  + + + EE L  ++   D+ LRV A+++N+RRR +++ + A  +++ KFA D+L + 
Sbjct: 23  ELTTRVQVLEEQLAAAQ---DQSLRVAADLQNVRRRAEQDVEKAHKFALEKFAGDLLPII 79

Query: 85  DNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNP 144
           D+L R LD     L+N + +S   ++ + EGIE+T +    TL+RY ++ ID   Q F+ 
Sbjct: 80  DSLERGLD-----LSNPDDES---IRPMREGIELTLKMFQDTLKRYQLEAIDPHGQPFSA 131

Query: 145 NMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           + HQAM  +    V  NT++KV Q GY +N R+LRPA+V +SK  +
Sbjct: 132 DQHQAMAMQESADVEPNTVLKVFQKGYQLNGRLLRPAMVVVSKAPS 177


>gi|221136663|ref|XP_002167866.1| PREDICTED: similar to predicted protein, partial [Hydra
           magnipapillata]
          Length = 143

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 51/146 (34%), Positives = 96/146 (65%), Gaps = 4/146 (2%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           EF+DKY+R +AE EN+RRR  +   DA+ +++  F++D+L V+D L +A+ S P+D    
Sbjct: 2   EFKDKYIRSLAECENVRRRGVKMVSDAKLFAVQGFSKDLLEVADILEKAMLSVPID---- 57

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
           E +   +LK+L +G+ MT   +     ++G++K++  ++KF+PN H+A+F++      + 
Sbjct: 58  ELQKNELLKNLYDGLVMTEAHLQKVFLKHGLQKVNPINEKFDPNFHEALFQKSIPGKASG 117

Query: 162 TIIKVVQDGYAINERVLRPALVSISK 187
           T+++V + GY +N R +R ALV +++
Sbjct: 118 TVVEVNKPGYLLNGRPVRAALVGVAQ 143


>gi|118603015|ref|YP_904230.1| GrpE protein [Candidatus Ruthia magnifica str. Cm (Calyptogena
           magnifica)]
 gi|226737166|sp|A1AXV2|GRPE_RUTMC RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|118567954|gb|ABL02759.1| GrpE protein [Candidatus Ruthia magnifica str. Cm (Calyptogena
           magnifica)]
          Length = 180

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 112/177 (63%), Gaps = 13/177 (7%)

Query: 15  NPS-NANSSTAEEKSEINIPEESLNQSEEFRD---KYLRVIAEMENLRRRTDREKKDAQS 70
           NP+  A S T +EK E N+ E+ +   +  +D   K LR  AEMENL+RR  ++ ++A  
Sbjct: 13  NPTIKAVSQTPKEK-EDNLKEQLIQAQQSAKDNWDKLLRSQAEMENLKRRNAKDVENAHK 71

Query: 71  YSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERY 130
           +++  F + +L V D+LS  + +A        ++ ++ +K ++EG+EMT +  +STLE++
Sbjct: 72  FALDSFVKALLEVKDSLSMGIKTA--------QEEKATVKHIVEGLEMTNKVFLSTLEKF 123

Query: 131 GVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           GV  I+ +D+ FNP +H+A+   P     +N++++VVQ G+ +N R++RPA+V +++
Sbjct: 124 GVVMINPEDEAFNPELHEAVTMIPMPGKDSNSVLEVVQFGFTLNGRLVRPAMVVVAQ 180


>gi|308800618|ref|XP_003075090.1| Molecular chaperone of the GrpE family (ISS) [Ostreococcus tauri]
 gi|116061644|emb|CAL52362.1| Molecular chaperone of the GrpE family (ISS) [Ostreococcus tauri]
          Length = 420

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 94/148 (63%), Gaps = 4/148 (2%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAP-LDLAN 100
           + +D+ LR +AEMENLR RT R+ +DA+ +++  F +D+L V+DNL RA+ + P  ++  
Sbjct: 271 DLKDRILRTMAEMENLRERTRRQAEDAKKFAVQGFCKDLLDVADNLDRAISTVPEEEIET 330

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEP---HDT 157
             +K ++ LKS  EG+ +T +++ ST  ++GV K + + ++F+ N+H A+F  P      
Sbjct: 331 DVEKIKAKLKSFREGVVLTEKQLSSTFNKHGVAKFNPEGEEFDANLHMALFNVPIPEGSD 390

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSI 185
             A T+  V + GY ++ERV+R A V +
Sbjct: 391 AKAGTVAAVTKTGYTLHERVIRAAEVGV 418


>gi|46105354|ref|XP_380481.1| hypothetical protein FG00305.1 [Gibberella zeae PH-1]
          Length = 244

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 92/150 (61%), Gaps = 2/150 (1%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           +++DK LR +A+  NL+ RT RE K A+ ++I KFA+D++   DNL RAL   P +    
Sbjct: 95  DWKDKCLRTVADFRNLQERTTREVKSAKDFAIQKFAKDLVDSVDNLDRALGMVPQEKLKV 154

Query: 102 EKKSESV--LKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVP 159
           + + E +  L +L EG++MT   +M+TL+++G++++  + +KFNPN  +A F  P     
Sbjct: 155 KDRPEGIEDLANLYEGLKMTEDILMNTLKKHGLERLSPEGEKFNPNEQEATFMTPQPDKE 214

Query: 160 ANTIIKVVQDGYAINERVLRPALVSISKGK 189
             T+  V Q G+ +N RVLR A V + K K
Sbjct: 215 DGTVFFVQQKGFKLNGRVLRAAKVGVVKNK 244


>gi|70734321|ref|YP_257961.1| heat shock protein GrpE [Pseudomonas fluorescens Pf-5]
 gi|123748551|sp|Q4KIH2|GRPE_PSEF5 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|68348620|gb|AAY96226.1| co-chaperone GrpE [Pseudomonas fluorescens Pf-5]
          Length = 188

 Score =  111 bits (278), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 109/187 (58%), Gaps = 14/187 (7%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E  +  +N+D  + P  +    A   + + + EE L  ++   D+ LRV A+++N+RRR 
Sbjct: 4   EQTLDTQNLDANQAPEASGDDLA---ARVQVLEEQLAGAQ---DQALRVAADLQNVRRRA 57

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           +++ + A  +++ KFA D+L V D+L R L+     L+N + +S   ++ + EGIE+T +
Sbjct: 58  EQDVEKAHKFALEKFAGDLLPVIDSLERGLE-----LSNPDDES---IRPMREGIELTLK 109

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
               TL+RY ++ ID   + FN   HQAM  +    V  N+++KV Q GY +N R+LRPA
Sbjct: 110 MFHDTLKRYQLEAIDPHGEPFNAEQHQAMAMQESADVEPNSVLKVFQKGYQLNGRLLRPA 169

Query: 182 LVSISKG 188
           +V +SK 
Sbjct: 170 MVVVSKA 176


>gi|255264654|ref|ZP_05343996.1| co-chaperone GrpE [Thalassiobium sp. R2A62]
 gi|255106989|gb|EET49663.1| co-chaperone GrpE [Thalassiobium sp. R2A62]
          Length = 188

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 107/154 (69%), Gaps = 8/154 (5%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           EE   + ++++D+++R +A+ EN R+R+DR++++A++Y  +K ARDML V DN+ RALD+
Sbjct: 38  EELRAERDDYKDRFMRALADAENSRKRSDRDRREAENYGGSKLARDMLPVYDNMKRALDA 97

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFE 152
           A      + + SE+  K+LIEG+E+T RE++S  +++G+  I  +   +F+P  HQAMFE
Sbjct: 98  A------TAEGSEAS-KALIEGVELTMRELISVFKKHGIDPIVPEVGDRFDPQNHQAMFE 150

Query: 153 EPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
            P     A  II+V+ +G+ +++R+LRPA V +S
Sbjct: 151 APLPDTKAGDIIQVMTEGFMLHDRLLRPAQVGVS 184


>gi|39942268|ref|XP_360671.1| hypothetical protein MGG_03214 [Magnaporthe oryzae 70-15]
 gi|145015794|gb|EDK00284.1| hypothetical protein MGG_03214 [Magnaporthe oryzae 70-15]
          Length = 252

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 92/156 (58%), Gaps = 10/156 (6%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD---- 97
           E++D+YLR +A+  NL+ R  RE K  + ++I KFARD++   DNL RAL   P D    
Sbjct: 95  EWKDRYLRSVADFRNLQDRQAREMKSTRDFAIQKFARDLVDSVDNLERALAMVPADKIKA 154

Query: 98  ----LANSEKKSESV--LKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMF 151
                 +SE K E +  L +L EG++MT   ++ST+ ++G+++ +   +KFNPN H+A F
Sbjct: 155 ASDAAKDSETKPEFLQDLVNLYEGLKMTENILVSTVAKHGLERFNPNGEKFNPNEHEATF 214

Query: 152 EEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
             P      NT+    Q G+ +N RV+RPA V + K
Sbjct: 215 MTPQPDKDDNTVFFTQQTGFKLNGRVIRPAKVGVVK 250


>gi|328350782|emb|CCA37182.1| GrpE protein homolog, mitochondrial [Pichia pastoris CBS 7435]
          Length = 233

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 85/146 (58%), Gaps = 4/146 (2%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            +D+YLR +A+  NL+  T RE + A+ +++ KFARD+L   DN   AL +   +   + 
Sbjct: 90  LKDRYLRSVADFRNLQETTKREIQKARDFALQKFARDLLESLDNFGHALSAVKDETLAAN 149

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
           K+    +  L +G+EMT+     TL R+G+ KID  D++F+PN H+A FE P       T
Sbjct: 150 KE----VSQLYDGVEMTKNIFEKTLVRHGINKIDPVDERFDPNRHEATFEVPQPDKEPGT 205

Query: 163 IIKVVQDGYAINERVLRPALVSISKG 188
           +  V Q GY +N RVLR A V + KG
Sbjct: 206 VFHVQQPGYELNGRVLRAAKVGVVKG 231


>gi|213966663|ref|ZP_03394814.1| heat shock protein GrpE [Pseudomonas syringae pv. tomato T1]
 gi|301383174|ref|ZP_07231592.1| heat shock protein GrpE [Pseudomonas syringae pv. tomato Max13]
 gi|302063391|ref|ZP_07254932.1| heat shock protein GrpE [Pseudomonas syringae pv. tomato K40]
 gi|302133764|ref|ZP_07259754.1| heat shock protein GrpE [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|213928513|gb|EEB62057.1| heat shock protein GrpE [Pseudomonas syringae pv. tomato T1]
 gi|331016632|gb|EGH96688.1| heat shock protein GrpE [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 187

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 100/161 (62%), Gaps = 11/161 (6%)

Query: 30  INIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSR 89
           + + EE L  ++   D+ LRV A+++N+RRR +++ + A  +++ KFA D+L + D+L R
Sbjct: 28  VQVLEEQLAAAQ---DQSLRVAADLQNVRRRAEQDVEKAHKFALEKFAGDLLPIIDSLER 84

Query: 90  ALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQA 149
            LD     L+N + +S   ++ + EGIE+T +    TL+RY ++ ID   Q F+ + HQA
Sbjct: 85  GLD-----LSNPDDES---IRPMREGIELTLKMFQDTLKRYQLEAIDPHGQPFSADQHQA 136

Query: 150 MFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           M  +    V  NT++KV Q GY +N R+LRPA+V +SK  +
Sbjct: 137 MAMQESADVEPNTVLKVFQKGYQLNGRLLRPAMVVVSKAPS 177


>gi|78224716|ref|YP_386463.1| heat shock protein GrpE [Geobacter metallireducens GS-15]
 gi|123729156|sp|Q39PT6|GRPE_GEOMG RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|78195971|gb|ABB33738.1| GrpE protein [Geobacter metallireducens GS-15]
          Length = 189

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 57/144 (39%), Positives = 94/144 (65%), Gaps = 11/144 (7%)

Query: 45  DKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKK 104
           DK++R  A++EN R+RT +EK++   Y       ++L V DN+ RALD +  D A++   
Sbjct: 56  DKFVRERADLENYRKRTQKEKEELLKYGNESLIVEILPVVDNMERALDHSDDDSASA--- 112

Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKIDA-KDQKFNPNMHQAMFEEPHDTVPANTI 163
                  +IEG+ MT   ++STL+++GV  ++A K   F+P +HQAM +  +  VPAN++
Sbjct: 113 -------VIEGVRMTLNMLLSTLKKFGVTVVEAEKGTPFDPAVHQAMCQVENTDVPANSV 165

Query: 164 IKVVQDGYAINERVLRPALVSISK 187
           +++ Q GY +NER++RPA+VS+SK
Sbjct: 166 VEIFQKGYLLNERLIRPAMVSVSK 189


>gi|268573048|ref|XP_002641501.1| Hypothetical protein CBG09795 [Caenorhabditis briggsae]
 gi|187031286|emb|CAP29347.1| hypothetical protein CBG_09795 [Caenorhabditis briggsae AF16]
          Length = 237

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 93/155 (60%), Gaps = 7/155 (4%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           +E   +S++F+DKY R +AE EN+RRR  ++  DA+ ++I  F +D+L VSD L  A+ S
Sbjct: 84  DEVQTESKDFKDKYQRSLAETENVRRRGIKQTDDAKVFAIQSFCKDLLEVSDILDIAVKS 143

Query: 94  A-PLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFE 152
             P +L +  K     LK L EG+ MTR  +  T  ++G+  +D  +QKF+PN+H+A+F+
Sbjct: 144 VKPEELESGGK----ALKDLFEGVSMTRTVLAKTFAKHGLVTVDPTNQKFDPNLHEAVFQ 199

Query: 153 EPHDTV--PANTIIKVVQDGYAINERVLRPALVSI 185
            P      P   I    + GY++ ER +RPA V +
Sbjct: 200 IPSANAKQPVGHIEVCTKIGYSLKERPIRPAQVGV 234


>gi|315633866|ref|ZP_07889155.1| co-chaperone GrpE [Aggregatibacter segnis ATCC 33393]
 gi|315477116|gb|EFU67859.1| co-chaperone GrpE [Aggregatibacter segnis ATCC 33393]
          Length = 194

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 57/143 (39%), Positives = 98/143 (68%), Gaps = 7/143 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE++N+RRRT+++ + A  +++ KFA+D+L+  DNL RAL + P   AN E 
Sbjct: 58  QDLLLRTRAEIDNIRRRTEQDVEKAHKFALEKFAKDILNTIDNLERAL-ATP---ANIED 113

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           +S   +K+L +G+E+T +E+++T+ R+GV+ +    + FNP++HQA+  +P +    N I
Sbjct: 114 ES---IKALFDGVELTLKELLATVARFGVEPVGVVGEVFNPDLHQAISMQPMEGFETNQI 170

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY +N RV+RPA+V ++
Sbjct: 171 TTVLQKGYLLNGRVIRPAMVMVA 193


>gi|82703358|ref|YP_412924.1| GrpE protein [Nitrosospira multiformis ATCC 25196]
 gi|123754280|sp|Q2Y6T9|GRPE_NITMU RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|82411423|gb|ABB75532.1| GrpE protein [Nitrosospira multiformis ATCC 25196]
          Length = 193

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 53/148 (35%), Positives = 93/148 (62%), Gaps = 12/148 (8%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E  D +LR  AE EN+R+R   +  +A  Y+I  F+ ++LSV D+L  AL          
Sbjct: 56  EHYDAWLRAKAEGENIRKRAQMDVTNAHKYAIENFSTELLSVMDSLEAAL---------- 105

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
                + +++   G+E+T +++ +T  ++ +K++  + +KF+P++HQAM     + +P N
Sbjct: 106 -AVENATVENFKSGMELTLKQLTATFAKFNIKQLSPQGEKFDPHLHQAMCMVESE-LPHN 163

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGK 189
           T+++V+Q GY +N+RV+RPALVS+SKGK
Sbjct: 164 TVVQVMQKGYVLNDRVIRPALVSVSKGK 191


>gi|114321052|ref|YP_742735.1| GrpE protein [Alkalilimnicola ehrlichii MLHE-1]
 gi|122311356|sp|Q0A7E2|GRPE_ALHEH RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|114227446|gb|ABI57245.1| GrpE protein [Alkalilimnicola ehrlichii MLHE-1]
          Length = 218

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 113/183 (61%), Gaps = 11/183 (6%)

Query: 13  EKNPSNANSSTAEEKSEINIP-EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
           E    +A+  + +E +E+    EE+  ++EE  ++ LR  AEM+N++RR   + + A+ Y
Sbjct: 36  EDGAESASGDSGDELTELQQALEEARARAEENWNECLRARAEMQNIQRRAQADVEKARKY 95

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
           ++ K A D+L V D+L   + +A  + A+ +K        L+EG E+T + +   LER+ 
Sbjct: 96  AVEKIAGDLLGVKDSLEMGVKAAKEEGADPQK--------LLEGSELTLKMLSQVLERFN 147

Query: 132 VKKIDAKDQKFNPNMHQAMFEEP-HDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           V++ID + ++FNP  H+A+  +P H+  P NT++ V+Q GYA+++RVLRPA+V +S+   
Sbjct: 148 VQEIDPQGERFNPEHHEAVAAQPSHEHEP-NTVLNVMQKGYALHDRVLRPAMVVVSQKAP 206

Query: 191 QNP 193
           + P
Sbjct: 207 EPP 209


>gi|325110507|ref|YP_004271575.1| protein grpE [Planctomyces brasiliensis DSM 5305]
 gi|324970775|gb|ADY61553.1| Protein grpE [Planctomyces brasiliensis DSM 5305]
          Length = 188

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 101/174 (58%), Gaps = 11/174 (6%)

Query: 17  SNANSSTAEEKSEINI-PEESLNQ-SEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIA 74
           +NA + +A E++E  + P E L Q + E  D+ +R  AE+ N RRRT  E    + Y   
Sbjct: 21  ANAETDSAAEEAEPELSPLEQLQQQNSELEDRLVRTQAELVNYRRRTQNELDQFRKYEGL 80

Query: 75  KFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKK 134
              RD+L   DNL RA D+A            S +++L +G+EM  +++M TL RY V  
Sbjct: 81  NLVRDLLPALDNLHRATDAA---------AKASDVENLKKGVEMVTQQIMETLRRYQVDA 131

Query: 135 IDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           I A+ ++F+PN H+A+ ++P + VPA  ++  V+ GY + +R++RPA V +S G
Sbjct: 132 ISAQGEEFDPNQHEAVVQQPSEDVPAMHVLAEVETGYKMQDRIVRPAKVVVSTG 185


>gi|71735196|ref|YP_276327.1| heat shock protein GrpE [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|123761176|sp|Q48E61|GRPE_PSE14 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|71555749|gb|AAZ34960.1| heat shock protein GrpE [Pseudomonas syringae pv. phaseolicola
           1448A]
          Length = 187

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 61/166 (36%), Positives = 102/166 (61%), Gaps = 11/166 (6%)

Query: 25  EEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVS 84
           E  + + + EE L  ++   D+ LRV A+++N+RRR +++ + A  +++ KFA D+L + 
Sbjct: 23  ELTTRVQVLEEQLAAAQ---DQSLRVAADLQNVRRRAEQDVEKAHKFALEKFAGDLLPII 79

Query: 85  DNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNP 144
           D+L R LD     L+N + +S   ++ + EGIE+T +    TL+RY ++ ID   Q F+ 
Sbjct: 80  DSLERGLD-----LSNPDDES---IRPMREGIELTLKMFQDTLKRYQLEAIDPYGQPFSA 131

Query: 145 NMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           + HQAM  +    V  NT++KV Q GY +N R+LRPA+V +SK  +
Sbjct: 132 DQHQAMAMQESADVEPNTVLKVFQKGYQLNGRLLRPAMVVVSKAPS 177


>gi|17552458|ref|NP_497713.1| hypothetical protein C34C12.8 [Caenorhabditis elegans]
 gi|6225475|sp|Q18421|GRPE_CAEEL RecName: Full=GrpE protein homolog, mitochondrial; Flags: Precursor
 gi|3874729|emb|CAA87101.1| C. elegans protein C34C12.8, confirmed by transcript evidence
           [Caenorhabditis elegans]
          Length = 237

 Score =  111 bits (278), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 100/178 (56%), Gaps = 13/178 (7%)

Query: 11  DKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQS 70
           DK + P  A     +E  ++    ESL+    F+DKY R +AE EN+RRR  ++  DA+ 
Sbjct: 67  DKTQIPKGAFDVLLKEYDDLQ--AESLD----FKDKYQRSLAETENVRRRGIKQTDDAKV 120

Query: 71  YSIAKFARDMLSVSDNLSRALDSA-PLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
           ++I  F +D+L VSD L  A+ S  P DL +  K     LK L EG+ MTR  M  T  +
Sbjct: 121 FAIQSFCKDLLEVSDILDIAVKSVKPEDLESGGK----ALKDLFEGVSMTRTVMAKTFAK 176

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTV--PANTIIKVVQDGYAINERVLRPALVSI 185
           +G+  +D  ++KF+PN+H+A+F+ P      P   I    + GY++ ER +RPA V +
Sbjct: 177 HGLVTVDPTNEKFDPNLHEAVFQIPSANAKQPVGHIEVCTKIGYSLKERPIRPAQVGV 234


>gi|325181744|emb|CCA16200.1| Mitochondrial Protein Translocase (MPT) Family puta [Albugo
           laibachii Nc14]
          Length = 221

 Score =  111 bits (277), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 100/155 (64%), Gaps = 1/155 (0%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           EE  + S++  D  LR +A+ EN+RR + ++ ++A+ ++I+KFAR++L V+DNL RA +S
Sbjct: 61  EELESDSKKINDHLLRALADAENVRRISRQDVQNARDFAISKFARNLLDVADNLQRAHES 120

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
             ++  + ++  E++ KSL EG+ MT +++    + + +  +     +F+PNMH A+FE 
Sbjct: 121 IKIEELHPDRTLEAI-KSLHEGVVMTDQQLQKVFQEFNINPVGQVGDRFDPNMHDALFEY 179

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
             DT    TI ++++ GY +N R++RPA V + KG
Sbjct: 180 EDDTKEPGTIGQLMKRGYLLNSRIIRPAQVGVIKG 214


>gi|87312188|ref|ZP_01094291.1| molecular chaperone GrpE [Blastopirellula marina DSM 3645]
 gi|87285113|gb|EAQ77044.1| molecular chaperone GrpE [Blastopirellula marina DSM 3645]
          Length = 198

 Score =  111 bits (277), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 85/143 (59%), Gaps = 9/143 (6%)

Query: 46  KYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKS 105
           + L   A+MENLR+R  RE +D   Y+      D+L V DNL+RALDSA      S++ +
Sbjct: 55  RILLAQADMENLRKRMRREVEDTVKYADVPLITDLLPVIDNLNRALDSA----GQSQEAA 110

Query: 106 ESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIK 165
                 ++ G++M  + M+  L R G K I+A  Q F+PN H A+ ++P D VP+  ++ 
Sbjct: 111 -----GIVTGVKMVAQSMLDVLARRGCKTIEALGQPFDPNRHDAILQQPSDEVPSGHVLM 165

Query: 166 VVQDGYAINERVLRPALVSISKG 188
           V Q GY +++RV+RPA V +S G
Sbjct: 166 VTQSGYQLHDRVIRPAQVIVSTG 188


>gi|304398632|ref|ZP_07380504.1| GrpE protein [Pantoea sp. aB]
 gi|308187819|ref|YP_003931950.1| Protein grpE (HSP-70 cofactor) [Pantoea vagans C9-1]
 gi|304353843|gb|EFM18218.1| GrpE protein [Pantoea sp. aB]
 gi|308058329|gb|ADO10501.1| Protein grpE (HSP-70 cofactor) [Pantoea vagans C9-1]
          Length = 193

 Score =  111 bits (277), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 60/158 (37%), Positives = 95/158 (60%), Gaps = 9/158 (5%)

Query: 34  EESLNQSEE-FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALD 92
           E  L QS+   RD  LR  AE+EN+RRR + + + A  +++ KFA ++L V D+L RAL+
Sbjct: 44  EAELAQSQTGVRDAQLRAQAEVENIRRRAEMDVEKAHKFALEKFANELLPVIDSLERALE 103

Query: 93  SAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFE 152
            A         K +  L S+IEGIE+T + ++  + ++GV+ +      FNP +HQAM  
Sbjct: 104 VA--------NKEDPQLASMIEGIELTLKGLLGAVRKFGVEVVGETGVPFNPEVHQAMSM 155

Query: 153 EPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
              +    N ++ V+Q GY +N R+LRPA+V++SK K+
Sbjct: 156 MESEEFEPNHVMLVMQRGYTLNGRLLRPAMVAVSKAKS 193


>gi|259907664|ref|YP_002648020.1| heat shock protein GrpE [Erwinia pyrifoliae Ep1/96]
 gi|224963286|emb|CAX54771.1| Heat shock protein [Erwinia pyrifoliae Ep1/96]
 gi|283477511|emb|CAY73427.1| Protein grpE (HSP-70 cofactor) [Erwinia pyrifoliae DSM 12163]
          Length = 194

 Score =  111 bits (277), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 56/148 (37%), Positives = 94/148 (63%), Gaps = 8/148 (5%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            RD  LR  AE+EN+RRR + + + A  +++ KF+ ++L V D+L RAL+ A  D +N E
Sbjct: 55  VRDAQLRAQAEIENIRRRAELDVEKAHKFALEKFSNELLPVIDSLERALEVA--DKSNPE 112

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
                 L ++IEGIE+T + ++  + ++GV+ +   +  FNP +HQAM     + V  N 
Sbjct: 113 ------LAAMIEGIELTMKSLLGAVRKFGVEVVGDTNVPFNPELHQAMSMMESEEVEPNH 166

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ V+Q GY +N R+LRPA+V+++K K+
Sbjct: 167 VMMVMQRGYTLNGRLLRPAMVAVAKSKS 194


>gi|296104283|ref|YP_003614429.1| heat shock protein GrpE [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295058742|gb|ADF63480.1| heat shock protein GrpE [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 197

 Score =  111 bits (277), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 57/147 (38%), Positives = 92/147 (62%), Gaps = 8/147 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LR+ AEMENLRRRT+++ + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 59  RDSVLRIKAEMENLRRRTEQDVEKAHKFALEKFVNELLPVIDSLDRALEVA--DKANPDN 116

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
            +      +IEGIE+T + M+  + ++GV+ I   D   +PN+HQA+     + V A  +
Sbjct: 117 AA------MIEGIELTLKSMLDVVRKFGVEVIADTDVPLDPNVHQAIAMVESEDVEAGKV 170

Query: 164 IKVVQDGYAINERVLRPALVSISKGKT 190
           + V+Q GY +N R +R A+V+++K K 
Sbjct: 171 LGVMQKGYTLNGRTIRAAMVTVAKAKA 197


>gi|3851638|gb|AAC72386.1| chaperone GrpE type 1 [Nicotiana tabacum]
          Length = 299

 Score =  111 bits (277), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 63/199 (31%), Positives = 111/199 (55%), Gaps = 25/199 (12%)

Query: 13  EKNPSNANSSTAEEKSEINIPEESLN-----------------QSEEFR---DKYLRVIA 52
           EK  ++A+S   +EK E +I  E L+                 + +EFR   DK+LR  A
Sbjct: 88  EKASASADSHIQDEKDESDIDAEDLSRDDLVKLVVEKEELLKMKDDEFRKLQDKFLRSYA 147

Query: 53  EMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS-----APLDLANSEKKSES 107
           EMEN+  RT RE ++++ ++I  F + +L V DNL RA        + +D +     +  
Sbjct: 148 EMENVMERTKREAENSKKFAIQNFVKALLDVPDNLGRASSVVKESFSKIDASKDTVGAMP 207

Query: 108 VLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVV 167
           +LK+L+EG+EMT +++    +++GV+K D  +++F+PN H A+F+ P        I   +
Sbjct: 208 LLKTLLEGVEMTDKQLAEVFKKFGVEKYDPTNEQFDPNKHNAVFQVPDPEKAPGVIAVCL 267

Query: 168 QDGYAINERVLRPALVSIS 186
           + GY +++R++RPA V ++
Sbjct: 268 KPGYTLHDRIIRPAEVGVT 286


>gi|226946322|ref|YP_002801395.1| heat shock protein GrpE [Azotobacter vinelandii DJ]
 gi|259647650|sp|C1DFM4|GRPE_AZOVD RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226721249|gb|ACO80420.1| GrpE protein [Azotobacter vinelandii DJ]
          Length = 187

 Score =  110 bits (276), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 62/188 (32%), Positives = 110/188 (58%), Gaps = 15/188 (7%)

Query: 7   EKNIDK---EKNPSNANSSTAEE-KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
           E+N+D    E+ P+   +S  E+  + +   EE L  ++   D+ LR  AE++N+RRR +
Sbjct: 4   EQNLDNRAPEETPAAEGTSAGEDLAARVQALEEQLAAAQ---DQALRAAAELQNVRRRAE 60

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           ++ + A  +++ +FA+D+L V D+L R ++        S+   ES+ + + EG+E+T + 
Sbjct: 61  QDVEKAHKFALERFAQDLLGVVDSLERGIEL-------SDPADESI-RPMREGMELTLKM 112

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
               L RY ++++D   + FNP  HQAM  E  D+    +++KV Q GY ++ R+LRPA+
Sbjct: 113 FHDVLRRYQLEQLDPHGEPFNPEHHQAMAMEESDSAEPGSVLKVFQKGYLLSGRLLRPAM 172

Query: 183 VSISKGKT 190
           V +SK  T
Sbjct: 173 VVVSKAPT 180


>gi|295097181|emb|CBK86271.1| Molecular chaperone GrpE (heat shock protein) [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
          Length = 205

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 57/147 (38%), Positives = 91/147 (61%), Gaps = 8/147 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LR+ AEMENLRRRT+ + + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 67  RDGVLRIKAEMENLRRRTELDVEKAHKFALEKFVNELLPVIDSLDRALEVA--DKANPDN 124

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
            +      +IEGIE+T + M+  + ++GV+ I   D   +PN+HQA+     + V A  +
Sbjct: 125 AA------MIEGIELTLKSMLDVVRKFGVEVIADTDVPLDPNVHQAIAMVESEDVAAGNV 178

Query: 164 IKVVQDGYAINERVLRPALVSISKGKT 190
           + V+Q GY +N R +R A+V+++K K 
Sbjct: 179 LGVMQKGYTLNGRTIRAAMVTVAKAKA 205


>gi|302412933|ref|XP_003004299.1| grpE [Verticillium albo-atrum VaMs.102]
 gi|261356875|gb|EEY19303.1| grpE [Verticillium albo-atrum VaMs.102]
          Length = 247

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 59/149 (39%), Positives = 88/149 (59%), Gaps = 3/149 (2%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAP---LDL 98
           +++DK LR +A+  NL+ RT RE K A+ ++I KFA+D++   DNL RAL   P   L  
Sbjct: 97  DWKDKCLRSVADFRNLQDRTTREMKSARDFAIQKFAKDLVDSIDNLDRALGMVPESKLSP 156

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
           A    ++   L +L EG+ MT   +M+TLE++G+++   +  KFNPN H+A F  P    
Sbjct: 157 AADASEAAKDLANLHEGLRMTETVLMNTLEKHGLERFSPEADKFNPNEHEATFMTPQPGK 216

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISK 187
             NT+  V   G+ +N RVLR A V + K
Sbjct: 217 EDNTVFHVQSKGFKLNGRVLRAAKVGVVK 245


>gi|330888675|gb|EGH21336.1| heat shock protein GrpE [Pseudomonas syringae pv. mori str. 301020]
          Length = 187

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 102/166 (61%), Gaps = 11/166 (6%)

Query: 25  EEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVS 84
           E  + + + EE L  ++   D+ LRV A+++N+RRR +++ + A  +++ +FA D+L + 
Sbjct: 23  ELTTRVQVLEEQLAAAQ---DQSLRVAADLQNVRRRAEQDVEKAHKFALERFAGDLLPII 79

Query: 85  DNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNP 144
           D+L R LD     L+N + +S   ++ + EGIE+T +    TL+RY ++ ID   Q F+ 
Sbjct: 80  DSLERGLD-----LSNPDDES---IRPMREGIELTLKMFQDTLKRYQLEAIDPHGQPFSA 131

Query: 145 NMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           + HQAM  +    V  NT++KV Q GY +N R+LRPA+V +SK  +
Sbjct: 132 DQHQAMAMQESADVEPNTVLKVFQKGYQLNGRLLRPAMVVVSKAPS 177


>gi|330920035|ref|XP_003298864.1| hypothetical protein PTT_09692 [Pyrenophora teres f. teres 0-1]
 gi|311327765|gb|EFQ93051.1| hypothetical protein PTT_09692 [Pyrenophora teres f. teres 0-1]
          Length = 231

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 101/166 (60%), Gaps = 9/166 (5%)

Query: 28  SEINIPEESLNQSE----EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSV 83
           SE+   +E+L + +    + +DKYLR +A+  NL+ RT RE K A+ ++I +FARD++  
Sbjct: 67  SEVTQLKEALEKKDKEIIDLKDKYLRSVADFRNLQERTQREIKAAKDFAIQRFARDLVES 126

Query: 84  SDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQ--K 141
            DNL RAL +   D   S+      L +L +GI+MT   +++TL+++G+++ D  +Q  K
Sbjct: 127 VDNLDRALGTVSEDKLKSDNTD---LIALHDGIKMTDSILINTLKKHGLERFDPSEQAEK 183

Query: 142 FNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           F+PN+H+A+F+ P       T     Q G+ +N RVLRPA V + K
Sbjct: 184 FDPNVHEAVFQAPQPDKEDGTCFHTQQKGFRLNGRVLRPAKVGVVK 229


>gi|289207644|ref|YP_003459710.1| GrpE protein [Thioalkalivibrio sp. K90mix]
 gi|288943275|gb|ADC70974.1| GrpE protein [Thioalkalivibrio sp. K90mix]
          Length = 193

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 58/149 (38%), Positives = 92/149 (61%), Gaps = 9/149 (6%)

Query: 40  SEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLA 99
           +EE RD+ LR  AE+EN RRR +RE ++A  Y++ KFA +ML V D+L   L +A     
Sbjct: 44  AEERRDQALRAQAELENQRRRFERELENAHKYAMEKFASEMLEVGDSLEMGLQAA----- 98

Query: 100 NSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVP 159
              ++S+ V + +IEG E+T + +    E++G++  D   ++F+P  HQAM  +     P
Sbjct: 99  ---RESKDV-ERIIEGAELTLKNLNRVFEKFGIQAEDPTGERFDPERHQAMSMQEDPENP 154

Query: 160 ANTIIKVVQDGYAINERVLRPALVSISKG 188
            NT++  +Q GY + +RVLRPA+V +SK 
Sbjct: 155 PNTVVATMQKGYLLQDRVLRPAMVVVSKA 183


>gi|328858918|gb|EGG08029.1| hypothetical protein MELLADRAFT_85253 [Melampsora larici-populina
           98AG31]
          Length = 239

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 106/194 (54%), Gaps = 12/194 (6%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
           SE  +   +N + +N   ++ KS+  + ++   Q  E++D Y+R  A+ ENL++ + REK
Sbjct: 45  SETPLPASENTTTSNPEASQPKSDEQLAKKDA-QIAEYKDLYIRARADYENLQKISTREK 103

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL-----------ANSEKKSESVLKSLIE 114
             A+ Y+I  FA+D++S  D L  ALDS P D            ++++  S   L  L  
Sbjct: 104 SQAKDYAIQSFAKDLVSNIDVLKLALDSVPEDFRKQPGSEEAGTSSNQTDSRKHLADLWT 163

Query: 115 GIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAIN 174
           G+  T+  +  TL R+GV   D   +KF+PN H+AMF+ P      N+++   + G+ + 
Sbjct: 164 GVSSTKTLLEKTLSRFGVTPFDPTGEKFDPNKHEAMFQAPVPGKDPNSVLSCSKVGWMLR 223

Query: 175 ERVLRPALVSISKG 188
           +RVLRPA V + +G
Sbjct: 224 DRVLRPAQVGVVQG 237


>gi|307176632|gb|EFN66100.1| GrpE protein-like protein, mitochondrial [Camponotus floridanus]
          Length = 234

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 111/190 (58%), Gaps = 14/190 (7%)

Query: 10  IDKEKNPSNAN-------SSTAEEKSEINIPEESLNQSEE----FRDKYLRVIAEMENLR 58
           I +EK P  AN        +T + K+E+ +  + L + +E      DKY R +AE EN+R
Sbjct: 48  ITEEKKPDAANVPPRVEQEATEKIKTELELINKELAELKESKDVLEDKYKRALAEGENIR 107

Query: 59  RRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEM 118
            R  ++  DA+ + I  F +D+L V+D L +A +S P     +EK     LKSL EG+ M
Sbjct: 108 IRLTKQIHDAKLFGIQGFCKDLLDVADILGKATESVP-KAELTEKNPH--LKSLYEGLIM 164

Query: 119 TRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVL 178
           T  ++    +++G+  ++  ++KF+PN H+A+F++  +     TI+ V + GY ++ER++
Sbjct: 165 TEAQLHKVFKKHGLISLNPINEKFDPNEHEALFQQEVEGKEPGTIVVVSKIGYKLHERIV 224

Query: 179 RPALVSISKG 188
           RPALV ++KG
Sbjct: 225 RPALVGVAKG 234


>gi|254426863|ref|ZP_05040570.1| co-chaperone GrpE [Alcanivorax sp. DG881]
 gi|196193032|gb|EDX87991.1| co-chaperone GrpE [Alcanivorax sp. DG881]
          Length = 192

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/141 (39%), Positives = 89/141 (63%), Gaps = 8/141 (5%)

Query: 48  LRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSES 107
           +R  AE++N+R+R +R+ + A+ +++ KFA D+LSV+DNL R L  A LD        + 
Sbjct: 59  VRAQAEVQNVRKRAERDVQHARKFALEKFAGDLLSVADNLERGL--AALD------AEDE 110

Query: 108 VLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVV 167
            LK   EGIE+T + ++    RY +++I   D+ FNP +H+AM   P   V  NT+I+V+
Sbjct: 111 ALKGAREGIELTLKSLLDAFARYNLEQIAPADEPFNPELHEAMTMVPVPNVDPNTVIEVL 170

Query: 168 QDGYAINERVLRPALVSISKG 188
           + GY +N R++RPA V +SK 
Sbjct: 171 EKGYQLNGRLIRPARVVVSKA 191


>gi|116748477|ref|YP_845164.1| GrpE protein [Syntrophobacter fumaroxidans MPOB]
 gi|254799619|sp|A0LH27|GRPE_SYNFM RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|116697541|gb|ABK16729.1| GrpE protein [Syntrophobacter fumaroxidans MPOB]
          Length = 189

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 92/154 (59%), Gaps = 12/154 (7%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           EE L QS+   D+ LR+ AE++N R+R +REK +  +Y+     +D+L V DNL RAL+ 
Sbjct: 43  EEELKQSQ---DRLLRMAAELDNTRKRLEREKSEGIAYANEGLMKDLLPVLDNLERALEH 99

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
           +         ++E+   SL+EG+ MT +  + +L R+G    ++    F+PN H+A+ +E
Sbjct: 100 S---------ENEADCGSLVEGVRMTLKGFLDSLARFGCTPFESVGNAFDPNFHEAVMQE 150

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
                P  T+I+  Q GY + ER+LRPA+V +SK
Sbjct: 151 EVADYPERTVIREFQKGYTLKERLLRPAMVVVSK 184


>gi|110833174|ref|YP_692033.1| heat shock protein GrpE [Alcanivorax borkumensis SK2]
 gi|123149737|sp|Q0VST7|GRPE_ALCBS RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|110646285|emb|CAL15761.1| Heat shock protein GrpE [Alcanivorax borkumensis SK2]
          Length = 190

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 90/141 (63%), Gaps = 8/141 (5%)

Query: 48  LRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSES 107
           +R  AE++N+R+R +R+ + A+ +++ KFA D+LSV+DNL R L  A LD        + 
Sbjct: 57  VRAQAEVQNVRKRAERDVQHARKFALEKFAGDLLSVADNLERGL--AALD------AEDD 108

Query: 108 VLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVV 167
            LK   EGIE+T + ++    RY +++I+  D+ FNP +H+AM   P   V  N++I+V+
Sbjct: 109 ALKGAREGIELTLKSLLDAFARYNIEQINPADEPFNPELHEAMTMVPVPNVDPNSVIEVL 168

Query: 168 QDGYAINERVLRPALVSISKG 188
           + GY +N R++RPA V +SK 
Sbjct: 169 EKGYQLNGRLIRPARVVVSKA 189


>gi|237798547|ref|ZP_04587008.1| heat shock protein GrpE [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331021400|gb|EGI01457.1| heat shock protein GrpE [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 187

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 63/167 (37%), Positives = 102/167 (61%), Gaps = 13/167 (7%)

Query: 25  EEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVS 84
           E  + + + EE L  ++   D+ LRV A+++N+RRR +++ + A  +++ KFA D+L + 
Sbjct: 23  ELTTRVQVLEEQLAAAQ---DQSLRVAADLQNVRRRAEQDVEKAHKFALEKFAGDLLPII 79

Query: 85  DNLSRALD-SAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFN 143
           D+L R LD S+P D        ES+ + + EGIE+T +    TL+RY ++ ID   Q F+
Sbjct: 80  DSLERGLDLSSPDD--------ESI-RPMREGIELTLKMFQDTLKRYQLEAIDPHGQPFS 130

Query: 144 PNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
            + HQAM  +    V  NT++KV Q GY +N R+LRPA+V +SK  +
Sbjct: 131 ADQHQAMAMQESTDVEPNTVLKVFQKGYQLNGRLLRPAMVVVSKAPS 177


>gi|255656446|ref|ZP_05401855.1| heat shock protein [Clostridium difficile QCD-23m63]
 gi|296450108|ref|ZP_06891870.1| co-chaperone GrpE [Clostridium difficile NAP08]
 gi|296878489|ref|ZP_06902495.1| co-chaperone GrpE [Clostridium difficile NAP07]
 gi|296261116|gb|EFH07949.1| co-chaperone GrpE [Clostridium difficile NAP08]
 gi|296430573|gb|EFH16414.1| co-chaperone GrpE [Clostridium difficile NAP07]
          Length = 206

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 109/180 (60%), Gaps = 20/180 (11%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           EK +D E N ++ NS  AE+K +        N+ +E  DKY R+ AE  N RRRT +EK+
Sbjct: 46  EKEVDDE-NVTDINSKLAEKKLQ--------NELDELNDKYQRLQAEYANYRRRTQQEKE 96

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
               ++  K   +++ V D++ RALD+        E K +++ K    GI +  ++++ T
Sbjct: 97  TIGVFANEKIITELIPVIDSMERALDAC-------EDKEDTMYK----GISLVHKQLIDT 145

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           L ++GV++I+A+ ++F+PN+H A+ +E  D + AN I+ V+Q GY +  +V+RP++V +S
Sbjct: 146 LVKFGVEEIEAESKEFDPNLHLAVMQESVDGIEANQIVMVLQKGYKLGTKVVRPSMVKVS 205


>gi|332021654|gb|EGI62013.1| GrpE protein-like protein 1, mitochondrial [Acromyrmex echinatior]
          Length = 233

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 109/192 (56%), Gaps = 9/192 (4%)

Query: 3   TFMSEKNIDKEKNP--SNANSSTAEEKSEINIPEESLNQSEE----FRDKYLRVIAEMEN 56
           T   EK  D    P  S A  +  + K+E+ +  + L + +E      DKY R +AE EN
Sbjct: 45  TITEEKKPDATDVPPMSEATENEKKLKTELELINKELGELKESKDTLEDKYKRALAEGEN 104

Query: 57  LRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGI 116
           +R R  ++  DA+ + I  F +D+L V+D L +A +S P D    +      LKSL EG+
Sbjct: 105 IRIRLTKQINDAKLFGIQGFCKDLLDVADILGKATESVPKDEITEQNPH---LKSLYEGL 161

Query: 117 EMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINER 176
            MT  ++    +++G+  ++  ++KF+PN H+A+F++  +     TI+ V + GY ++ER
Sbjct: 162 VMTEAQLHKVFKKHGLVSLNPVNEKFDPNEHEALFQQEVEGKNPGTIVVVSKVGYKLHER 221

Query: 177 VLRPALVSISKG 188
           ++RPALV ++KG
Sbjct: 222 IVRPALVGVAKG 233


>gi|292489107|ref|YP_003531994.1| protein grpE (HSP-70 cofactor) [Erwinia amylovora CFBP1430]
 gi|292900227|ref|YP_003539596.1| heat shock protein [Erwinia amylovora ATCC 49946]
 gi|291200075|emb|CBJ47201.1| heat shock protein [Erwinia amylovora ATCC 49946]
 gi|291554541|emb|CBA22128.1| Protein grpE (HSP-70 cofactor) [Erwinia amylovora CFBP1430]
          Length = 194

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/148 (37%), Positives = 94/148 (63%), Gaps = 8/148 (5%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            RD  LR  AE+EN+RRR + + + A  +++ KF+ ++L V D+L RAL+ A  D +N E
Sbjct: 55  VRDAQLRAQAEIENIRRRAELDVEKAHKFALEKFSNELLPVIDSLERALEVA--DKSNPE 112

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
                 L ++IEGIE+T + ++  + ++GV+ +   +  FNP +HQAM     + V  N 
Sbjct: 113 ------LAAMIEGIELTMKSLLGAVRKFGVEVVGDTNVPFNPEVHQAMSMMESEEVEPNH 166

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ V+Q GY +N R+LRPA+V+++K K+
Sbjct: 167 VMMVMQRGYTLNGRLLRPAMVAVAKSKS 194


>gi|284006728|emb|CBA71985.1| heat shock protein [Arsenophonus nasoniae]
          Length = 206

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 91/146 (62%), Gaps = 8/146 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           R+  LR  AE+EN+RRRT+++ + A  +++ +FA ++L V DNL RA++           
Sbjct: 69  REALLRAKAEVENIRRRTEQDVEKAHKFALERFANELLPVIDNLERAIELV--------D 120

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           K ++ L  ++EG+E+T +  ++T+ +YG+K +  K+  FNP +HQAM          N +
Sbjct: 121 KEQAELIPMLEGLELTLKSFLATVGKYGIKVVAEKNVPFNPELHQAMTMIDSKEHEPNQV 180

Query: 164 IKVVQDGYAINERVLRPALVSISKGK 189
           I V+Q GY +N R+LRPA+V +SK K
Sbjct: 181 IDVMQKGYTLNGRLLRPAMVIVSKAK 206


>gi|152984079|ref|YP_001350804.1| heat shock protein GrpE [Pseudomonas aeruginosa PA7]
 gi|254799606|sp|A6VCL9|GRPE_PSEA7 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|150959237|gb|ABR81262.1| heat shock protein GrpE [Pseudomonas aeruginosa PA7]
          Length = 189

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 95/150 (63%), Gaps = 8/150 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D+ LR++A+++N+RRR +++ + A  +++ KFA D+L+V D L R L      ++N + 
Sbjct: 41  QDQSLRLVADLQNVRRRAEQDVEKAHKFALEKFAGDLLAVVDTLERGLQ-----MSNPDD 95

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           ++   ++ + EG+E+T +    TL RY V+ I+ + + FNP  HQAM  E   T    ++
Sbjct: 96  EA---IRPMREGMELTLKMFDDTLRRYQVEAINPEGEPFNPEQHQAMVMEESATAEPGSV 152

Query: 164 IKVVQDGYAINERVLRPALVSISKGKTQNP 193
           +KV Q GY I+ R+LRPA+V +SK  ++ P
Sbjct: 153 LKVFQKGYLISGRLLRPAMVVVSKAPSETP 182


>gi|312173265|emb|CBX81520.1| Protein grpE (HSP-70 cofactor) [Erwinia amylovora ATCC BAA-2158]
          Length = 194

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/148 (37%), Positives = 94/148 (63%), Gaps = 8/148 (5%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            RD  LR  AE+EN+RRR + + + A  +++ KF+ ++L V D+L RAL+ A  D +N E
Sbjct: 55  VRDAQLRAQAEIENIRRRAELDVEKAHKFALEKFSNELLPVIDSLERALEVA--DKSNPE 112

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
                 L ++IEGIE+T + ++  + ++GV+ +   +  FNP +HQAM     + V  N 
Sbjct: 113 ------LAAMIEGIELTMKSLLGAVRKFGVEVVGDTNVPFNPEVHQAMSMMESEEVEPNH 166

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ V+Q GY +N R+LRPA+V+++K K+
Sbjct: 167 VMMVMQRGYTLNGRLLRPAMVAVAKSKS 194


>gi|157148126|ref|YP_001455445.1| heat shock protein GrpE [Citrobacter koseri ATCC BAA-895]
 gi|157085331|gb|ABV15009.1| hypothetical protein CKO_03936 [Citrobacter koseri ATCC BAA-895]
          Length = 251

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 93/148 (62%), Gaps = 10/148 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LR+ AEMENLRRRT+ + + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 113 RDSVLRIKAEMENLRRRTELDVEKAHKFALEKFVNELLPVIDSLDRALEVA--DKANPD- 169

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                + S++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+   E  D  P N 
Sbjct: 170 -----MASMVEGIELTLKSMLDVVRKFGVEVIADTNVPLDPNVHQAIAMVESEDVTPGN- 223

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ ++Q GY +N R +R A+V+++K K 
Sbjct: 224 VLGIMQKGYTLNGRTIRAAMVTVAKAKA 251


>gi|302185416|ref|ZP_07262089.1| heat shock protein GrpE [Pseudomonas syringae pv. syringae 642]
          Length = 187

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 63/167 (37%), Positives = 102/167 (61%), Gaps = 13/167 (7%)

Query: 25  EEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVS 84
           E  + + + EE L  ++   D+ LRV A+++N+RRR +++ + A  +++ KFA D+L + 
Sbjct: 23  ELTTRVQVLEEQLAAAQ---DQSLRVAADLQNVRRRAEQDVEKAHKFALEKFAGDLLPII 79

Query: 85  DNLSRALD-SAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFN 143
           D+L R LD S+P D        ES+ + + EGIE+T +    TL+RY ++ ID   Q F+
Sbjct: 80  DSLERGLDLSSPDD--------ESI-RPMREGIELTLKMFQDTLKRYQLEAIDPHGQPFS 130

Query: 144 PNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
            + HQAM  +    V  NT++KV Q GY +N R+LRPA+V +SK  +
Sbjct: 131 ADQHQAMAMQESADVEPNTVLKVFQKGYQLNGRLLRPAMVVVSKAPS 177


>gi|167855751|ref|ZP_02478506.1| ATP-dependent RNA helicase HrpA [Haemophilus parasuis 29755]
 gi|219871765|ref|YP_002476140.1| heat shock protein GrpE [Haemophilus parasuis SH0165]
 gi|254799594|sp|B8F790|GRPE_HAEPS RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|167853148|gb|EDS24407.1| ATP-dependent RNA helicase HrpA [Haemophilus parasuis 29755]
 gi|219691969|gb|ACL33192.1| heat shock protein (HSP-70 cofactor) [Haemophilus parasuis SH0165]
          Length = 199

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 90/143 (62%), Gaps = 11/143 (7%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+EN+RRR +++ + A  +++ KF+++ML+V DNL R L +          
Sbjct: 67  QDIQLRARAEVENIRRRAEQDVEKAHKFALEKFSKEMLTVVDNLERGLQAL--------- 117

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
             E V +S+  G+E+T + ++STL  +GV+ +    + FNP +HQA+  +P + + AN I
Sbjct: 118 --EGVDESVKSGVELTHKGLVSTLNNFGVEAVGVVGEAFNPELHQAISMQPAEGIEANHI 175

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
             V+Q GY ++ RV+RPA+V ++
Sbjct: 176 SVVLQKGYTLHGRVIRPAMVMVA 198


>gi|322705210|gb|EFY96797.1| mitochondrial co-chaperone GrpE [Metarhizium anisopliae ARSEF 23]
          Length = 241

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 93/149 (62%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           ++ +++DK +R +A+  NL+ RT RE K A+ ++I KFA+D++   DNL RAL   P + 
Sbjct: 91  EARDWKDKCMRTVADFRNLQDRTQREVKTAREFAIQKFAKDLVESVDNLDRALTMVPSEK 150

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
             ++ ++   L +L +G++MT   +M TL ++G+++++ + +KFNPN H+A F  P    
Sbjct: 151 LVAKDEASQDLVNLYDGLKMTENILMQTLAKHGLERLNPEGEKFNPNEHEATFMAPQPDK 210

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISK 187
             N +  V Q G+ +N RVLR A V + K
Sbjct: 211 DNNHVFHVQQKGFKLNGRVLRAAKVGVVK 239


>gi|146308640|ref|YP_001189105.1| GrpE protein [Pseudomonas mendocina ymp]
 gi|166215279|sp|A4XYF7|GRPE_PSEMY RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|145576841|gb|ABP86373.1| GrpE protein [Pseudomonas mendocina ymp]
          Length = 189

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 110/189 (58%), Gaps = 12/189 (6%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLN-QSEEFRDKYLRVIAEMENLRRRTDREK 65
           E+N+D  +NP    +  A    ++    ++L  Q    +D+ LR+ AE++N+RRR +++ 
Sbjct: 4   EQNLDT-QNPEAQAAENAAPSDDLAARVQALEEQLAAAQDQSLRMAAELQNVRRRAEQDV 62

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALD-SAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
           + A  +++ KFA D+L V D+L R L+ S+P D A         +K + EG+++T +  +
Sbjct: 63  EKAHKFALEKFANDLLPVVDSLERGLELSSPDDEA---------IKGVREGMQLTLKLFI 113

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
            TL R+ ++ ++   + FNP  HQAM  E    V  N+++KV Q GY +N R+LRPA+V 
Sbjct: 114 DTLARHQLEAVEPHGEPFNPEHHQAMAMEESTHVEPNSVLKVFQKGYLLNGRLLRPAMVV 173

Query: 185 ISKGKTQNP 193
           +SK  T  P
Sbjct: 174 VSKAPTTPP 182


>gi|317491005|ref|ZP_07949441.1| GrpE protein [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316920552|gb|EFV41875.1| GrpE protein [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 195

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 91/147 (61%), Gaps = 8/147 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  +R  AE +N+RRR +++ + A  +++ KF+ ++L V D+L RALD A         
Sbjct: 57  RDSVMRARAEADNIRRRAEQDVEKAHKFALEKFSNELLPVIDSLERALDLA--------D 108

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           KS   L ++IEGIE+T + M+  + ++GV+++   +  FNP +HQAM     D    N +
Sbjct: 109 KSNPDLAAMIEGIELTLKSMLDAVRKFGVEQVGEVNVPFNPEVHQAMTMMESDQHEPNQV 168

Query: 164 IKVVQDGYAINERVLRPALVSISKGKT 190
           + V+Q GY +N R++RPA+V++SK K 
Sbjct: 169 MMVMQKGYTLNGRLIRPAMVAVSKAKA 195


>gi|66047423|ref|YP_237264.1| heat shock protein GrpE [Pseudomonas syringae pv. syringae B728a]
 gi|289676008|ref|ZP_06496898.1| heat shock protein GrpE [Pseudomonas syringae pv. syringae FF5]
 gi|81307931|sp|Q4ZNP6|GRPE_PSEU2 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|63258130|gb|AAY39226.1| GrpE protein [Pseudomonas syringae pv. syringae B728a]
 gi|330895321|gb|EGH27659.1| heat shock protein GrpE [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330969635|gb|EGH69701.1| heat shock protein GrpE [Pseudomonas syringae pv. aceris str.
           M302273PT]
 gi|330981073|gb|EGH79176.1| heat shock protein GrpE [Pseudomonas syringae pv. aptata str. DSM
           50252]
          Length = 187

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 63/167 (37%), Positives = 102/167 (61%), Gaps = 13/167 (7%)

Query: 25  EEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVS 84
           E  + + + EE L  ++   D+ LRV A+++N+RRR +++ + A  +++ KFA D+L + 
Sbjct: 23  ELTTRVQVLEEQLAAAQ---DQSLRVAADLQNVRRRAEQDVEKAHKFALEKFAGDLLPII 79

Query: 85  DNLSRALD-SAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFN 143
           D+L R LD S+P D        ES+ + + EGIE+T +    TL+RY ++ ID   Q F+
Sbjct: 80  DSLERGLDLSSPDD--------ESI-RPMREGIELTLKMFQDTLKRYQLEAIDPHGQPFS 130

Query: 144 PNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
            + HQAM  +    V  NT++KV Q GY +N R+LRPA+V +SK  +
Sbjct: 131 ADQHQAMAMQESADVEPNTVLKVFQKGYQLNGRLLRPAMVVVSKAPS 177


>gi|310764831|gb|ADP09781.1| heat shock protein GrpE [Erwinia sp. Ejp617]
          Length = 176

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 56/148 (37%), Positives = 94/148 (63%), Gaps = 8/148 (5%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            RD  LR  AE+EN+RRR + + + A  +++ KF+ ++L V D+L RAL+ A  D +N E
Sbjct: 37  VRDAQLRAQAEIENIRRRAELDVEKAHKFALEKFSNELLPVIDSLERALEVA--DKSNPE 94

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
                 L ++IEGIE+T + ++  + ++GV+ +   +  FNP +HQAM     + V  N 
Sbjct: 95  ------LAAMIEGIELTMKSLLGAVRKFGVEVVGDTNVPFNPELHQAMSMMESEEVEPNH 148

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ V+Q GY +N R+LRPA+V+++K K+
Sbjct: 149 VMMVMQRGYTLNGRLLRPAMVAVAKSKS 176


>gi|11344585|dbj|BAB18515.1| GrpE [Aphis gossypii]
          Length = 222

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 106/182 (58%), Gaps = 13/182 (7%)

Query: 18  NANSSTAEEKSEINIP------EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
           NA     E K +I+I       E+ L +++   DK  R +AE EN+R+RT +E  DA+ Y
Sbjct: 46  NAKEPLKESKEKIDIEALVKQNEDLLEENKNLTDKVRRYLAETENIRKRTIKETADAKIY 105

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSES--VLKSLIEGIEMTRREMMSTLER 129
           +I  F +D+L V+D+LS+A +  P      E+ S+S   LK L EG+  T  ++ +  +R
Sbjct: 106 AIQGFCKDLLDVADSLSKATECVP-----KEEVSDSNPHLKHLYEGLVTTESQLQTIFQR 160

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
           +G+  I+  ++KF+PN H+A+FE+  +      ++ V Q GY +++R++R A V ISK  
Sbjct: 161 HGLMSINPLNEKFDPNSHKALFEQVVEGKEGGIVVVVSQIGYKLHDRIVRAAAVGISKDP 220

Query: 190 TQ 191
            Q
Sbjct: 221 NQ 222


>gi|330950324|gb|EGH50584.1| heat shock protein GrpE [Pseudomonas syringae Cit 7]
          Length = 187

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 63/167 (37%), Positives = 102/167 (61%), Gaps = 13/167 (7%)

Query: 25  EEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVS 84
           E  + + + EE L  ++   D+ LRV A+++N+RRR +++ + A  +++ KFA D+L + 
Sbjct: 23  ELTTRVQVLEEQLAAAQ---DQSLRVAADLQNVRRRAEQDVEKAHKFALEKFAGDLLPII 79

Query: 85  DNLSRALD-SAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFN 143
           D+L R LD S+P D        ES+ + + EGIE+T +    TL+RY ++ ID   Q F+
Sbjct: 80  DSLERGLDLSSPDD--------ESI-RPMREGIELTLKMFQDTLKRYQLEAIDPHGQPFS 130

Query: 144 PNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
            + HQAM  +    V  NT++KV Q GY +N R+LRPA+V +SK  +
Sbjct: 131 ADQHQAMAMQESADVEPNTVLKVFQKGYQLNGRLLRPAMVVVSKAPS 177


>gi|302037064|ref|YP_003797386.1| chaperone protein GrpE [Candidatus Nitrospira defluvii]
 gi|300605128|emb|CBK41461.1| Chaperone protein GrpE [Candidatus Nitrospira defluvii]
          Length = 184

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 62/190 (32%), Positives = 109/190 (57%), Gaps = 15/190 (7%)

Query: 5   MSEKN-----IDKEKNPSNANSSTAEEKSEIN-IPEESLNQSEEFRDKYLRVIAEMENLR 58
           MSE N     ID     S A+S T E  +E+  + +   ++ +   +KYLR+ AE +N +
Sbjct: 1   MSEDNKNIHSIDNLDGSSEASSGTMEGVNELQQVLDAKSDECKALNEKYLRLAAEFDNYK 60

Query: 59  RRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEM 118
           R   R++++   +   +  +++L V DNL RA+ S+        K S SV  +L EG+E+
Sbjct: 61  RLAQRDQREQIKFGNEQILKELLPVVDNLERAIKSS--------KGSGSV-DALTEGVEL 111

Query: 119 TRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVL 178
           T ++++  L ++GVK +D+    F+P   QA+ + P DT+P N +++  Q GY + +R+L
Sbjct: 112 TLKQLVGALTKFGVKAVDSVGLAFDPATQQAVAQVPSDTIPENHVVEEYQKGYLLQDRIL 171

Query: 179 RPALVSISKG 188
           R A+V++S G
Sbjct: 172 RAAMVTVSTG 181


>gi|294011055|ref|YP_003544515.1| molecular chaperone GrpE [Sphingobium japonicum UT26S]
 gi|292674385|dbj|BAI95903.1| molecular chaperone GrpE [Sphingobium japonicum UT26S]
          Length = 184

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 91/150 (60%), Gaps = 5/150 (3%)

Query: 38  NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD 97
           N+    R   L   AE +N+RRR ++E  DA++Y+   FARDMLSV+DNL RAL + P D
Sbjct: 37  NELATARQDVLYAHAETQNVRRRLEKELADARAYAATAFARDMLSVADNLGRALQAIPAD 96

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
           L   EK      K L+ G+E T RE+ +   R G++K+ +  Q  +PN HQAM E P   
Sbjct: 97  LREDEK-----FKGLVAGLEATGRELEAVFGRNGIEKLVSVGQPLDPNKHQAMMEVPSAD 151

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISK 187
               T++  +Q GY I +R+LRPALVS++K
Sbjct: 152 AEPGTVLVEMQAGYTIKDRLLRPALVSVAK 181


>gi|21554173|gb|AAM63252.1| chaperone GrpE-like protein [Arabidopsis thaliana]
          Length = 302

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 91/150 (60%), Gaps = 5/150 (3%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS-----APL 96
           E +DK+LR  AE +NL  RT+R  + A+ +++  FA  +L V+DNL RA        + +
Sbjct: 139 EMKDKFLRTYAEQQNLMDRTNRNAESAKKFAVQNFATSLLDVADNLERASSVVKESFSKI 198

Query: 97  DLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHD 156
           D +     +  +LK+L+EG+EMT +++     + G+ K D  ++ FNPN H A+F+ P  
Sbjct: 199 DTSKDLAGATPLLKNLLEGVEMTEKQLAEVFRKAGLVKEDPLNEPFNPNRHNAVFQVPDA 258

Query: 157 TVPANTIIKVVQDGYAINERVLRPALVSIS 186
           + P  TI  V++ GY++ +RV+RPA V ++
Sbjct: 259 SKPKGTIAHVLKSGYSLYDRVIRPAEVGVT 288


>gi|260773329|ref|ZP_05882245.1| heat shock protein GrpE [Vibrio metschnikovii CIP 69.14]
 gi|260612468|gb|EEX37671.1| heat shock protein GrpE [Vibrio metschnikovii CIP 69.14]
          Length = 199

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 55/150 (36%), Positives = 97/150 (64%), Gaps = 10/150 (6%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           +++E  +  LR +A++EN+RRR+++E   A+ Y++ +F  ++L V DN+ RA+D+A  D 
Sbjct: 59  RAKENHEAMLRALADVENMRRRSEQEVDKARKYALGRFVEELLPVLDNIERAIDAA--DC 116

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDT 157
            N       V+K  +EG+E+T +  +  + ++GV  I+ + + FNP  HQAM  +E  D 
Sbjct: 117 ENE------VIKPFLEGVELTHKSFVDAVTKFGVSVINPEGETFNPEFHQAMSIQESADH 170

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISK 187
             +NT++ V+Q GY +N RV+RPA+V ++K
Sbjct: 171 -ASNTVMFVMQKGYELNGRVVRPAMVMVAK 199


>gi|15240475|ref|NP_200331.1| co-chaperone grpE protein, putative [Arabidopsis thaliana]
 gi|9758117|dbj|BAB08589.1| chaperone GrpE-like protein [Arabidopsis thaliana]
 gi|14596129|gb|AAK68792.1| chaperone GrpE-like protein [Arabidopsis thaliana]
 gi|20148445|gb|AAM10113.1| chaperone GrpE-like protein [Arabidopsis thaliana]
 gi|332009216|gb|AED96599.1| co-chaperone GrpE family protein [Arabidopsis thaliana]
          Length = 302

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 91/150 (60%), Gaps = 5/150 (3%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS-----APL 96
           E +DK+LR  AE +NL  RT+R  + A+ +++  FA  +L V+DNL RA        + +
Sbjct: 139 EMKDKFLRTYAEQQNLMDRTNRNAESAKKFAVQNFATSLLDVADNLERASSVVKESFSKI 198

Query: 97  DLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHD 156
           D +     +  +LK+L+EG+EMT +++     + G+ K D  ++ FNPN H A+F+ P  
Sbjct: 199 DTSKDLAGATPLLKNLLEGVEMTEKQLAEVFRKAGLVKEDPLNEPFNPNRHNAVFQVPDA 258

Query: 157 TVPANTIIKVVQDGYAINERVLRPALVSIS 186
           + P  TI  V++ GY++ +RV+RPA V ++
Sbjct: 259 SKPKGTIAHVLKSGYSLYDRVIRPAEVGVT 288


>gi|300724104|ref|YP_003713421.1| Hsp 24 nucleotide exchange factor [Xenorhabdus nematophila ATCC
           19061]
 gi|297630638|emb|CBJ91303.1| Hsp 24 nucleotide exchange factor [Xenorhabdus nematophila ATCC
           19061]
          Length = 193

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 99/155 (63%), Gaps = 9/155 (5%)

Query: 34  EESLNQSE-EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALD 92
           EE L Q++   RD  LR  AE+EN+RRR +++ + A  +++ KFA ++L V DNL RAL+
Sbjct: 47  EEQLKQAQINERDAMLRARAEVENIRRRVEQDVEKAHKFALEKFANELLPVIDNLERALE 106

Query: 93  SAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFE 152
           +A       ++ +ES L+ +IEGIE+T +  +  + ++G++ +   +  FNP +HQAM  
Sbjct: 107 AA-------DRTNES-LQPMIEGIELTLKSFIGAVAKFGIEVVGDTNVPFNPEVHQAMTM 158

Query: 153 EPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
              +    N ++ V+Q GY +N R+LRPA+V++SK
Sbjct: 159 MESEQHEPNHVMLVMQKGYTLNGRLLRPAMVAVSK 193


>gi|254446976|ref|ZP_05060443.1| co-chaperone GrpE [gamma proteobacterium HTCC5015]
 gi|198263115|gb|EDY87393.1| co-chaperone GrpE [gamma proteobacterium HTCC5015]
          Length = 198

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 104/174 (59%), Gaps = 10/174 (5%)

Query: 17  SNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKF 76
           ++A S+   E   +   EE+  ++EE  D  LR  AEMENL+RRT+++   A+ +++ K 
Sbjct: 34  ASAESAVEAEAPTVEALEEAQKKAEENYDLALRTKAEMENLKRRTEKDIDSARKFALEKI 93

Query: 77  ARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID 136
           A ++L V D++   LD+A  D  +        +  L EG E+T + + S +E++ ++ +D
Sbjct: 94  ANELLGVRDSMEMGLDAAQSDDVD--------IAKLREGSELTLKMLSSLMEKFNIEPVD 145

Query: 137 AKDQKFNPNMHQAM-FEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
              +KFNP+ HQAM   E  +  P NT+I V+Q GY +N R+LRPALV ++K +
Sbjct: 146 PTGEKFNPDFHQAMQMIESEEHEP-NTVINVLQKGYTLNGRLLRPALVMVAKAQ 198


>gi|322694889|gb|EFY86707.1| mitochondrial co-chaperone GrpE [Metarhizium acridum CQMa 102]
          Length = 241

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 93/149 (62%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           ++ +++DK +R +A+  NL+ RT RE K A+ ++I KFA+D++   DNL RAL   P + 
Sbjct: 91  EARDWKDKCMRAVADFRNLQDRTQREVKTAREFAIQKFAKDLVESVDNLDRALTMVPSEK 150

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
             ++ ++   L +L +G++MT   +M TL ++G+++++ + +KFNPN H+A F  P    
Sbjct: 151 LAAKDEACQDLINLYDGLKMTENILMQTLAKHGLERLNPEGEKFNPNEHEATFMAPQPDK 210

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISK 187
             N +  V Q G+ +N RVLR A V + K
Sbjct: 211 ENNLVFHVQQKGFKLNGRVLRAAKVGVVK 239


>gi|148549796|ref|YP_001269898.1| heat shock protein GrpE [Pseudomonas putida F1]
 gi|166215280|sp|A5W9A4|GRPE_PSEP1 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|148513854|gb|ABQ80714.1| GrpE protein [Pseudomonas putida F1]
          Length = 185

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 55/145 (37%), Positives = 91/145 (62%), Gaps = 8/145 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D+ LR +A+++N+RRR +++ + A  +++ KF+ D+L V       +DS  L LA+S  
Sbjct: 37  KDQALRAVADLQNVRRRAEQDVEKAHKFALEKFSSDLLPV-------IDSLELALAHSSA 89

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           + E V K + EG+E+T +    TL+RY ++ +D   Q FNP  HQAM  + +  V  N++
Sbjct: 90  EDEHV-KQIREGVELTLKMFQDTLKRYNLEAVDPHGQPFNPEHHQAMAMQENAEVEPNSV 148

Query: 164 IKVVQDGYAINERVLRPALVSISKG 188
           + V Q GY +N R+LRPA+V +SK 
Sbjct: 149 LNVFQKGYLLNGRLLRPAMVVVSKA 173


>gi|261345457|ref|ZP_05973101.1| co-chaperone GrpE [Providencia rustigianii DSM 4541]
 gi|282566504|gb|EFB72039.1| co-chaperone GrpE [Providencia rustigianii DSM 4541]
          Length = 192

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 93/146 (63%), Gaps = 12/146 (8%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           R+  LR  AE+EN+RRRT+++ + A  +++ KF+ ++L + DNL RA+D+A  D  N E 
Sbjct: 57  REAMLRAHAEIENVRRRTEQDIEKAHKFALEKFSNELLPIIDNLERAIDAA--DHENEES 114

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM--FEEPHDTVPAN 161
           K+      ++EG+ +T +  +  + ++G++ +DA +  FNP +HQAM   E P     A 
Sbjct: 115 KA------MLEGLNLTLKMFLDAVGKFGIEVVDAANVPFNPEVHQAMTMIESPDHQ--AG 166

Query: 162 TIIKVVQDGYAINERVLRPALVSISK 187
            +I V+Q GY +N R+LRPA+V +SK
Sbjct: 167 QVINVMQKGYTLNNRLLRPAMVIVSK 192


>gi|209695893|ref|YP_002263823.1| protein GrpE (heat shock protein) [Aliivibrio salmonicida LFI1238]
 gi|226737103|sp|B6EKA3|GRPE_ALISL RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|208009846|emb|CAQ80157.1| protein GrpE (heat shock protein) [Aliivibrio salmonicida LFI1238]
          Length = 194

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 98/149 (65%), Gaps = 8/149 (5%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           Q +E +D  LR  AE +N+RRR + +   A+ Y++ KFA ++L V DNL RAL+S     
Sbjct: 54  QLKEQQDAVLRAKAEEQNVRRRAEGDIDKARKYALKKFAGELLPVIDNLERALES----- 108

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
              +K++E+  K L+EG+E+T +  +ST+E++G+  I+   + FNP  HQA+  +     
Sbjct: 109 --GDKENEAA-KVLLEGVELTLQTFISTIEKFGLTVINPVGETFNPEHHQAIGMQASPDH 165

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISK 187
            +NT++ V+Q GY++NE+V+RPA+V +++
Sbjct: 166 ESNTVMVVMQKGYSLNEQVIRPAMVMVAQ 194


>gi|302608228|emb|CBW44463.1| heat shock protein [Marinobacter hydrocarbonoclasticus]
          Length = 202

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/180 (31%), Positives = 111/180 (61%), Gaps = 16/180 (8%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           N D E++P        E+ SE+++ ++ L   +E++++ LR  AEM+N+RRR + + + A
Sbjct: 29  NQDAEQSP--------EQGSELDVLQQKL---QEYQEQALRAQAEMQNVRRRAEIDVEKA 77

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
             +++ KF +++L V+D+L +A++S         + +  ++ S+ EG+EMT    M++L+
Sbjct: 78  HKFALEKFVKELLPVADSLEKAVEST-----EGHENAGELVASIREGVEMTLTLFMNSLK 132

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           ++ V++++   + F+P  H+AM   P      NT++ VVQ GY +N RV+RPA+V ++K 
Sbjct: 133 KFNVEQLNPVGEPFDPQQHEAMSMVPAPDAEPNTVVAVVQKGYLLNGRVVRPAMVVVAKA 192


>gi|84684656|ref|ZP_01012557.1| putative chaperone protein GrpE (heat shock protein)
           [Maritimibacter alkaliphilus HTCC2654]
 gi|84667635|gb|EAQ14104.1| putative chaperone protein GrpE (heat shock protein)
           [Rhodobacterales bacterium HTCC2654]
          Length = 199

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 55/149 (36%), Positives = 98/149 (65%), Gaps = 8/149 (5%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           + ++ +DK++R +A+ EN R+R+DR++++A++Y  +K ARDML V DN+ RA+++   DL
Sbjct: 54  ERDQLKDKFMRALADAENARKRSDRDRREAENYGGSKLARDMLPVYDNMKRAMEAIDDDL 113

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDT 157
              EK S      L EG+E+T RE+++   ++G++ +  +   KF+P  H+AMFE P   
Sbjct: 114 --REKAS-----GLTEGLELTMRELLNIFSKHGIRILAPEVGDKFDPIEHEAMFEAPVPG 166

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSIS 186
                II+V+ +G+ +++R+LR A V +S
Sbjct: 167 TNKGEIIQVMAEGFMLHDRLLRAAQVGVS 195


>gi|229592653|ref|YP_002874772.1| heat shock protein GrpE [Pseudomonas fluorescens SBW25]
 gi|259647655|sp|C3K276|GRPE_PSEFS RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|229364519|emb|CAY52374.1| protein GrpE (HSP-70 cofactor) [Pseudomonas fluorescens SBW25]
          Length = 186

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 64/174 (36%), Positives = 109/174 (62%), Gaps = 15/174 (8%)

Query: 18  NANSSTAEE-KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKF 76
           +ANS+  +E  + + + EE L  ++   D+ LRV A+++N+RRR +++ + A  +++ KF
Sbjct: 13  DANSAVGDELATRVQVLEEQLAAAQ---DQSLRVAADLQNVRRRAEQDVEKAHKFALEKF 69

Query: 77  ARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID 136
           A D+L + D+L R      L+L+N + ++   ++ + EGIE+T +    TL+RY ++ ID
Sbjct: 70  ASDLLPIIDSLERG-----LELSNPDDEN---IRPMREGIELTLKMFQDTLKRYQLEAID 121

Query: 137 -AKDQKFNPNMHQAM-FEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
               + FN   HQAM  +E HD  P N+++KV Q GY +N R+LRPA+V +SK 
Sbjct: 122 PVGGEPFNAEHHQAMAMQESHDLEP-NSVLKVFQKGYQLNGRLLRPAMVVVSKA 174


>gi|227356269|ref|ZP_03840657.1| possible chaperone GrpE [Proteus mirabilis ATCC 29906]
 gi|227163379|gb|EEI48300.1| possible chaperone GrpE [Proteus mirabilis ATCC 29906]
          Length = 203

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 60/158 (37%), Positives = 102/158 (64%), Gaps = 15/158 (9%)

Query: 34  EESLNQSEEF-RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALD 92
           E+ L QS++  R+  +R  AE+EN+RRRT ++ + A  +++ KF+ ++L V DNL RAL 
Sbjct: 57  EKQLQQSQKTEREAMIRAQAEIENIRRRTQQDVEKAHKFALEKFSNELLPVLDNLERALS 116

Query: 93  SAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-- 150
           +A  D  N +      +K +IEG+E+T +  +  + ++G++ ++ K+  FNP +HQAM  
Sbjct: 117 AA--DHENEQ------MKPMIEGLELTLKSFLDAVRKFGIEVVEEKNVAFNPEVHQAMTL 168

Query: 151 FEEP-HDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            + P H+   AN ++ V+Q GY +N R+LRPA+V +SK
Sbjct: 169 IDSPEHE---ANHVVDVMQKGYTLNGRLLRPAMVVVSK 203


>gi|324111249|gb|EGC05231.1| GrpE protein [Escherichia fergusonii B253]
          Length = 283

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 93/148 (62%), Gaps = 10/148 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LRV AEMENLRRRT+ + + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 145 RDGILRVKAEMENLRRRTELDIEKAHKFALEKFINELLPVIDSLDRALEVA--DKANPD- 201

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                + +++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+   E  D  P N 
Sbjct: 202 -----MSAMVEGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGN- 255

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ ++Q GY +N R +R A+V+++K K 
Sbjct: 256 VLGIMQKGYTLNGRTIRAAMVTVAKAKA 283


>gi|293603750|ref|ZP_06686168.1| heat shock protein GrpE [Achromobacter piechaudii ATCC 43553]
 gi|292817853|gb|EFF76916.1| heat shock protein GrpE [Achromobacter piechaudii ATCC 43553]
          Length = 185

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 101/166 (60%), Gaps = 16/166 (9%)

Query: 25  EEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVS 84
           E +++++  + ++N   E  D+ LRV AE EN+RRR   E   A+ + I  FA  ++ V 
Sbjct: 34  ELRAQLDAAQATVN---EQHDQLLRVHAEAENVRRRAQEEVSKARKFGIESFAESLVPVK 90

Query: 85  DNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI-DAKDQKFN 143
           D+L  AL            + +  +++L EG+E+T +++ +  ER  +K I  A+  KF+
Sbjct: 91  DSLEAAL-----------AQPDQTVQTLREGVEVTLKQLSAAFERNMLKDIAPAQGDKFD 139

Query: 144 PNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
           P++HQA+   PH+  PANT+++++Q GYAI +R LRPALV +S G+
Sbjct: 140 PHLHQAISSIPHEQ-PANTVVQLLQKGYAIADRTLRPALVVVSAGQ 184


>gi|255307492|ref|ZP_05351663.1| heat shock protein [Clostridium difficile ATCC 43255]
          Length = 212

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 109/180 (60%), Gaps = 20/180 (11%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           EK +D E N ++ NS  AE+K +        ++ +E  DKY R+ AE  N RRRT +EK+
Sbjct: 52  EKEVDDE-NVTDINSKLAEKKLQ--------DELDELNDKYQRLQAEYANYRRRTQQEKE 102

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
               ++  K   +++ V D++ RALD+        E K +++ K    GI +  ++++ T
Sbjct: 103 TIGVFANEKIITELIPVIDSMERALDAC-------EDKEDTMYK----GISLVHKQLIDT 151

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           L ++GV++I+A+ ++F+PN+H A+ +E  D V AN I+ V+Q GY +  +V+RP++V +S
Sbjct: 152 LVKFGVEEIEAESKEFDPNLHLAVMQESVDGVEANQIVMVLQKGYKLGTKVVRPSMVKVS 211


>gi|254460161|ref|ZP_05073577.1| co-chaperone GrpE [Rhodobacterales bacterium HTCC2083]
 gi|206676750|gb|EDZ41237.1| co-chaperone GrpE [Rhodobacteraceae bacterium HTCC2083]
          Length = 189

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 57/147 (38%), Positives = 103/147 (70%), Gaps = 8/147 (5%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           +EF+D+++R +A+ EN R+R+DR++++A++Y  +K ARD+L V DN+ RAL++A      
Sbjct: 46  DEFKDRFMRALADAENSRKRSDRDRREAENYGGSKLARDLLPVYDNMKRALEAA------ 99

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVP 159
           ++++ E V  +LIEG+E+T RE+++   ++G+  +  +   KF+P +HQAMFE P     
Sbjct: 100 TDEQRE-VSSALIEGVELTMRELVNVFGKHGIVPVSPEVGDKFDPKLHQAMFEAPVPGTK 158

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
           A  II++  +G+ +++R+LRPA V +S
Sbjct: 159 AGEIIQIAAEGFMLHDRLLRPAQVGVS 185


>gi|254367842|ref|ZP_04983862.1| chaperone protein grpE (heat shock protein family 70 cofactor)
           [Francisella tularensis subsp. holarctica 257]
 gi|134253652|gb|EBA52746.1| chaperone protein grpE (heat shock protein family 70 cofactor)
           [Francisella tularensis subsp. holarctica 257]
          Length = 195

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 58/150 (38%), Positives = 95/150 (63%), Gaps = 9/150 (6%)

Query: 38  NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD 97
           +  ++F+D+ LR  AEMEN+R+R +R+  +A+ Y I KFA+++L V D++ +AL      
Sbjct: 54  DSCDQFKDEALRAKAEMENIRKRAERDVSNARKYGIEKFAKELLPVIDSIEQAL------ 107

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
               E K E  + ++ EGIE+T + ++  L++ GV+++D K +KF+PN+H+AM   P+  
Sbjct: 108 --KHEVKLEEAI-AMKEGIELTAKMLVDILKKNGVEELDPKGEKFDPNLHEAMAMIPNPE 164

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISK 187
              NTI  V Q GY +N R++R A V I K
Sbjct: 165 FEDNTIFDVFQKGYMLNGRIVRAAKVVIVK 194


>gi|87120232|ref|ZP_01076127.1| heat shock protein GrpE [Marinomonas sp. MED121]
 gi|86164335|gb|EAQ65605.1| heat shock protein GrpE [Marinomonas sp. MED121]
          Length = 185

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 54/151 (35%), Positives = 94/151 (62%), Gaps = 11/151 (7%)

Query: 36  SLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAP 95
           +L + EE+++  LR  A+ +N+RRR +++ + A  + + KFA+D+++V+DNL RAL SA 
Sbjct: 43  ALAKVEEYKEAALRSHADAQNVRRRAEQDVQKAHKFGLEKFAKDIITVADNLERALTSA- 101

Query: 96  LDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPH 155
                     +S   ++ EG+E+T + +  TL R+ V  +D   + FNP  HQAM   P+
Sbjct: 102 ----------DSDNDAMREGVELTLKSLQETLTRFEVIALDPHGEPFNPEFHQAMTMVPN 151

Query: 156 DTVPANTIIKVVQDGYAINERVLRPALVSIS 186
             +  NT++ V+Q GY ++ R++RPA+V +S
Sbjct: 152 PEMEPNTVMDVIQKGYTLHGRLIRPAMVVVS 182


>gi|126700079|ref|YP_001088976.1| heat shock protein [Clostridium difficile 630]
 gi|254976057|ref|ZP_05272529.1| heat shock protein [Clostridium difficile QCD-66c26]
 gi|255101623|ref|ZP_05330600.1| heat shock protein [Clostridium difficile QCD-63q42]
 gi|255315190|ref|ZP_05356773.1| heat shock protein [Clostridium difficile QCD-76w55]
 gi|255517859|ref|ZP_05385535.1| heat shock protein [Clostridium difficile QCD-97b34]
 gi|255650975|ref|ZP_05397877.1| heat shock protein [Clostridium difficile QCD-37x79]
 gi|260684043|ref|YP_003215328.1| heat shock protein [Clostridium difficile CD196]
 gi|260687703|ref|YP_003218837.1| heat shock protein [Clostridium difficile R20291]
 gi|123363006|sp|Q182F1|GRPE_CLOD6 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|115251516|emb|CAJ69349.1| Protein grpE (HSP-70 cofactor) [Clostridium difficile]
 gi|260210206|emb|CBA64424.1| heat shock protein [Clostridium difficile CD196]
 gi|260213720|emb|CBE05613.1| heat shock protein [Clostridium difficile R20291]
          Length = 206

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 109/180 (60%), Gaps = 20/180 (11%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           EK +D E N ++ NS  AE+K +        ++ +E  DKY R+ AE  N RRRT +EK+
Sbjct: 46  EKEVDDE-NVTDINSKLAEKKLQ--------DELDELNDKYQRLQAEYANYRRRTQQEKE 96

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
               ++  K   +++ V D++ RALD+        E K +++ K    GI +  ++++ T
Sbjct: 97  TIGVFANEKIITELIPVIDSMERALDAC-------EDKEDTMYK----GISLVHKQLIDT 145

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           L ++GV++I+A+ ++F+PN+H A+ +E  D V AN I+ V+Q GY +  +V+RP++V +S
Sbjct: 146 LVKFGVEEIEAESKEFDPNLHLAVMQESVDGVEANQIVMVLQKGYKLGTKVVRPSMVKVS 205


>gi|90022379|ref|YP_528206.1| heat shock protein GrpE [Saccharophagus degradans 2-40]
 gi|123090257|sp|Q21H35|GRPE_SACD2 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|89951979|gb|ABD81994.1| GrpE protein [Saccharophagus degradans 2-40]
          Length = 194

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 63/172 (36%), Positives = 104/172 (60%), Gaps = 15/172 (8%)

Query: 19  ANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFAR 78
           A+   A  ++EI    E L  ++E     LR  AE +N RRR +++ + A  + + KF  
Sbjct: 36  ASDDVAALQAEIARLNEELQTTKE---NALRAAAEAQNARRRAEQDVEKAHKFGLEKFVG 92

Query: 79  DMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
           D+L V+DNL RA+D+A  + A+        L  ++EG+E+T + ++  L+R+ V++ID +
Sbjct: 93  DILPVADNLERAIDAAKAEGAD--------LGVVVEGVELTLKTLVDGLKRHKVEQIDPQ 144

Query: 139 DQKFNPNMHQA--MFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
            + F+P +HQA  M E+P D  P NT+I V Q GY ++ R++RPA+V +SK 
Sbjct: 145 GEPFDPQLHQAMTMIEQP-DVEP-NTVINVFQRGYTLHGRLVRPAMVVVSKA 194


>gi|262395062|ref|YP_003286916.1| heat shock protein GrpE [Vibrio sp. Ex25]
 gi|262338656|gb|ACY52451.1| heat shock protein GrpE [Vibrio sp. Ex25]
          Length = 198

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 94/144 (65%), Gaps = 8/144 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+EN+RRRT++E   A+ +++ KFA ++L V DNL RA+ +A       + 
Sbjct: 63  QDAVLRSKAEVENMRRRTEQEIDKARKFALNKFAEELLPVIDNLERAIQAA-------DT 115

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           ++E+V K  +EG+E+T +  +  + ++G+K I+ + + FNP  HQAM  +      +NT+
Sbjct: 116 ENETV-KPFLEGVELTHKTFVDVVAKFGLKAINPEGEAFNPEFHQAMSIQESPDHESNTV 174

Query: 164 IKVVQDGYAINERVLRPALVSISK 187
           + V+Q GY +N RV+RPA+V ++K
Sbjct: 175 MFVMQKGYELNGRVIRPAMVMVAK 198


>gi|322788377|gb|EFZ14048.1| hypothetical protein SINV_00910 [Solenopsis invicta]
          Length = 235

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 63/191 (32%), Positives = 109/191 (57%), Gaps = 15/191 (7%)

Query: 10  IDKEKNPSNANSSTAEE--------KSEINIPEESLNQSEE----FRDKYLRVIAEMENL 57
           I +EK P + N     E        K+E+ +  + L + +E      DKY R +AE EN+
Sbjct: 48  ITEEKKPDSTNVPPMSEATENEKKLKTELELINKELAELKESKDTLEDKYKRALAEGENI 107

Query: 58  RRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIE 117
           R R  ++  DA+ + I  F +D+L V+D L +A +S P D   +E+     LK L EG+ 
Sbjct: 108 RVRLTKQINDAKLFGIQGFCKDLLDVADVLGKATESVPKD-EITERNPH--LKGLYEGLV 164

Query: 118 MTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERV 177
           MT  ++    +++G+  ++  ++KF+PN H+A+F++  +     TI+ V + GY ++ER+
Sbjct: 165 MTEAQLHKVFKKHGLVSLNPVNEKFDPNEHEALFQQEVEGKEPGTIVVVSKVGYKLHERI 224

Query: 178 LRPALVSISKG 188
           +RPALV ++KG
Sbjct: 225 VRPALVGVAKG 235


>gi|255321426|ref|ZP_05362586.1| co-chaperone GrpE [Campylobacter showae RM3277]
 gi|255301579|gb|EET80836.1| co-chaperone GrpE [Campylobacter showae RM3277]
          Length = 175

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 65/172 (37%), Positives = 96/172 (55%), Gaps = 10/172 (5%)

Query: 16  PSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAK 75
           PSN + S + E  +    E    Q EE  DKY R  A+ EN+++R ++EK D  +Y+  K
Sbjct: 14  PSNFDESISFEGLDAKYVELQ-KQLEELTDKYYRANADFENIKKRFEKEKADIATYANEK 72

Query: 76  FARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI 135
           FARD+L V D L  A+        N E + +     + EGI +T  +     E+ G+  I
Sbjct: 73  FARDLLPVIDALEMAV--------NFETEGDEYAAKIKEGIYITIDQFKKCFEKNGITAI 124

Query: 136 DAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +A ++ F+PN H AM +   + V    I++V+Q GY IN RVLRPA+VSI+K
Sbjct: 125 EA-NEDFDPNFHNAMLQVESEDVEKGKIVQVIQKGYLINGRVLRPAMVSIAK 175


>gi|254583852|ref|XP_002497494.1| ZYRO0F06820p [Zygosaccharomyces rouxii]
 gi|238940387|emb|CAR28561.1| ZYRO0F06820p [Zygosaccharomyces rouxii]
          Length = 217

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 93/151 (61%), Gaps = 4/151 (2%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           ++ E++D+ +R +A+  NL+  T ++ + A+ +++ KFA+D+L   DN   AL++   D 
Sbjct: 70  EAAEYKDRLVRCVADFRNLQEVTKKDVQKAKDFALQKFAKDLLESVDNFGHALNA--FDA 127

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
           A+S+  SE  +K L  G++MTR     TL +YG++KI+   Q+F+PN H+A FE      
Sbjct: 128 ADSKHSSE--VKELYTGVKMTRDVFEKTLYKYGIEKIEPLGQQFDPNQHEATFELDQPDK 185

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISKGK 189
              T+  V Q G+++N RV+RPA V I K +
Sbjct: 186 EPGTVFFVQQVGFSLNSRVIRPAKVGIVKAR 216


>gi|319778394|ref|YP_004129307.1| Heat shock protein GrpE [Taylorella equigenitalis MCE9]
 gi|317108418|gb|ADU91164.1| Heat shock protein GrpE [Taylorella equigenitalis MCE9]
          Length = 194

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 67/183 (36%), Positives = 108/183 (59%), Gaps = 12/183 (6%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           E  ID E    +  +S AEE+    +  E   Q  + +D+ LR +AE+EN+RRR++ E  
Sbjct: 23  EVGIDVEGAVEDGVASYAEEEDSDKLISELQEQVLQMQDQSLRAMAEVENIRRRSNEEIS 82

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
            A+ Y++  FA  +L V D+L  AL        NSE +S   L+SL EG+++T +++   
Sbjct: 83  KARRYALEGFASALLPVRDSLEAAL--------NSENQS---LESLKEGMDLTYKQLTQA 131

Query: 127 LERYGVKKIDAKD-QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
           LER  + +I   +  KF+PN+HQA+   P+  +  + I++V+Q GY + +RV+RPALV +
Sbjct: 132 LERNNLTEIQPNEGDKFDPNVHQAISSVPNADITKDGIVQVLQKGYKLADRVVRPALVIV 191

Query: 186 SKG 188
           S G
Sbjct: 192 SAG 194


>gi|3851640|gb|AAC72387.1| chaperone GrpE type 2 [Nicotiana tabacum]
          Length = 304

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 51/151 (33%), Positives = 92/151 (60%), Gaps = 5/151 (3%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS-----AP 95
           ++ +DK LR  AEMEN+  RT RE ++++ ++I  F + +L VSDNL RA        + 
Sbjct: 140 QKMQDKVLRTYAEMENVMNRTKREAENSKKFAIQNFVKALLDVSDNLGRASSVVKESFSK 199

Query: 96  LDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPH 155
           +D +     +  +LK+L+EG+EMT +++    +++GV K D  +++F+PN H A+F+ P 
Sbjct: 200 IDESKDTAGAVPLLKTLLEGVEMTDKQLAEVFKKFGVGKYDPTNEQFDPNKHNAIFQVPD 259

Query: 156 DTVPANTIIKVVQDGYAINERVLRPALVSIS 186
                  +   ++ GY ++ER++RPA V ++
Sbjct: 260 PKKAPGVVAVCLKSGYTLHERIIRPAEVGVT 290


>gi|183599793|ref|ZP_02961286.1| hypothetical protein PROSTU_03301 [Providencia stuartii ATCC 25827]
 gi|188022057|gb|EDU60097.1| hypothetical protein PROSTU_03301 [Providencia stuartii ATCC 25827]
          Length = 196

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 61/157 (38%), Positives = 103/157 (65%), Gaps = 13/157 (8%)

Query: 34  EESLNQSEEF-RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALD 92
           EE L  S++  R+  LR  AE+EN+RRRT+++ + A  +++ KF+ ++L V DNL RA+D
Sbjct: 50  EEQLAASQKVEREAMLRAHAEIENIRRRTEQDIEKAHKFALEKFSNELLPVIDNLERAID 109

Query: 93  SAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-- 150
           +A       + +SE+  K+++EG+++T +  +S + ++G++ +   +  FNP +HQAM  
Sbjct: 110 AA-------DHESETS-KAMLEGLDLTLKTFLSAVGKFGIEVVGESNVAFNPEVHQAMTM 161

Query: 151 FEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            E P D  P N +I V+Q GY +N R+LRPA+V +SK
Sbjct: 162 VESP-DHQP-NQVIDVMQKGYLLNGRLLRPAMVIVSK 196


>gi|187931761|ref|YP_001891746.1| chaperone GrpE (heat shock protein). Hsp70/Hsc70 protein regulator
           activity [Francisella tularensis subsp. mediasiatica
           FSC147]
 gi|226737136|sp|B2SGV9|GRPE_FRATM RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|187712670|gb|ACD30967.1| chaperone GrpE (heat shock protein). Hsp70/Hsc70 protein regulator
           activity [Francisella tularensis subsp. mediasiatica
           FSC147]
          Length = 195

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 95/150 (63%), Gaps = 9/150 (6%)

Query: 38  NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD 97
           +  ++F+D+ LR  AEMEN+R+R +R+  +A+ + I KFA+++L V D++ +AL      
Sbjct: 54  DSCDQFKDEALRAKAEMENIRKRAERDVSNARKFGIEKFAKELLPVIDSIGQAL------ 107

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
               E K E  + ++ EGIE+T + ++  L++ GV+++D K +KF+PN+H+AM   P+  
Sbjct: 108 --KHEVKHEEAI-AMKEGIELTAKMLVDILKKNGVEELDPKGEKFDPNLHEAMAMIPNPE 164

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISK 187
              NTI  V Q GY +N R++R A V I K
Sbjct: 165 FEDNTIFDVFQKGYMLNGRIVRAAKVVIVK 194


>gi|325276145|ref|ZP_08141952.1| heat shock protein GrpE [Pseudomonas sp. TJI-51]
 gi|324098721|gb|EGB96760.1| heat shock protein GrpE [Pseudomonas sp. TJI-51]
          Length = 185

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 55/145 (37%), Positives = 91/145 (62%), Gaps = 8/145 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D+ LR +A+++N+RRR +++ + A  +++ KF+ D+L V       +DS  L LA+S  
Sbjct: 37  KDQSLRAVADLQNVRRRAEQDVEKAHKFALEKFSSDLLPV-------IDSLELALAHSSA 89

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           + E+V K + EG+E+T +    TL+RY ++ +D   Q FNP  HQAM  +    V  N++
Sbjct: 90  EDENV-KQIREGVELTLKMFQDTLKRYNLEAVDPHGQPFNPEHHQAMAMQESADVEPNSV 148

Query: 164 IKVVQDGYAINERVLRPALVSISKG 188
           + V Q GY +N R+LRPA+V +SK 
Sbjct: 149 LNVFQKGYLLNGRLLRPAMVVVSKA 173


>gi|170681212|ref|YP_001744797.1| heat shock protein GrpE [Escherichia coli SMS-3-5]
 gi|226737133|sp|B1LPC1|GRPE_ECOSM RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|170518930|gb|ACB17108.1| co-chaperone GrpE [Escherichia coli SMS-3-5]
          Length = 196

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 57/147 (38%), Positives = 93/147 (63%), Gaps = 10/147 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LRV AEMENLRRRT+ + + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 59  RDGILRVKAEMENLRRRTELDIEKAHKFALEKFINELLPVIDSLDRALEVA--DKANPD- 115

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                + +++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+   E  D  P N 
Sbjct: 116 -----MSAMVEGIELTLKSMLDVVRKFGVEVISETNVPLDPNVHQAIAMVESDDVAPGN- 169

Query: 163 IIKVVQDGYAINERVLRPALVSISKGK 189
           ++ ++Q GY +N R +R A+V+++K K
Sbjct: 170 VLGIMQKGYTLNGRTIRAAMVTVAKAK 196


>gi|300112992|ref|YP_003759567.1| GrpE protein [Nitrosococcus watsonii C-113]
 gi|299538929|gb|ADJ27246.1| GrpE protein [Nitrosococcus watsonii C-113]
          Length = 210

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 59/169 (34%), Positives = 101/169 (59%), Gaps = 8/169 (4%)

Query: 19  ANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFAR 78
           A   TAE ++   + E++ ++++E  ++ LR  AE+EN RRR +RE    + Y++ KFA+
Sbjct: 37  AAPETAELEAVQQLLEDARSKADEHWNELLRARAELENQRRRHERELDKGRKYALEKFAQ 96

Query: 79  DMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
           D+L V D+L   L +A  + AN        + +L EG E+  +     + R+G++ ID +
Sbjct: 97  DLLPVKDSLEMGLAAAQAEDAN--------VTALREGTELILKMFNEVVARFGIETIDPQ 148

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            + FNP+ HQA+  +       +T++ VV+ GYA+N R+LRPA+V +SK
Sbjct: 149 GEAFNPDFHQAISTQESSEAAPDTVLTVVRKGYALNGRLLRPAMVVVSK 197


>gi|297568046|ref|YP_003689390.1| GrpE protein [Desulfurivibrio alkaliphilus AHT2]
 gi|296923961|gb|ADH84771.1| GrpE protein [Desulfurivibrio alkaliphilus AHT2]
          Length = 206

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 94/154 (61%), Gaps = 9/154 (5%)

Query: 35  ESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSA 94
           E+ +++ +  D+ LR+ AE EN ++R  RE++ A  Y+     +++L   DNL RA++  
Sbjct: 57  EARSEAHDLEDRMLRLAAEFENYKKRMQRERESAFKYAEEDLLKELLPALDNLERAIE-- 114

Query: 95  PLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEP 154
                   K +++   +L+EG+EMT R +++ LE++G+K ++++ Q F+PN H+AM  E 
Sbjct: 115 -----QGHKTNDA--SALLEGVEMTYRGLLAGLEKFGLKPLESRGQAFDPNYHEAMAMEA 167

Query: 155 HDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
            D  PANT+I   Q GY   +R++R A V +S G
Sbjct: 168 SDEFPANTVISEFQRGYLYKDRLIRAAKVVVSNG 201


>gi|292493429|ref|YP_003528868.1| GrpE protein [Nitrosococcus halophilus Nc4]
 gi|291582024|gb|ADE16481.1| GrpE protein [Nitrosococcus halophilus Nc4]
          Length = 210

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 57/160 (35%), Positives = 99/160 (61%), Gaps = 8/160 (5%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           E++ ++++E  ++ LR  AE+EN RRR +RE + A+ Y++ KFA+++L V D+L   L +
Sbjct: 52  EDARSKADEHWNELLRARAELENQRRRHERELEKARKYALEKFAQELLPVKDSLEMGLAA 111

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
           A  + A+        + +L EG E+  +       R+G++ +D + + FNP +HQA+  +
Sbjct: 112 AQAEDAD--------VAALREGSELILKMFDEVTTRFGIETVDPQGESFNPELHQAISTQ 163

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNP 193
            +D V  NT++ VV+ GY +N R+LRPA+V +SK   Q P
Sbjct: 164 ENDEVAPNTVLIVVRKGYVLNGRLLRPAMVVVSKPSEQIP 203


>gi|240849047|ref|NP_001155829.1| GrpE protein homolog, mitochondrial [Acyrthosiphon pisum]
 gi|239789346|dbj|BAH71303.1| ACYPI010003 [Acyrthosiphon pisum]
          Length = 222

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 96/157 (61%), Gaps = 7/157 (4%)

Query: 31  NIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRA 90
           ++ EE+ N +E+ R    R +AE EN+R+RT +E  DA+ Y+I  F +D+L V+D+LS+A
Sbjct: 69  DLHEENKNLTEKVR----RYLAETENIRKRTIKETADAKIYAIQGFCKDLLDVADSLSKA 124

Query: 91  LDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM 150
            +  P +       S   LK L EG+  T  ++ +  +R+G+  I+  ++KF+PN H+A+
Sbjct: 125 TECVPKEAVCD---SNPHLKHLYEGLVTTESQLQTIFQRHGLMSINPLNEKFDPNSHKAL 181

Query: 151 FEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           FE+  +      ++ V Q GY ++ER++R A V ISK
Sbjct: 182 FEQVVEGKEGGIVVVVSQIGYKLHERIVRAAAVGISK 218


>gi|294496265|ref|YP_003542758.1| GrpE protein [Methanohalophilus mahii DSM 5219]
 gi|292667264|gb|ADE37113.1| GrpE protein [Methanohalophilus mahii DSM 5219]
          Length = 180

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 99/155 (63%), Gaps = 10/155 (6%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            ++  LR  AE +N R+RT +E+++ +++++     ++L V DN  RA++SA     N++
Sbjct: 36  LKEDLLRKRAEFDNFRKRTRKEQEEFRNFAVENLMVELLDVYDNFERAIESA----HNTD 91

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
                 + S++EG+EM  ++ +S LE+ G+K+I+ + ++F+P+ H+AM    H   P NT
Sbjct: 92  D-----VNSVVEGVEMVFKQFVSILEKEGLKRIECEGEEFDPSKHEAMMHVEHADHPDNT 146

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKTQNPTEEK 197
           II V + GY +N RV+RPA+V++SK  T +  EEK
Sbjct: 147 IIDVCKPGYKLNSRVIRPAMVAVSKN-TSSDKEEK 180


>gi|218547868|ref|YP_002381659.1| heat shock protein HSP70 cofactor [Escherichia fergusonii ATCC
           35469]
 gi|218355409|emb|CAQ88018.2| heat shock protein HSP70 cofactor [Escherichia fergusonii ATCC
           35469]
          Length = 350

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 93/148 (62%), Gaps = 10/148 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LRV AEMENLRRRT+ + + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 212 RDGILRVKAEMENLRRRTELDIEKAHKFALEKFINELLPVIDSLDRALEVA--DKANPD- 268

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                + +++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+   E  D  P N 
Sbjct: 269 -----MSAMVEGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGN- 322

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ ++Q GY +N R +R A+V+++K K 
Sbjct: 323 VLGIMQKGYTLNGRTIRAAMVTVAKAKA 350


>gi|330813341|ref|YP_004357580.1| heat shock protein GrpE [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486436|gb|AEA80841.1| heat shock protein GrpE [Candidatus Pelagibacter sp. IMCC9063]
          Length = 201

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 91/145 (62%), Gaps = 5/145 (3%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E  DK LR++AE +N+R+  ++EK+D   Y    FA  +L+++DNL RA         N+
Sbjct: 53  ELNDKVLRLLAENQNVRKNQEKEKEDILKYGSFNFASQILNLTDNLDRAFSI----FKNN 108

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
           EK  +     +  GIE+  +E++STLE+  +  ID  ++KF+PN HQA+ E   +  P  
Sbjct: 109 EKFKDKEFIEITNGIELIEKELLSTLEKNSITYIDCLNKKFDPNFHQALSEIDSEKEPG- 167

Query: 162 TIIKVVQDGYAINERVLRPALVSIS 186
           T+++ VQ GY +++R+LRP+LV+++
Sbjct: 168 TVVEEVQKGYMLHDRLLRPSLVNVA 192


>gi|288550297|ref|ZP_05969902.2| co-chaperone GrpE [Enterobacter cancerogenus ATCC 35316]
 gi|288315700|gb|EFC54638.1| co-chaperone GrpE [Enterobacter cancerogenus ATCC 35316]
          Length = 205

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 91/147 (61%), Gaps = 8/147 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           R+  LR+ AEMENLRRRT+ + + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 67  REAVLRIKAEMENLRRRTELDVEKAHKFALEKFVNELLPVIDSLDRALEVA--DKANPDN 124

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
            +      +IEGIE+T + M+  + ++GV+ I   +   +PN+HQA+     D V A  +
Sbjct: 125 TA------MIEGIELTLKSMLDVVRKFGVEVIAETNVALDPNVHQAIAMVESDDVQAGNV 178

Query: 164 IKVVQDGYAINERVLRPALVSISKGKT 190
           + V+Q GY +N R +R A+V+++K K 
Sbjct: 179 LGVMQKGYTLNGRTIRAAMVTVAKAKA 205


>gi|94496902|ref|ZP_01303476.1| GrpE protein [Sphingomonas sp. SKA58]
 gi|94423578|gb|EAT08605.1| GrpE protein [Sphingomonas sp. SKA58]
          Length = 184

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 62/136 (45%), Positives = 89/136 (65%), Gaps = 5/136 (3%)

Query: 52  AEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKS 111
           A+ +N+RRR ++E  DA++Y+   FARDMLSV+DNL+RAL + P DL + EK      K 
Sbjct: 51  ADTQNVRRRLEKELADARAYAATAFARDMLSVADNLTRALAAIPADLRDDEK-----FKG 105

Query: 112 LIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGY 171
           L+ G+E T RE+ S   R G+ K+++  Q  +PN HQAM E P       TI+  +Q GY
Sbjct: 106 LVVGLEATGRELESVFGRNGITKLESVGQPLDPNKHQAMMEVPSSDAEPGTILVEMQAGY 165

Query: 172 AINERVLRPALVSISK 187
            I +R+LRPA+VS++K
Sbjct: 166 MIKDRLLRPAMVSVAK 181


>gi|315050720|ref|XP_003174734.1| grpE protein [Arthroderma gypseum CBS 118893]
 gi|311340049|gb|EFQ99251.1| grpE protein [Arthroderma gypseum CBS 118893]
          Length = 245

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 114/195 (58%), Gaps = 18/195 (9%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSE----EFRDKYLRVIAEMENLRRRT 61
           +E N DK   P    ++ AE+ SE++  ++ L   E    + +DKYLR +A+  NL+ RT
Sbjct: 54  TEANGDK---PKAEEATEAEKPSELDTLKKDLEAREKEVVDLKDKYLRSVADFRNLQERT 110

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAP---LDLANSEKKSESVLKSLIEGIEM 118
            R+ + A++++I KFA D++   DNL RAL + P   +D AN+++  +  +  L  G++M
Sbjct: 111 RRDVEAARTFAIQKFAGDLIESIDNLERALGAVPPEKVDAANAKENKD--VYDLFSGLKM 168

Query: 119 TRREMMSTLERYGVKK------IDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYA 172
           T   +M+TL+++GV +      +D + QKF+P+ H+A+F  P +      I+ V   G+ 
Sbjct: 169 TEGILMNTLKKHGVVRFDPSEPVDGQPQKFDPSRHEALFMSPMEGKQDGDIMHVQNKGFT 228

Query: 173 INERVLRPALVSISK 187
           +N RVLR A V + K
Sbjct: 229 LNGRVLRAAKVGVVK 243


>gi|158520086|ref|YP_001527956.1| GrpE protein [Desulfococcus oleovorans Hxd3]
 gi|158508912|gb|ABW65879.1| GrpE protein [Desulfococcus oleovorans Hxd3]
          Length = 217

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 56/156 (35%), Positives = 93/156 (59%), Gaps = 8/156 (5%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           E +L + ++  DK LR  AE +N ++R +++  D + Y+     R++LSV DNL RA+  
Sbjct: 62  EAALEEKKKVEDKLLRAAAEFDNYKKRLEKQWADFKKYAHEAVIRELLSVVDNLERAI-V 120

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
           A  D A+  +        L+ G++MT  E++   E++GV +IDA  + F+PN H+A+   
Sbjct: 121 ASKDTADQNE-------CLLSGVDMTLTEILKVFEKFGVTRIDALGRSFDPNFHEAVARR 173

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
             D   AN +I+  Q GY I++R+LRPA+V +S G+
Sbjct: 174 ETDDTDANIVIEEYQKGYMIHDRLLRPAMVVVSAGR 209


>gi|26991411|ref|NP_746836.1| heat shock protein GrpE [Pseudomonas putida KT2440]
 gi|52782934|sp|Q88DU1|GRPE_PSEPK RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|24986482|gb|AAN70300.1|AE016671_1 heat shock protein GrpE [Pseudomonas putida KT2440]
 gi|313500637|gb|ADR62003.1| GrpE [Pseudomonas putida BIRD-1]
          Length = 185

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 55/145 (37%), Positives = 90/145 (62%), Gaps = 8/145 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D+ LR +A+++N+RRR +++ + A  +++ KF+ D+L V       +DS  L LA+S  
Sbjct: 37  KDQALRAVADLQNVRRRAEQDVEKAHKFALEKFSSDLLPV-------IDSLELALAHSSA 89

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
             E V K + EG+E+T +    TL+RY ++ +D   Q FNP  HQAM  + +  V  N++
Sbjct: 90  DDEHV-KQIREGVELTLKMFQDTLKRYNLEAVDPHGQPFNPEHHQAMAMQENAEVEPNSV 148

Query: 164 IKVVQDGYAINERVLRPALVSISKG 188
           + V Q GY +N R+LRPA+V +SK 
Sbjct: 149 LNVFQKGYLLNGRLLRPAMVVVSKA 173


>gi|300940953|ref|ZP_07155477.1| co-chaperone GrpE [Escherichia coli MS 21-1]
 gi|300454277|gb|EFK17770.1| co-chaperone GrpE [Escherichia coli MS 21-1]
          Length = 241

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 57/147 (38%), Positives = 93/147 (63%), Gaps = 10/147 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LRV AEMENLRRRT+ + + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 104 RDGILRVKAEMENLRRRTELDIEKAHKFALEKFINELLPVIDSLDRALEVA--DKANPD- 160

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                + +++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+   E  D  P N 
Sbjct: 161 -----MSAMVEGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGN- 214

Query: 163 IIKVVQDGYAINERVLRPALVSISKGK 189
           ++ ++Q GY +N R +R A+V+++K K
Sbjct: 215 VLGIMQKGYTLNGRTIRAAMVTVAKAK 241


>gi|91225097|ref|ZP_01260319.1| GrpE [Vibrio alginolyticus 12G01]
 gi|91190040|gb|EAS76311.1| GrpE [Vibrio alginolyticus 12G01]
          Length = 219

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 94/144 (65%), Gaps = 8/144 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+EN+RRRT++E   A+ +++ KFA ++L V DNL RA+ +A       + 
Sbjct: 84  QDAVLRSKAEVENMRRRTEQEIDKARKFALNKFAEELLPVIDNLERAIQAA-------DT 136

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           ++E+V K  +EG+E+T +  +  + ++G+K I+ + + FNP  HQAM  +      +NT+
Sbjct: 137 ENETV-KPFLEGVELTHKTFVDVVAKFGLKAINPEGEAFNPEFHQAMSIQESPDHESNTV 195

Query: 164 IKVVQDGYAINERVLRPALVSISK 187
           + V+Q GY +N RV+RPA+V ++K
Sbjct: 196 MFVMQKGYELNGRVIRPAMVMVAK 219


>gi|254228624|ref|ZP_04922048.1| co-chaperone GrpE [Vibrio sp. Ex25]
 gi|151938803|gb|EDN57637.1| co-chaperone GrpE [Vibrio sp. Ex25]
          Length = 219

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 94/144 (65%), Gaps = 8/144 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  LR  AE+EN+RRRT++E   A+ +++ KFA ++L V DNL RA+ +A       + 
Sbjct: 84  QDAVLRSKAEVENMRRRTEQEIDKARKFALNKFAEELLPVIDNLERAIQAA-------DT 136

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           ++E+V K  +EG+E+T +  +  + ++G+K I+ + + FNP  HQAM  +      +NT+
Sbjct: 137 ENETV-KPFLEGVELTHKTFVDVVAKFGLKAINPEGEAFNPEFHQAMSIQESPDHESNTV 195

Query: 164 IKVVQDGYAINERVLRPALVSISK 187
           + V+Q GY +N RV+RPA+V ++K
Sbjct: 196 MFVMQKGYELNGRVIRPAMVMVAK 219


>gi|88801009|ref|ZP_01116559.1| co-chaperone GrpE [Reinekea sp. MED297]
 gi|88776276|gb|EAR07501.1| co-chaperone GrpE [Reinekea sp. MED297]
          Length = 200

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 53/156 (33%), Positives = 99/156 (63%), Gaps = 10/156 (6%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           E++ +++ + +D+Y+R  AEM NLRRR +++ ++A  +   K  +++L+V+DNL RA+ S
Sbjct: 43  EQAQDEAAKMKDQYVRAEAEMANLRRRVEKDVENAHKFGQEKLTKELLAVADNLERAIVS 102

Query: 94  APLDLANSEKKSESV-LKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFE 152
                     + E+V + ++ EG+EMT + +     ++ ++ ID + + F+P +HQAM  
Sbjct: 103 T---------EGENVDVNAIKEGVEMTLKGLQDVFSKFSIEAIDPQGEPFDPQLHQAMSM 153

Query: 153 EPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
             +  V  NT+I V+Q GY ++ R++RPA+V +SKG
Sbjct: 154 VENPEVEPNTVIAVMQKGYQLHGRLVRPAMVMVSKG 189


>gi|311278429|ref|YP_003940660.1| GrpE protein [Enterobacter cloacae SCF1]
 gi|308747624|gb|ADO47376.1| GrpE protein [Enterobacter cloacae SCF1]
          Length = 197

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 90/147 (61%), Gaps = 10/147 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LRV AEMENLRRRT+ + + A  +++ KF  ++L V D+L RAL+ A         
Sbjct: 59  RDGVLRVKAEMENLRRRTELDVEKAHKFALEKFVNELLPVIDSLDRALEVA--------D 110

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
           KS   L  ++EGIE+T + M+  + ++GV+ +   +   +PN+HQA+   E  D  P N 
Sbjct: 111 KSNPDLTPMVEGIELTLKSMLDVVRKFGVEVVGDINVPMDPNVHQAIAMVESDDVAPGNV 170

Query: 163 IIKVVQDGYAINERVLRPALVSISKGK 189
           ++ V+Q GY +N R +R A+VS++K K
Sbjct: 171 LM-VMQKGYTLNGRTIRAAMVSVAKAK 196


>gi|60549562|gb|AAX24094.1| GrpE [Pseudomonas putida]
          Length = 184

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 55/145 (37%), Positives = 93/145 (64%), Gaps = 8/145 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D+ LR +A+++N+RRR +++ + A  +++ KFA D+L V D+L R L+     L+N++ 
Sbjct: 36  KDQSLRAVADLQNVRRRAEQDVEKAHKFALEKFAGDLLPVIDSLERGLE-----LSNADD 90

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           +S   +K + EGI++T +    TL+RY ++ +D   + FN   HQAM  E    V  N++
Sbjct: 91  ES---IKPMREGIKLTLKMFQDTLKRYNLEAVDPHGEPFNAEHHQAMAMEESAEVEPNSV 147

Query: 164 IKVVQDGYAINERVLRPALVSISKG 188
           +KV Q GY +N R+LRPA+V +SK 
Sbjct: 148 LKVFQKGYLLNGRLLRPAMVVVSKA 172


>gi|78044836|ref|YP_359275.1| grpE protein [Carboxydothermus hydrogenoformans Z-2901]
 gi|123770625|sp|Q3AF09|GRPE_CARHZ RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|77996951|gb|ABB15850.1| grpE protein [Carboxydothermus hydrogenoformans Z-2901]
          Length = 194

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 54/151 (35%), Positives = 93/151 (61%), Gaps = 11/151 (7%)

Query: 37  LNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPL 96
           L++    +++YLR+ A+ +N R+RT REK++   Y   +F + +L V DN  RAL     
Sbjct: 53  LDEHNRLKNQYLRLYADFDNYRKRTQREKEELLKYEGMEFLKKLLPVLDNFERAL----- 107

Query: 97  DLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHD 156
                 K+ ++  + +IEG+E+T R+++  L ++ VK I+A+ Q FNP +H+A+  E  +
Sbjct: 108 ------KEKDTDPQKVIEGVELTHRQLLEILNQHEVKAIEAQGQPFNPELHEALMVEVRE 161

Query: 157 TVPANTIIKVVQDGYAINERVLRPALVSISK 187
            +  NT+I+ +  GY   ++VLRPALV +SK
Sbjct: 162 DLEENTVIEELVKGYFYKDKVLRPALVKVSK 192


>gi|15803134|ref|NP_289166.1| heat shock protein GrpE [Escherichia coli O157:H7 EDL933]
 gi|15832730|ref|NP_311503.1| heat shock protein GrpE [Escherichia coli O157:H7 str. Sakai]
 gi|24113951|ref|NP_708461.1| heat shock protein GrpE [Shigella flexneri 2a str. 301]
 gi|26248977|ref|NP_755017.1| heat shock protein GrpE [Escherichia coli CFT073]
 gi|30064012|ref|NP_838183.1| heat shock protein GrpE [Shigella flexneri 2a str. 2457T]
 gi|74313203|ref|YP_311622.1| heat shock protein GrpE [Shigella sonnei Ss046]
 gi|82545157|ref|YP_409104.1| heat shock protein GrpE [Shigella boydii Sb227]
 gi|82777972|ref|YP_404321.1| heat shock protein GrpE [Shigella dysenteriae Sd197]
 gi|110642774|ref|YP_670504.1| heat shock protein GrpE [Escherichia coli 536]
 gi|157162089|ref|YP_001459407.1| heat shock protein GrpE [Escherichia coli HS]
 gi|170019110|ref|YP_001724064.1| heat shock protein GrpE [Escherichia coli ATCC 8739]
 gi|187733216|ref|YP_001881403.1| heat shock protein GrpE [Shigella boydii CDC 3083-94]
 gi|188492041|ref|ZP_02999311.1| co-chaperone GrpE [Escherichia coli 53638]
 gi|189404136|ref|ZP_03007340.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4501]
 gi|189405288|ref|ZP_03007748.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC869]
 gi|191171373|ref|ZP_03032922.1| co-chaperone GrpE [Escherichia coli F11]
 gi|193071253|ref|ZP_03052173.1| co-chaperone GrpE [Escherichia coli E110019]
 gi|209920088|ref|YP_002294172.1| heat shock protein GrpE [Escherichia coli SE11]
 gi|215487963|ref|YP_002330394.1| heat shock protein GrpE [Escherichia coli O127:H6 str. E2348/69]
 gi|217327690|ref|ZP_03443773.1| co-chaperone GrpE [Escherichia coli O157:H7 str. TW14588]
 gi|218555193|ref|YP_002388106.1| heat shock protein GrpE [Escherichia coli IAI1]
 gi|218696237|ref|YP_002403904.1| heat shock protein GrpE [Escherichia coli 55989]
 gi|218701125|ref|YP_002408754.1| heat shock protein GrpE [Escherichia coli IAI39]
 gi|218706114|ref|YP_002413633.1| heat shock protein GrpE [Escherichia coli UMN026]
 gi|227888179|ref|ZP_04005984.1| co-chaperone GrpE [Escherichia coli 83972]
 gi|253772493|ref|YP_003035324.1| heat shock protein GrpE [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254037690|ref|ZP_04871748.1| grpE [Escherichia sp. 1_1_43]
 gi|254162583|ref|YP_003045691.1| heat shock protein GrpE [Escherichia coli B str. REL606]
 gi|256019568|ref|ZP_05433433.1| heat shock protein GrpE [Shigella sp. D9]
 gi|256024860|ref|ZP_05438725.1| heat shock protein GrpE [Escherichia sp. 4_1_40B]
 gi|260856702|ref|YP_003230593.1| heat shock protein GrpE [Escherichia coli O26:H11 str. 11368]
 gi|260869294|ref|YP_003235696.1| heat shock protein GrpE [Escherichia coli O111:H- str. 11128]
 gi|261227496|ref|ZP_05941777.1| heat shock protein HSP70 cofactor [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261255690|ref|ZP_05948223.1| heat shock protein HSP70 cofactor [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291283885|ref|YP_003500703.1| heat shock protein GrpE [Escherichia coli O55:H7 str. CB9615]
 gi|293406120|ref|ZP_06650046.1| heat shock protein GrpE [Escherichia coli FVEC1412]
 gi|297518860|ref|ZP_06937246.1| heat shock protein HSP70 cofactor [Escherichia coli OP50]
 gi|298381854|ref|ZP_06991451.1| grpE [Escherichia coli FVEC1302]
 gi|300819914|ref|ZP_07100097.1| co-chaperone GrpE [Escherichia coli MS 107-1]
 gi|300825185|ref|ZP_07105275.1| co-chaperone GrpE [Escherichia coli MS 119-7]
 gi|300900200|ref|ZP_07118389.1| co-chaperone GrpE [Escherichia coli MS 198-1]
 gi|300905066|ref|ZP_07122876.1| co-chaperone GrpE [Escherichia coli MS 84-1]
 gi|300921159|ref|ZP_07137537.1| co-chaperone GrpE [Escherichia coli MS 115-1]
 gi|300930661|ref|ZP_07146048.1| co-chaperone GrpE [Escherichia coli MS 187-1]
 gi|300949008|ref|ZP_07163061.1| co-chaperone GrpE [Escherichia coli MS 116-1]
 gi|300957398|ref|ZP_07169612.1| co-chaperone GrpE [Escherichia coli MS 175-1]
 gi|300986817|ref|ZP_07177806.1| co-chaperone GrpE [Escherichia coli MS 45-1]
 gi|300990717|ref|ZP_07179302.1| co-chaperone GrpE [Escherichia coli MS 200-1]
 gi|301026396|ref|ZP_07189840.1| co-chaperone GrpE [Escherichia coli MS 69-1]
 gi|301050484|ref|ZP_07197362.1| co-chaperone GrpE [Escherichia coli MS 185-1]
 gi|301305742|ref|ZP_07211829.1| co-chaperone GrpE [Escherichia coli MS 124-1]
 gi|301644055|ref|ZP_07244071.1| co-chaperone GrpE [Escherichia coli MS 146-1]
 gi|306812469|ref|ZP_07446667.1| heat shock protein HSP70 cofactor [Escherichia coli NC101]
 gi|307139334|ref|ZP_07498690.1| heat shock protein HSP70 cofactor [Escherichia coli H736]
 gi|307315075|ref|ZP_07594659.1| GrpE protein [Escherichia coli W]
 gi|309784643|ref|ZP_07679278.1| protein grpE [Shigella dysenteriae 1617]
 gi|309794124|ref|ZP_07688548.1| co-chaperone GrpE [Escherichia coli MS 145-7]
 gi|312965544|ref|ZP_07779775.1| protein grpE [Escherichia coli 2362-75]
 gi|312973144|ref|ZP_07787317.1| protein grpE [Escherichia coli 1827-70]
 gi|331643329|ref|ZP_08344460.1| co-chaperone GrpE [Escherichia coli H736]
 gi|331648355|ref|ZP_08349443.1| co-chaperone GrpE [Escherichia coli M605]
 gi|331654070|ref|ZP_08355070.1| co-chaperone GrpE [Escherichia coli M718]
 gi|331658761|ref|ZP_08359703.1| co-chaperone GrpE [Escherichia coli TA206]
 gi|331664178|ref|ZP_08365087.1| co-chaperone GrpE [Escherichia coli TA143]
 gi|331669363|ref|ZP_08370209.1| co-chaperone GrpE [Escherichia coli TA271]
 gi|331674053|ref|ZP_08374815.1| co-chaperone GrpE [Escherichia coli TA280]
 gi|331678604|ref|ZP_08379278.1| co-chaperone GrpE [Escherichia coli H591]
 gi|332280692|ref|ZP_08393105.1| grpE [Shigella sp. D9]
 gi|52782896|sp|Q7ABI1|GRPE_ECO57 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|52782897|sp|Q7C0D0|GRPE_SHIFL RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|52782947|sp|Q8FEY9|GRPE_ECOL6 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|123048952|sp|Q0TEM6|GRPE_ECOL5 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|123755551|sp|Q31XD2|GRPE_SHIBS RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|123769568|sp|Q32CX5|GRPE_SHIDS RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|123773469|sp|Q3YYM5|GRPE_SHISS RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|167008732|sp|A8A3C0|GRPE_ECOHS RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|189041740|sp|B1IVM0|GRPE_ECOLC RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737128|sp|B7NSB2|GRPE_ECO7I RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737129|sp|B7M983|GRPE_ECO8A RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737131|sp|B7N6J9|GRPE_ECOLU RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737132|sp|B6I635|GRPE_ECOSE RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737184|sp|B2TYN5|GRPE_SHIB3 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|254799591|sp|B7UH62|GRPE_ECO27 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|254799592|sp|B7LDK2|GRPE_ECO55 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|12517038|gb|AAG57724.1|AE005491_4 phage lambda replication; host DNA synthesis; heat shock protein;
           protein repair [Escherichia coli O157:H7 str. EDL933]
 gi|26109383|gb|AAN81585.1|AE016764_267 GrpE protein [Escherichia coli CFT073]
 gi|13362947|dbj|BAB36899.1| heat shock protein GrpE [Escherichia coli O157:H7 str. Sakai]
 gi|24053058|gb|AAN44168.1| heat shock protein GrpE [Shigella flexneri 2a str. 301]
 gi|30042268|gb|AAP17993.1| heat shock protein GrpE [Shigella flexneri 2a str. 2457T]
 gi|73856680|gb|AAZ89387.1| heat shock protein [Shigella sonnei Ss046]
 gi|81242120|gb|ABB62830.1| GrpE [Shigella dysenteriae Sd197]
 gi|81246568|gb|ABB67276.1| GrpE [Shigella boydii Sb227]
 gi|110344366|gb|ABG70603.1| GrpE protein [Escherichia coli 536]
 gi|157067769|gb|ABV07024.1| co-chaperone GrpE [Escherichia coli HS]
 gi|169754038|gb|ACA76737.1| Ribulose-phosphate 3-epimerase [Escherichia coli ATCC 8739]
 gi|187430208|gb|ACD09482.1| co-chaperone GrpE [Shigella boydii CDC 3083-94]
 gi|188487240|gb|EDU62343.1| co-chaperone GrpE [Escherichia coli 53638]
 gi|189367278|gb|EDU85694.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4501]
 gi|189370861|gb|EDU89277.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC869]
 gi|190908307|gb|EDV67897.1| co-chaperone GrpE [Escherichia coli F11]
 gi|192955406|gb|EDV85889.1| co-chaperone GrpE [Escherichia coli E110019]
 gi|209762508|gb|ACI79566.1| heat shock protein GrpE [Escherichia coli]
 gi|209762510|gb|ACI79567.1| heat shock protein GrpE [Escherichia coli]
 gi|209762514|gb|ACI79569.1| heat shock protein GrpE [Escherichia coli]
 gi|209913347|dbj|BAG78421.1| heat shock protein [Escherichia coli SE11]
 gi|215266035|emb|CAS10450.1| heat shock protein [Escherichia coli O127:H6 str. E2348/69]
 gi|217320057|gb|EEC28482.1| co-chaperone GrpE [Escherichia coli O157:H7 str. TW14588]
 gi|218352969|emb|CAU98769.1| heat shock protein [Escherichia coli 55989]
 gi|218361961|emb|CAQ99562.1| heat shock protein [Escherichia coli IAI1]
 gi|218371111|emb|CAR18939.1| heat shock protein [Escherichia coli IAI39]
 gi|218433211|emb|CAR14109.1| heat shock protein [Escherichia coli UMN026]
 gi|222034315|emb|CAP77056.1| Protein grpE [Escherichia coli LF82]
 gi|226839314|gb|EEH71335.1| grpE [Escherichia sp. 1_1_43]
 gi|227834819|gb|EEJ45285.1| co-chaperone GrpE [Escherichia coli 83972]
 gi|242378208|emb|CAQ32983.1| phage lambda replication; host DNA synthesis; heat shock protein;
           protein repair, subunit of DnaJ/DnaK/GrpE [Escherichia
           coli BL21(DE3)]
 gi|253323537|gb|ACT28139.1| GrpE protein [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253974484|gb|ACT40155.1| heat shock protein [Escherichia coli B str. REL606]
 gi|253978651|gb|ACT44321.1| heat shock protein [Escherichia coli BL21(DE3)]
 gi|257755351|dbj|BAI26853.1| heat shock protein GrpE [Escherichia coli O26:H11 str. 11368]
 gi|257765650|dbj|BAI37145.1| heat shock protein GrpE [Escherichia coli O111:H- str. 11128]
 gi|281179659|dbj|BAI55989.1| heat shock protein [Escherichia coli SE15]
 gi|281602023|gb|ADA75007.1| Protein grpE [Shigella flexneri 2002017]
 gi|290763758|gb|ADD57719.1| heat shock protein GrpE [Escherichia coli O55:H7 str. CB9615]
 gi|291426126|gb|EFE99158.1| heat shock protein GrpE [Escherichia coli FVEC1412]
 gi|298276994|gb|EFI18510.1| grpE [Escherichia coli FVEC1302]
 gi|300297792|gb|EFJ54177.1| co-chaperone GrpE [Escherichia coli MS 185-1]
 gi|300305685|gb|EFJ60205.1| co-chaperone GrpE [Escherichia coli MS 200-1]
 gi|300315833|gb|EFJ65617.1| co-chaperone GrpE [Escherichia coli MS 175-1]
 gi|300356315|gb|EFJ72185.1| co-chaperone GrpE [Escherichia coli MS 198-1]
 gi|300395543|gb|EFJ79081.1| co-chaperone GrpE [Escherichia coli MS 69-1]
 gi|300403053|gb|EFJ86591.1| co-chaperone GrpE [Escherichia coli MS 84-1]
 gi|300407869|gb|EFJ91407.1| co-chaperone GrpE [Escherichia coli MS 45-1]
 gi|300411890|gb|EFJ95200.1| co-chaperone GrpE [Escherichia coli MS 115-1]
 gi|300451535|gb|EFK15155.1| co-chaperone GrpE [Escherichia coli MS 116-1]
 gi|300461481|gb|EFK24974.1| co-chaperone GrpE [Escherichia coli MS 187-1]
 gi|300522347|gb|EFK43416.1| co-chaperone GrpE [Escherichia coli MS 119-7]
 gi|300527502|gb|EFK48564.1| co-chaperone GrpE [Escherichia coli MS 107-1]
 gi|300838996|gb|EFK66756.1| co-chaperone GrpE [Escherichia coli MS 124-1]
 gi|301077600|gb|EFK92406.1| co-chaperone GrpE [Escherichia coli MS 146-1]
 gi|305854507|gb|EFM54945.1| heat shock protein HSP70 cofactor [Escherichia coli NC101]
 gi|306905504|gb|EFN36038.1| GrpE protein [Escherichia coli W]
 gi|307554626|gb|ADN47401.1| co-chaperone GrpE [Escherichia coli ABU 83972]
 gi|308122029|gb|EFO59291.1| co-chaperone GrpE [Escherichia coli MS 145-7]
 gi|308927540|gb|EFP73012.1| protein grpE [Shigella dysenteriae 1617]
 gi|309702993|emb|CBJ02324.1| heat shock protein (heat shock protein B25.3) [Escherichia coli
           ETEC H10407]
 gi|310333086|gb|EFQ00300.1| protein grpE [Escherichia coli 1827-70]
 gi|312289792|gb|EFR17681.1| protein grpE [Escherichia coli 2362-75]
 gi|312947185|gb|ADR28012.1| heat shock protein HSP70 cofactor [Escherichia coli O83:H1 str. NRG
           857C]
 gi|313648291|gb|EFS12735.1| protein grpE [Shigella flexneri 2a str. 2457T]
 gi|315061927|gb|ADT76254.1| heat shock protein [Escherichia coli W]
 gi|315253140|gb|EFU33108.1| co-chaperone GrpE [Escherichia coli MS 85-1]
 gi|315290946|gb|EFU50311.1| co-chaperone GrpE [Escherichia coli MS 153-1]
 gi|315615312|gb|EFU95947.1| protein grpE [Escherichia coli 3431]
 gi|320177030|gb|EFW52051.1| Heat shock protein GrpE [Shigella dysenteriae CDC 74-1112]
 gi|320182473|gb|EFW57367.1| Heat shock protein GrpE [Shigella boydii ATCC 9905]
 gi|320183094|gb|EFW57956.1| Heat shock protein GrpE [Shigella flexneri CDC 796-83]
 gi|320640795|gb|EFX10293.1| heat shock protein HSP70 cofactor [Escherichia coli O157:H7 str.
           G5101]
 gi|320646140|gb|EFX15085.1| heat shock protein HSP70 cofactor [Escherichia coli O157:H- str.
           493-89]
 gi|320651437|gb|EFX19838.1| heat shock protein HSP70 cofactor [Escherichia coli O157:H- str. H
           2687]
 gi|320657042|gb|EFX24865.1| heat shock protein HSP70 cofactor [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320662706|gb|EFX30050.1| heat shock protein HSP70 cofactor [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320667523|gb|EFX34447.1| heat shock protein HSP70 cofactor [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323156267|gb|EFZ42426.1| protein grpE [Escherichia coli EPECa14]
 gi|323167736|gb|EFZ53431.1| protein grpE [Shigella sonnei 53G]
 gi|323173070|gb|EFZ58701.1| protein grpE [Escherichia coli LT-68]
 gi|323177261|gb|EFZ62849.1| protein grpE [Escherichia coli 1180]
 gi|323188395|gb|EFZ73684.1| protein grpE [Escherichia coli RN587/1]
 gi|323377493|gb|ADX49761.1| GrpE protein [Escherichia coli KO11]
 gi|323935673|gb|EGB31990.1| GrpE protein [Escherichia coli E1520]
 gi|323941369|gb|EGB37553.1| GrpE protein [Escherichia coli E482]
 gi|323960529|gb|EGB56158.1| GrpE protein [Escherichia coli H489]
 gi|323963922|gb|EGB59415.1| GrpE protein [Escherichia coli M863]
 gi|323971444|gb|EGB66680.1| GrpE protein [Escherichia coli TA007]
 gi|324005811|gb|EGB75030.1| co-chaperone GrpE [Escherichia coli MS 57-2]
 gi|324012451|gb|EGB81670.1| co-chaperone GrpE [Escherichia coli MS 60-1]
 gi|324016601|gb|EGB85820.1| co-chaperone GrpE [Escherichia coli MS 117-3]
 gi|324120070|gb|EGC13946.1| GrpE protein [Escherichia coli E1167]
 gi|325496319|gb|EGC94178.1| heat shock protein HSP70 cofactor [Escherichia fergusonii ECD227]
 gi|331036800|gb|EGI09024.1| co-chaperone GrpE [Escherichia coli H736]
 gi|331042102|gb|EGI14244.1| co-chaperone GrpE [Escherichia coli M605]
 gi|331047452|gb|EGI19529.1| co-chaperone GrpE [Escherichia coli M718]
 gi|331053343|gb|EGI25372.1| co-chaperone GrpE [Escherichia coli TA206]
 gi|331058635|gb|EGI30613.1| co-chaperone GrpE [Escherichia coli TA143]
 gi|331063031|gb|EGI34944.1| co-chaperone GrpE [Escherichia coli TA271]
 gi|331068792|gb|EGI40185.1| co-chaperone GrpE [Escherichia coli TA280]
 gi|331073434|gb|EGI44755.1| co-chaperone GrpE [Escherichia coli H591]
 gi|332088121|gb|EGI93246.1| protein grpE [Shigella boydii 5216-82]
 gi|332089213|gb|EGI94320.1| protein grpE [Shigella dysenteriae 155-74]
 gi|332092119|gb|EGI97197.1| protein grpE [Shigella boydii 3594-74]
 gi|332103044|gb|EGJ06390.1| grpE [Shigella sp. D9]
 gi|332344482|gb|AEE57816.1| heat shock protein GrpE [Escherichia coli UMNK88]
 gi|332753359|gb|EGJ83739.1| protein grpE [Shigella flexneri 4343-70]
 gi|332755601|gb|EGJ85964.1| protein grpE [Shigella flexneri 2747-71]
 gi|332765591|gb|EGJ95804.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Shigella flexneri 2930-71]
 gi|332999388|gb|EGK18973.1| protein grpE [Shigella flexneri VA-6]
 gi|333000780|gb|EGK20354.1| protein grpE [Shigella flexneri K-218]
 gi|333000985|gb|EGK20555.1| protein grpE [Shigella flexneri K-272]
 gi|333015511|gb|EGK34850.1| protein grpE [Shigella flexneri K-227]
 gi|333015862|gb|EGK35198.1| protein grpE [Shigella flexneri K-304]
          Length = 197

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 93/148 (62%), Gaps = 10/148 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LRV AEMENLRRRT+ + + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 59  RDGILRVKAEMENLRRRTELDIEKAHKFALEKFINELLPVIDSLDRALEVA--DKANPD- 115

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                + +++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+   E  D  P N 
Sbjct: 116 -----MSAMVEGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGN- 169

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ ++Q GY +N R +R A+V+++K K 
Sbjct: 170 VLGIMQKGYTLNGRTIRAAMVTVAKAKA 197


>gi|52782985|sp|Q9LCQ6|GRPE_BRECH RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|6855460|dbj|BAA90472.1| GrpE [Brevibacillus choshinensis]
          Length = 179

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 59/186 (31%), Positives = 111/186 (59%), Gaps = 14/186 (7%)

Query: 5   MSEKNIDKEKNPSNANSSTA--EEKSEINIPEESLN---QSEEFRDKYLRVIAEMENLRR 59
           MSE+ + ++       + TA  +E +++N  +E+ +   Q+EE +++ LR +A+MENLRR
Sbjct: 1   MSEEKLTQDPTAEEEQTETADQQESADVNWEQEAAHWKAQAEEHQNRMLRTMADMENLRR 60

Query: 60  RTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMT 119
           R  +E++D   Y+  K   ++L + DN  RAL         ++K+S +V +SL+ G++M 
Sbjct: 61  RVRKEQEDLAKYASQKVVEELLPILDNFERAL--------AADKESMTV-ESLLTGVDMV 111

Query: 120 RREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
            R+M+   ++ G+  I AK Q F+P++HQA+ +       +  +++ +Q GY   +RV+R
Sbjct: 112 YRQMVQVFDKEGLVAIAAKGQPFDPHVHQAVMQTQDPAFESGVVVEELQKGYMFKDRVVR 171

Query: 180 PALVSI 185
           PA+V +
Sbjct: 172 PAMVKV 177


>gi|159486567|ref|XP_001701310.1| mitochondrial grpE-type co-chaperone of the HSP70 system
           [Chlamydomonas reinhardtii]
 gi|158271793|gb|EDO97605.1| mitochondrial grpE-type co-chaperone of the HSP70 system
           [Chlamydomonas reinhardtii]
          Length = 264

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 59/152 (38%), Positives = 85/152 (55%), Gaps = 5/152 (3%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPL-- 96
           Q E   D   R +AEMENLR RT RE   ++ ++I  F + +L V DNL RA    P   
Sbjct: 107 QVETLTDSLKRTLAEMENLRARTAREVDVSKKFAIQGFVKSLLDVPDNLERAASVVPSEA 166

Query: 97  ---DLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
              D     +K  ++L  L+EG+  T   +   L++ GV++ DA  Q F+PN+H A+F+ 
Sbjct: 167 LKEDGGVPPEKLRNLLAGLLEGVRATESILHKVLKQNGVERYDAAGQPFDPNLHNALFDI 226

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
           P  T   NTI  V + GY +N+RV+RPA V +
Sbjct: 227 PDPTKENNTIAVVTKKGYKLNDRVIRPAEVGV 258


>gi|169608896|ref|XP_001797867.1| hypothetical protein SNOG_07532 [Phaeosphaeria nodorum SN15]
 gi|111063878|gb|EAT84998.1| hypothetical protein SNOG_07532 [Phaeosphaeria nodorum SN15]
          Length = 226

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 54/140 (38%), Positives = 88/140 (62%), Gaps = 3/140 (2%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E +DKYLR +A+  NL+ RT RE + A+ ++I +FARD++   DNL RAL + P D    
Sbjct: 81  ELKDKYLRSVADFRNLQERTKRETQAAKDFAIQRFARDLVESVDNLDRALGTVPADKLKP 140

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKD--QKFNPNMHQAMFEEPHDTVP 159
           E  +  ++ +L +GI+MT   ++STL+++G+++ D  D  +KFNPN+H+A+F+ P     
Sbjct: 141 EDGNADLI-ALHDGIKMTDSILISTLKKHGLERFDPSDAGEKFNPNVHEAVFQAPQPDKE 199

Query: 160 ANTIIKVVQDGYAINERVLR 179
                   Q G+ +N RVL+
Sbjct: 200 DGICFHTQQKGFLLNGRVLK 219


>gi|16130533|ref|NP_417104.1| heat shock protein [Escherichia coli str. K-12 substr. MG1655]
 gi|89109414|ref|AP_003194.1| heat shock protein [Escherichia coli str. K-12 substr. W3110]
 gi|170082216|ref|YP_001731536.1| heat shock protein [Escherichia coli str. K-12 substr. DH10B]
 gi|238901773|ref|YP_002927569.1| heat shock protein [Escherichia coli BW2952]
 gi|121638|sp|P09372|GRPE_ECOLI RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor; AltName:
           Full=HSP24; AltName: Full=Heat shock protein B25.3
 gi|226737130|sp|B1XBT4|GRPE_ECODH RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|259647651|sp|C4ZYN1|GRPE_ECOBW RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|41619|emb|CAA30711.1| unnamed protein product [Escherichia coli]
 gi|786517|gb|AAB32515.1| GrpE=heat shock protein [Escherichia coli, mutant grpE25, Peptide
           Mutant, 197 aa]
 gi|1788967|gb|AAC75663.1| heat shock protein [Escherichia coli str. K-12 substr. MG1655]
 gi|1800018|dbj|BAA16498.1| heat shock protein [Escherichia coli str. K12 substr. W3110]
 gi|169890051|gb|ACB03758.1| heat shock protein [Escherichia coli str. K-12 substr. DH10B]
 gi|238861403|gb|ACR63401.1| heat shock protein [Escherichia coli BW2952]
 gi|260448313|gb|ACX38735.1| Ribulose-phosphate 3-epimerase [Escherichia coli DH1]
 gi|315137231|dbj|BAJ44390.1| heat shock protein HSP70 cofactor [Escherichia coli DH1]
          Length = 197

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 93/148 (62%), Gaps = 10/148 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LRV AEMENLRRRT+ + + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 59  RDGILRVKAEMENLRRRTELDIEKAHKFALEKFINELLPVIDSLDRALEVA--DKANPD- 115

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                + +++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+   E  D  P N 
Sbjct: 116 -----MSAMVEGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGN- 169

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ ++Q GY +N R +R A+V+++K K 
Sbjct: 170 VLGIMQKGYTLNGRTIRAAMVTVAKAKA 197


>gi|77166264|ref|YP_344789.1| GrpE protein [Nitrosococcus oceani ATCC 19707]
 gi|123593368|sp|Q3J7D7|GRPE_NITOC RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|76884578|gb|ABA59259.1| GrpE protein [Nitrosococcus oceani ATCC 19707]
          Length = 210

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 59/169 (34%), Positives = 101/169 (59%), Gaps = 8/169 (4%)

Query: 19  ANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFAR 78
           A   TAE ++   + E++ ++++E  ++ LR  AE+EN RRR +RE +  + Y++ KFA+
Sbjct: 37  AAPETAELEAVQQLLEDARSKADEHWNELLRARAELENQRRRHERELEKGRKYALEKFAQ 96

Query: 79  DMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
           D+L V D+L   L +A  + AN        + +L EG E+  +       R+G++ ID +
Sbjct: 97  DLLPVKDSLEMGLAAAQAEDAN--------VTALREGTELILKMFNEVAARFGIETIDPQ 148

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            + FNP+ HQA+  +       +T++ VV+ GYA+N R+LRPA+V +SK
Sbjct: 149 GEAFNPDFHQAISTQESSEAAPDTVLTVVRKGYALNGRLLRPAMVVVSK 197


>gi|315298668|gb|EFU57922.1| co-chaperone GrpE [Escherichia coli MS 16-3]
          Length = 197

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 93/148 (62%), Gaps = 10/148 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LRV AEMENLRRRT+ + + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 59  RDGILRVKAEMENLRRRTELDIEKAHKFALEKFINELLPVIDSLDRALEVA--DKANPD- 115

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                + +++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+   E  D  P N 
Sbjct: 116 -----ISAMVEGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGN- 169

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ ++Q GY +N R +R A+V+++K K 
Sbjct: 170 VLGIMQKGYTLNGRTIRAAMVTVAKAKA 197


>gi|157158969|ref|YP_001463933.1| heat shock protein GrpE [Escherichia coli E24377A]
 gi|194427912|ref|ZP_03060458.1| co-chaperone GrpE [Escherichia coli B171]
 gi|260845295|ref|YP_003223073.1| heat shock protein GrpE [Escherichia coli O103:H2 str. 12009]
 gi|293448965|ref|ZP_06663386.1| co-chaperone GrpE [Escherichia coli B088]
 gi|300925606|ref|ZP_07141476.1| co-chaperone GrpE [Escherichia coli MS 182-1]
 gi|301326734|ref|ZP_07220048.1| co-chaperone GrpE [Escherichia coli MS 78-1]
 gi|167008731|sp|A7ZQ54|GRPE_ECO24 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|157080999|gb|ABV20707.1| co-chaperone GrpE [Escherichia coli E24377A]
 gi|194414145|gb|EDX30421.1| co-chaperone GrpE [Escherichia coli B171]
 gi|257760442|dbj|BAI31939.1| heat shock protein GrpE [Escherichia coli O103:H2 str. 12009]
 gi|291322055|gb|EFE61484.1| co-chaperone GrpE [Escherichia coli B088]
 gi|300418301|gb|EFK01612.1| co-chaperone GrpE [Escherichia coli MS 182-1]
 gi|300846594|gb|EFK74354.1| co-chaperone GrpE [Escherichia coli MS 78-1]
 gi|323159133|gb|EFZ45126.1| protein grpE [Escherichia coli E128010]
 gi|323184511|gb|EFZ69885.1| protein grpE [Escherichia coli 1357]
 gi|323946259|gb|EGB42292.1| GrpE protein [Escherichia coli H120]
          Length = 196

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 57/147 (38%), Positives = 93/147 (63%), Gaps = 10/147 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LRV AEMENLRRRT+ + + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 59  RDGILRVKAEMENLRRRTELDIEKAHKFALEKFINELLPVIDSLDRALEVA--DKANPD- 115

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                + +++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+   E  D  P N 
Sbjct: 116 -----MSAMVEGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGN- 169

Query: 163 IIKVVQDGYAINERVLRPALVSISKGK 189
           ++ ++Q GY +N R +R A+V+++K K
Sbjct: 170 VLGIMQKGYTLNGRTIRAAMVTVAKAK 196


>gi|308501795|ref|XP_003113082.1| hypothetical protein CRE_25465 [Caenorhabditis remanei]
 gi|308265383|gb|EFP09336.1| hypothetical protein CRE_25465 [Caenorhabditis remanei]
          Length = 237

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 91/151 (60%), Gaps = 7/151 (4%)

Query: 38  NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSA-PL 96
            +S++++DKY R +AE EN+RRR  ++  DA+ ++I  F +D+L VSD L  A+ S  P 
Sbjct: 88  TESKDYKDKYQRSLAETENVRRRGIKQTDDAKIFAIQSFCKDLLEVSDILDIAVKSVKPE 147

Query: 97  DLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHD 156
           +L +  K     +K L EG+ MTR  +  T  ++G+  +D  +QKF+PN+H+A+F+ P  
Sbjct: 148 ELESGGK----AMKDLFEGVSMTRTVLAKTFAKHGLVTVDPTNQKFDPNLHEAVFQIPSA 203

Query: 157 TV--PANTIIKVVQDGYAINERVLRPALVSI 185
               P   I    + GY++ ER +RPA V +
Sbjct: 204 NAKQPVGHIEVCTKIGYSLKERPIRPAQVGV 234


>gi|212710679|ref|ZP_03318807.1| hypothetical protein PROVALCAL_01745 [Providencia alcalifaciens DSM
           30120]
 gi|212686760|gb|EEB46288.1| hypothetical protein PROVALCAL_01745 [Providencia alcalifaciens DSM
           30120]
          Length = 196

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 95/146 (65%), Gaps = 12/146 (8%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           R+  LR  AE+EN+RRRT+++ + A  +++ KF+ ++L V DNL RA+D+A       ++
Sbjct: 61  REAMLRAHAEIENIRRRTEQDIEKAHKFALEKFSNELLPVIDNLERAIDAA-------DR 113

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM--FEEPHDTVPAN 161
           +SE   K+++EG+++T +  +  + ++G+  +D  +  FNP +HQAM   E P  +  A 
Sbjct: 114 ESEES-KAMLEGLDLTLKTFLDAVSKFGIVPVDEANVPFNPEVHQAMTMIESPDHS--AG 170

Query: 162 TIIKVVQDGYAINERVLRPALVSISK 187
            +I V+Q GY +N R+LRPA+V +SK
Sbjct: 171 QVINVMQKGYTLNNRLLRPAMVIVSK 196


>gi|255019874|ref|ZP_05291949.1| Heat shock protein GrpE [Acidithiobacillus caldus ATCC 51756]
 gi|254970654|gb|EET28141.1| Heat shock protein GrpE [Acidithiobacillus caldus ATCC 51756]
          Length = 192

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 57/152 (37%), Positives = 99/152 (65%), Gaps = 9/152 (5%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           Q+E++R+ YLR +A+MENLR+R +R+ +DA++Y++ +FAR++L V D+L  AL S P  +
Sbjct: 36  QAEQYRNDYLRALADMENLRKRLERQMEDARNYAVERFARELLPVVDSLELAL-STP--V 92

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
           A  E  ++     L +G+E T       L + GV  ++A+  +F+P+ HQA+     +  
Sbjct: 93  AGGEGVAQ-----LRQGLENTLSLFFQALAKAGVAPVEAEAARFDPHRHQAIAMVEAEGE 147

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           P N ++ V Q GY I++R+LRPA+V+++K  +
Sbjct: 148 P-NRVLAVHQKGYVIHDRLLRPAMVTVAKAAS 178


>gi|297792997|ref|XP_002864383.1| hypothetical protein ARALYDRAFT_495605 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297310218|gb|EFH40642.1| hypothetical protein ARALYDRAFT_495605 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 302

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 92/150 (61%), Gaps = 5/150 (3%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS-----APL 96
           E +DK+LR  AE +NL  RT R  ++A+ +++  FA  +L V+DNL RA        + +
Sbjct: 139 EMKDKFLRTYAEQQNLMDRTKRNAENAKKFAVQNFATSLLDVADNLERASSVVKESFSKI 198

Query: 97  DLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHD 156
           D +     +  +LK+L+EG+EMT +++    ++ G+ K D  ++ F+PN H A+F+ P  
Sbjct: 199 DTSKDSAGAAPLLKNLLEGVEMTEKQLAEVFKKSGLVKEDPLNEPFDPNKHNAVFQVPDA 258

Query: 157 TVPANTIIKVVQDGYAINERVLRPALVSIS 186
           + P  TI  V++ GY++ +RV+RPA V ++
Sbjct: 259 SKPKGTIAHVLKPGYSLYDRVIRPAEVGVT 288


>gi|254435973|ref|ZP_05049480.1| co-chaperone GrpE [Nitrosococcus oceani AFC27]
 gi|207089084|gb|EDZ66356.1| co-chaperone GrpE [Nitrosococcus oceani AFC27]
          Length = 215

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 59/169 (34%), Positives = 101/169 (59%), Gaps = 8/169 (4%)

Query: 19  ANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFAR 78
           A   TAE ++   + E++ ++++E  ++ LR  AE+EN RRR +RE +  + Y++ KFA+
Sbjct: 42  AAPETAELEAVQQLLEDARSKADEHWNELLRARAELENQRRRHERELEKGRKYALEKFAQ 101

Query: 79  DMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
           D+L V D+L   L +A  + AN        + +L EG E+  +       R+G++ ID +
Sbjct: 102 DLLPVKDSLEMGLAAAQAEDAN--------VTALREGTELILKMFNEVAARFGIETIDPQ 153

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            + FNP+ HQA+  +       +T++ VV+ GYA+N R+LRPA+V +SK
Sbjct: 154 GEAFNPDFHQAISTQESSEAAPDTVLTVVRKGYALNGRLLRPAMVVVSK 202


>gi|89091964|ref|ZP_01164919.1| Hsp 24 DnaK nucleotide exchange factor; probable member of the
           DnaK/DnaJ/GrpE foldase complex [Oceanospirillum sp.
           MED92]
 gi|89083699|gb|EAR62916.1| Hsp 24 DnaK nucleotide exchange factor; probable member of the
           DnaK/DnaJ/GrpE foldase complex [Oceanospirillum sp.
           MED92]
          Length = 205

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 52/146 (35%), Positives = 92/146 (63%), Gaps = 9/146 (6%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            +D+ LR+ AE +N+RRR +++ + A  + + KFA +ML + D+L RA+++      + E
Sbjct: 69  LKDQMLRIQAEAQNVRRRAEQDVEKAHKFGVEKFANEMLPIVDSLERAIEA----FGDDE 124

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
                 LK + EG+EMT    +S L ++ +K+++ K + F+P +HQAM   P     ANT
Sbjct: 125 S-----LKPMREGVEMTMNMFVSGLAKFEMKQVNPKGEMFDPALHQAMSMIPVPDTAANT 179

Query: 163 IIKVVQDGYAINERVLRPALVSISKG 188
           ++ V+Q GY ++ R++RPA+V ++KG
Sbjct: 180 VVDVMQKGYTLHGRLVRPAMVIVAKG 205


>gi|293412003|ref|ZP_06654726.1| co-chaperone GrpE [Escherichia coli B354]
 gi|293415884|ref|ZP_06658524.1| co-chaperone GrpE [Escherichia coli B185]
 gi|331684269|ref|ZP_08384861.1| co-chaperone GrpE [Escherichia coli H299]
 gi|291432073|gb|EFF05055.1| co-chaperone GrpE [Escherichia coli B185]
 gi|291468774|gb|EFF11265.1| co-chaperone GrpE [Escherichia coli B354]
 gi|331077884|gb|EGI49090.1| co-chaperone GrpE [Escherichia coli H299]
          Length = 197

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 93/148 (62%), Gaps = 10/148 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LRV AEMENLRRRT+ + + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 59  RDGILRVKAEMENLRRRTELDIEKAHKFALEKFINELLPVIDSLDRALEVA--DKANPD- 115

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                + +++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+   E  D  P N 
Sbjct: 116 -----MSAMVEGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGN- 169

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ ++Q GY +N R +R A+V+++K K 
Sbjct: 170 VLGIMQKGYTLNGRTIRAAMVTVAKAKA 197


>gi|284922559|emb|CBG35646.1| heat shock protein (heat shock protein B25.3) [Escherichia coli
           042]
          Length = 197

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 93/148 (62%), Gaps = 10/148 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LRV AEMENLRRRT+ + + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 59  RDGILRVKAEMENLRRRTELDIEKAHKFALEKFINELLPVIDSLDRALEVA--DKANPD- 115

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                + +++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+   E  D  P N 
Sbjct: 116 -----MSAMVEGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGN- 169

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ ++Q GY +N R +R A+V+++K K 
Sbjct: 170 VLGIMQKGYTLNGRTIRAAMVTVAKAKA 197


>gi|167627628|ref|YP_001678128.1| heat shock protein GrpE [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|189041741|sp|B0TYF1|GRPE_FRAP2 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|167597629|gb|ABZ87627.1| co-chaperone GrpE [Francisella philomiragia subsp. philomiragia
           ATCC 25017]
          Length = 191

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 93/145 (64%), Gaps = 9/145 (6%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
           F+D+ LR  AEMEN+R+R +R+  +A+ + I KFA+++L V D++ +AL          E
Sbjct: 55  FKDEALRARAEMENVRKRAERDVSNARKFGIEKFAKELLPVIDSIEQAL--------KHE 106

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
            K E  + ++ EGIE+T + ++ TL++ G++++D K +KF+PN+H+AM   P+     NT
Sbjct: 107 VKLEEAI-AMKEGIELTSKMLVDTLKKNGLEELDPKGEKFDPNLHEAMAMIPNSEFEDNT 165

Query: 163 IIKVVQDGYAINERVLRPALVSISK 187
           I  V Q GY +N RV+R A V I K
Sbjct: 166 IFDVFQKGYMLNGRVVRAAKVVIVK 190


>gi|110806719|ref|YP_690239.1| heat shock protein GrpE [Shigella flexneri 5 str. 8401]
 gi|123047953|sp|Q0T181|GRPE_SHIF8 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|110616267|gb|ABF04934.1| GrpE protein [Shigella flexneri 5 str. 8401]
          Length = 197

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 93/148 (62%), Gaps = 10/148 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LRV AEMENLRRRT+ + + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 59  RDGILRVKAEMENLRRRTELDIEKAHKFALEKFINELLPVIDSLDRALEVA--DKANPD- 115

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                + +++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+   E  D  P N 
Sbjct: 116 -----MSAMVEGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGN- 169

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ ++Q GY +N R +R A+V+++K K 
Sbjct: 170 VLGIMQKGYTLNGRTIRAAMVTVAKAKA 197


>gi|223040625|ref|ZP_03610895.1| co-chaperone GrpE [Campylobacter rectus RM3267]
 gi|222878083|gb|EEF13194.1| co-chaperone GrpE [Campylobacter rectus RM3267]
          Length = 175

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 96/172 (55%), Gaps = 10/172 (5%)

Query: 16  PSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAK 75
           PSN + S + E  +    E    Q EE  DKY R  A+ EN+++R ++EK D  +Y+  K
Sbjct: 14  PSNFDESISFEGLDAKYIELQ-KQLEELTDKYYRANADFENIKKRFEKEKADIATYANEK 72

Query: 76  FARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI 135
           FARD+L V D L  A+        N E + +     + EGI +T  +     E+ G+  I
Sbjct: 73  FARDLLPVIDALEMAV--------NFETEGDEYAAKIKEGIYITIDQFKKCFEKNGITAI 124

Query: 136 DAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +A ++ F+PN H AM +   + V    I++V+Q GY IN R+LRPA+VSI+K
Sbjct: 125 EA-NEDFDPNFHNAMLQVESEDVEKGKIVQVIQKGYLINGRILRPAMVSIAK 175


>gi|91211948|ref|YP_541934.1| heat shock protein GrpE [Escherichia coli UTI89]
 gi|218559533|ref|YP_002392446.1| heat shock protein GrpE [Escherichia coli S88]
 gi|218690731|ref|YP_002398943.1| heat shock protein GrpE [Escherichia coli ED1a]
 gi|237706799|ref|ZP_04537280.1| grpE [Escherichia sp. 3_2_53FAA]
 gi|122990747|sp|Q1R8B1|GRPE_ECOUT RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737126|sp|B7MIV1|GRPE_ECO45 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|254799593|sp|B7MYA6|GRPE_ECO81 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|91073522|gb|ABE08403.1| GrpE protein [Escherichia coli UTI89]
 gi|218366302|emb|CAR04053.1| heat shock protein [Escherichia coli S88]
 gi|218428295|emb|CAR09072.1| heat shock protein [Escherichia coli ED1a]
 gi|226899839|gb|EEH86098.1| grpE [Escherichia sp. 3_2_53FAA]
 gi|294489936|gb|ADE88692.1| co-chaperone GrpE [Escherichia coli IHE3034]
 gi|307625837|gb|ADN70141.1| heat shock protein GrpE [Escherichia coli UM146]
 gi|315284846|gb|EFU44291.1| co-chaperone GrpE [Escherichia coli MS 110-3]
 gi|323951188|gb|EGB47064.1| GrpE protein [Escherichia coli H252]
 gi|323957020|gb|EGB52746.1| GrpE protein [Escherichia coli H263]
          Length = 197

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 57/147 (38%), Positives = 93/147 (63%), Gaps = 10/147 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LRV AEMENLRRRT+ + + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 59  RDGILRVKAEMENLRRRTELDIEKAHKFALEKFINELLPVIDSLDRALEVA--DKANPD- 115

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                + +++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+   E  D  P N 
Sbjct: 116 -----MSAMVEGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGN- 169

Query: 163 IIKVVQDGYAINERVLRPALVSISKGK 189
           ++ ++Q GY +N R +R A+V+++K K
Sbjct: 170 VLGIMQKGYTLNGRTIRAAMVTVAKAK 196


>gi|82705747|ref|XP_727095.1| co-chaperone GrpE [Plasmodium yoelii yoelii str. 17XNL]
 gi|23482781|gb|EAA18660.1| co-chaperone GrpE, putative [Plasmodium yoelii yoelii]
          Length = 285

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 93/154 (60%), Gaps = 4/154 (2%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           +E L  ++  ++KYL V+AE ENLR R  +E ++ + Y I+ FA+ +L V+DNLS A+  
Sbjct: 135 DEKLVDNQVLKEKYLSVLAEKENLRTRYMKEIENNKLYCISNFAKSLLDVADNLSLAIK- 193

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
              +++    KS   + ++ +GIEMT   + +   +YG+ K +  ++KFNP  H+A+FE 
Sbjct: 194 ---NISEESLKSNEEINNIYKGIEMTETILHNIFNKYGIDKYNPINEKFNPMFHEAIFEV 250

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
              T    T+  V+Q GY IN+R+LR A V + K
Sbjct: 251 SDTTKEKGTVATVIQPGYKINDRILRAAKVGVVK 284


>gi|39995143|ref|NP_951094.1| heat shock protein GrpE [Geobacter sulfurreducens PCA]
 gi|52782890|sp|Q74H60|GRPE_GEOSL RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|39981905|gb|AAR33367.1| GrpE protein [Geobacter sulfurreducens PCA]
 gi|298504173|gb|ADI82896.1| DnaJ adenine nucleotide exchange factor GrpE [Geobacter
           sulfurreducens KN400]
          Length = 200

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 58/143 (40%), Positives = 90/143 (62%), Gaps = 11/143 (7%)

Query: 45  DKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKK 104
           DK++R  A++EN RRRT +EK++   Y      +D+L V D++ RAL  A          
Sbjct: 61  DKFVRERADLENYRRRTQKEKEELLKYGNESLLQDILPVVDSMERALGHA---------D 111

Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKIDA-KDQKFNPNMHQAMFEEPHDTVPANTI 163
           SES L ++IEGI MT   ++ TL+++GV  ++A +   F+P  HQAM +     +P NT+
Sbjct: 112 SES-LSAVIEGIRMTHGMLLGTLKKFGVVAVEAERGTVFDPAYHQAMCQVEVSELPPNTV 170

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
           ++V Q GY +NER+LRPA+VS++
Sbjct: 171 VEVFQRGYLLNERLLRPAMVSVA 193


>gi|320581976|gb|EFW96195.1| GrpE like-protein, mitochondrial [Pichia angusta DL-1]
          Length = 212

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 87/149 (58%), Gaps = 4/149 (2%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           +  E +D+Y+R +A+  NL+  T RE + A+ +++ +FA+D+L   DN   AL++    +
Sbjct: 66  ECAELKDRYVRSVADFRNLQETTKREMQKAKDFALQQFAKDLLESIDNFGHALNA----V 121

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
                KS   +  L EG++MTR     TL R+G+ KID  D+ F+PN H+A F+ P +  
Sbjct: 122 KEETLKSNQEVSQLYEGVKMTRDVFEKTLARHGLSKIDPVDEPFDPNRHEATFQAPVEGK 181

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISK 187
              T+  V Q G+ +N RVLRPA V + +
Sbjct: 182 EPGTVFHVQQPGFELNGRVLRPAKVGVVR 210


>gi|67622776|ref|XP_667827.1| co-chaperone GrpE [Cryptosporidium hominis TU502]
 gi|54658997|gb|EAL37599.1| co-chaperone GrpE [Cryptosporidium hominis]
          Length = 234

 Score =  108 bits (270), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 96/151 (63%), Gaps = 5/151 (3%)

Query: 37  LNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPL 96
           +++ EEF++K LR +AE ENLR+R  ++ + A+ YSI+ FA+ +L VSD+LSRAL S  +
Sbjct: 88  IHKIEEFKEKLLRSLAENENLRQRHRKDLEAAREYSISGFAKSLLDVSDSLSRALLS--V 145

Query: 97  DLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHD 156
           D+ N +K S   +KSL  GI MT   +    E +G+K+  +  ++FNP  H+A+FE    
Sbjct: 146 DIENVDKNS---IKSLYNGISMTYSSLEKVFEAHGIKRFQSLGKQFNPKEHEAVFEVKDT 202

Query: 157 TVPANTIIKVVQDGYAINERVLRPALVSISK 187
           + P   + + +  GY I++RVLR A V+  K
Sbjct: 203 SKPKGQVCEELLPGYKIHDRVLRAAKVATIK 233


>gi|293401396|ref|ZP_06645539.1| co-chaperone GrpE [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291305034|gb|EFE46280.1| co-chaperone GrpE [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 225

 Score =  108 bits (269), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 54/143 (37%), Positives = 87/143 (60%), Gaps = 9/143 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           ++ Y +  A+ ENL++R   E  + + Y I  FA ++L V DNL RALD          K
Sbjct: 91  KNAYFKAYADAENLKKRLQSEADNVRKYRIQGFATEVLPVLDNLERALDV---------K 141

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
             +  +K+ ++G EM  ++++  LE  GVK I+A+D+ F+PN HQA+ +E  + V +  +
Sbjct: 142 VEDPNIKNYVKGFEMIYQQLVHILENEGVKVIEAQDKPFDPNYHQALMQEAKEGVESGMV 201

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
           I+V+Q GY + +RVLR ALV +S
Sbjct: 202 IEVLQKGYMLKDRVLRAALVKVS 224


>gi|152993456|ref|YP_001359177.1| co-chaperone protein GrpE [Sulfurovum sp. NBC37-1]
 gi|166215290|sp|A6QBG1|GRPE_SULNB RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|151425317|dbj|BAF72820.1| co-chaperone protein GrpE [Sulfurovum sp. NBC37-1]
          Length = 184

 Score =  108 bits (269), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 119/184 (64%), Gaps = 6/184 (3%)

Query: 6   SEKNIDKEKNPSNANSSTAEEK--SEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDR 63
           +EK++++ +N      + ++EK   E++  E +  ++ E++DKY+R  A+ EN ++R ++
Sbjct: 5   TEKDLEQTQNEELVEEAQSDEKKDQEVDPVEAAQAEAAEYKDKYIRAHADFENAKKRLEK 64

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           +K +A +Y+   FA+D+L+V D+   AL  + ++ AN E  +E VL+ + EG+++T  ++
Sbjct: 65  DKMNAVAYANESFAKDILAVLDSFENAL--SAIEGANKENAAE-VLEKMQEGVKLTYEQL 121

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
              LE+  +K+I++K   FNP +HQA+ +   D    + I++V+Q GY I +RVLRPA+V
Sbjct: 122 KKVLEKNSIKEIESKG-TFNPEVHQAIMQVDSDEHKTDDIVQVMQKGYTIKDRVLRPAMV 180

Query: 184 SISK 187
           S +K
Sbjct: 181 STAK 184


>gi|146283646|ref|YP_001173799.1| heat shock protein GrpE [Pseudomonas stutzeri A1501]
 gi|166215281|sp|A4VPQ6|GRPE_PSEU5 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|145571851|gb|ABP80957.1| heat shock protein GrpE [Pseudomonas stutzeri A1501]
 gi|327482041|gb|AEA85351.1| heat shock protein GrpE [Pseudomonas stutzeri DSM 4166]
          Length = 189

 Score =  108 bits (269), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 114/188 (60%), Gaps = 10/188 (5%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLN-QSEEFRDKYLRVIAEMENLRRRTDREK 65
           E+N+D  +NP     S A+   ++    +SL  Q    +D+ LRV AE++N+RRR +++ 
Sbjct: 4   EQNLDN-QNPETPEQSQADVAEDLAARVQSLEEQLAAAQDQSLRVAAELQNIRRRAEQDV 62

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
           + A  +++ KFA D+L+V+D+L R L+     L+N + ++   +K + EG+E+T + ++ 
Sbjct: 63  EKAHKFALEKFAGDLLAVADSLERGLE-----LSNPDDEA---VKPMREGVELTLKLLLD 114

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
           TL R+ ++++D   + FNP  HQAM  E    V   +++KV Q GY +N R+LRPA+V +
Sbjct: 115 TLARHQLEQLDPHGEPFNPEHHQAMAMEESTHVEPGSVLKVFQKGYLLNGRLLRPAMVVV 174

Query: 186 SKGKTQNP 193
           SK     P
Sbjct: 175 SKAPADAP 182


>gi|270290306|ref|ZP_06196531.1| co-chaperone GrpE [Pediococcus acidilactici 7_4]
 gi|270281087|gb|EFA26920.1| co-chaperone GrpE [Pediococcus acidilactici 7_4]
          Length = 207

 Score =  108 bits (269), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 56/148 (37%), Positives = 93/148 (62%), Gaps = 12/148 (8%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           +E  DKY+R  AE+ N+RRR ++E+     Y   K A+ +L   DNL RAL    ++  +
Sbjct: 71  DELSDKYIRAQAEIVNMRRRNEKEQASLLKYDGQKLAKAILPALDNLERAL---TVEAEH 127

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEP-HDTVP 159
           SE+        L++G+EM +++++  L+   + +I+A  QKF+PN+HQA+   P  D  P
Sbjct: 128 SEQ--------LLKGVEMVQKDLLKALKENNIAEIEADGQKFDPNLHQAVQTVPADDDHP 179

Query: 160 ANTIIKVVQDGYAINERVLRPALVSISK 187
           A+T++KV Q GY + +RVLRPA+V +++
Sbjct: 180 ADTVVKVFQKGYILKDRVLRPAMVVVAQ 207


>gi|237653703|ref|YP_002890017.1| heat shock protein GrpE [Thauera sp. MZ1T]
 gi|237624950|gb|ACR01640.1| GrpE protein [Thauera sp. MZ1T]
          Length = 207

 Score =  108 bits (269), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 63/162 (38%), Positives = 92/162 (56%), Gaps = 16/162 (9%)

Query: 34  EESLNQSE----EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSR 89
           EE+L Q+E    E  D +LR  AE ENLRRR   +   A  ++  KFA  ML V D+L  
Sbjct: 58  EEALRQAELKAAEHHDAWLRAKAETENLRRRAQDDIAKASKFAAEKFATAMLPVKDSLEA 117

Query: 90  ALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQA 149
           AL +               ++ + EG+E+T R+++S  E   + + +   QKF+PN HQA
Sbjct: 118 ALAT-----------ENQTVEKMREGVELTLRQLISAFEGAKLAEENPLGQKFDPNKHQA 166

Query: 150 MFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQ 191
           +     D  P NT++ V+Q GY ++ERV+RPA+V +SKGK Q
Sbjct: 167 ISMVEADAEP-NTVVTVLQKGYLLSERVIRPAMVMVSKGKAQ 207


>gi|269140080|ref|YP_003296781.1| heat shock protein [Edwardsiella tarda EIB202]
 gi|267985741|gb|ACY85570.1| heat shock protein [Edwardsiella tarda EIB202]
 gi|304559907|gb|ADM42571.1| Heat shock protein GrpE [Edwardsiella tarda FL6-60]
          Length = 192

 Score =  108 bits (269), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 57/147 (38%), Positives = 97/147 (65%), Gaps = 12/147 (8%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           R+  LR  AE++N+RRR +++ + A  +++ KF+ ++L V DNL RAL+ A  D +N+E 
Sbjct: 56  REIMLRARAEVDNIRRRAEQDVEKAHKFALEKFSGELLPVIDNLERALELA--DKSNTE- 112

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM--FEEPHDTVPAN 161
                L S+IEG+E+T + ++  + ++GV+++   +  FNP +HQAM     P D  P N
Sbjct: 113 -----LVSMIEGVELTLKSLLDVVRKFGVEQVAEVNVPFNPEVHQAMTMMASP-DHAP-N 165

Query: 162 TIIKVVQDGYAINERVLRPALVSISKG 188
            ++ V+Q GY +N R++RPA+V++SKG
Sbjct: 166 QVMMVMQKGYTLNGRLIRPAMVAVSKG 192


>gi|312898005|ref|ZP_07757414.1| co-chaperone GrpE [Megasphaera micronuciformis F0359]
 gi|310620930|gb|EFQ04481.1| co-chaperone GrpE [Megasphaera micronuciformis F0359]
          Length = 191

 Score =  108 bits (269), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 53/148 (35%), Positives = 91/148 (61%), Gaps = 7/148 (4%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           +++EF++K++R+ A+  N ++R+  E+         +    +L V DN  RAL+      
Sbjct: 48  KAQEFQEKFMRLQADFANYKKRSSAERLQVAGVIKGELISTLLPVMDNFERALN------ 101

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
              EK+SE V +  IEG EM  +++   LE+ GV+KI+A D+ F+PN HQA+   P + V
Sbjct: 102 VPQEKQSEEV-RPFIEGYEMIYKQLAGVLEKAGVRKIEALDKPFDPNYHQAVMRVPAEGV 160

Query: 159 PANTIIKVVQDGYAINERVLRPALVSIS 186
             +TI++V+QDGY + ++ LRPA+V ++
Sbjct: 161 ANDTIVEVLQDGYLLGDKTLRPAMVKVA 188


>gi|304384876|ref|ZP_07367222.1| co-chaperone GrpE [Pediococcus acidilactici DSM 20284]
 gi|304329070|gb|EFL96290.1| co-chaperone GrpE [Pediococcus acidilactici DSM 20284]
          Length = 207

 Score =  108 bits (269), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 56/148 (37%), Positives = 93/148 (62%), Gaps = 12/148 (8%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           +E  DKY+R  AE+ N+RRR ++E+     Y   K A+ +L   DNL RAL    ++  +
Sbjct: 71  DELSDKYIRAQAEIVNMRRRNEKEQASLLKYDGQKLAKAILPALDNLERAL---TVEAEH 127

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEP-HDTVP 159
           SE+        L++G+EM +++++  L+   + +I+A  QKF+PN+HQA+   P  D  P
Sbjct: 128 SEQ--------LLKGVEMVQKDLLKALKENNIAEIEADGQKFDPNLHQAVQTVPADDDHP 179

Query: 160 ANTIIKVVQDGYAINERVLRPALVSISK 187
           A+T++KV Q GY + +RVLRPA+V +++
Sbjct: 180 ADTVVKVFQKGYILKDRVLRPAMVVVAQ 207


>gi|197285755|ref|YP_002151627.1| heat shock protein [Proteus mirabilis HI4320]
 gi|226737159|sp|B4F059|GRPE_PROMH RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|194683242|emb|CAR43943.1| heat shock protein [Proteus mirabilis HI4320]
          Length = 203

 Score =  108 bits (269), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 102/158 (64%), Gaps = 15/158 (9%)

Query: 34  EESLNQSEEF-RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALD 92
           E+ L QS++  R+  +R  AE+EN+RRRT ++ + A  +++ KF+ ++L V DNL RAL 
Sbjct: 57  EKQLQQSQKTEREAMIRAQAEIENIRRRTQQDVEKAHKFALEKFSNELLPVLDNLERALS 116

Query: 93  SAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-- 150
           +A  D  N +      ++ +IEG+E+T +  +  + ++G++ ++ K+  FNP +HQAM  
Sbjct: 117 AA--DHENEQ------MQPMIEGLELTLKSFLDAVRKFGIEVVEEKNVAFNPEVHQAMTL 168

Query: 151 FEEP-HDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            + P H+   AN ++ V+Q GY +N R+LRPA+V +SK
Sbjct: 169 IDSPEHE---ANHVVDVMQKGYTLNGRLLRPAMVVVSK 203


>gi|170765860|ref|ZP_02900671.1| co-chaperone GrpE [Escherichia albertii TW07627]
 gi|170125006|gb|EDS93937.1| co-chaperone GrpE [Escherichia albertii TW07627]
          Length = 197

 Score =  108 bits (269), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 91/146 (62%), Gaps = 8/146 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LRV AEMENLRRRT+ + + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 59  RDGILRVKAEMENLRRRTELDIEKAHKFALEKFINELLPVIDSLDRALEVA--DKANPD- 115

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
                + +++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+     D V    +
Sbjct: 116 -----MSAMVEGIELTLKSMLDVVRKFGVEVISETNVPLDPNVHQAIAMVESDDVEPGNV 170

Query: 164 IKVVQDGYAINERVLRPALVSISKGK 189
           + ++Q GY +N R +R A+V+++K K
Sbjct: 171 LGIMQKGYTLNGRTIRAAMVTVAKAK 196


>gi|89256511|ref|YP_513873.1| heat shock protein GrpE [Francisella tularensis subsp. holarctica
           LVS]
 gi|156502622|ref|YP_001428687.1| heat shock protein GrpE [Francisella tularensis subsp. holarctica
           FTNF002-00]
 gi|167010477|ref|ZP_02275408.1| co-chaperone GrpE [Francisella tularensis subsp. holarctica FSC200]
 gi|254369598|ref|ZP_04985609.1| protein grpE [Francisella tularensis subsp. holarctica FSC022]
 gi|254374680|ref|ZP_04990161.1| protein grpE [Francisella novicida GA99-3548]
 gi|290953980|ref|ZP_06558601.1| heat shock protein GrpE [Francisella tularensis subsp. holarctica
           URFT1]
 gi|295312657|ref|ZP_06803407.1| heat shock protein GrpE [Francisella tularensis subsp. holarctica
           URFT1]
 gi|1346177|sp|P48204|GRPE_FRATU RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|123287282|sp|Q2A329|GRPE_FRATH RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|166215263|sp|A7NCM8|GRPE_FRATF RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|893244|gb|AAA69560.1| putative [Francisella tularensis]
 gi|89144342|emb|CAJ79629.1| Chaperone protein grpE (heat shock protein family 70 cofactor)
           [Francisella tularensis subsp. holarctica LVS]
 gi|151572399|gb|EDN38053.1| protein grpE [Francisella novicida GA99-3548]
 gi|156253225|gb|ABU61731.1| co-chaperone GrpE [Francisella tularensis subsp. holarctica
           FTNF002-00]
 gi|157122552|gb|EDO66687.1| protein grpE [Francisella tularensis subsp. holarctica FSC022]
 gi|332678585|gb|AEE87714.1| Heat shock protein GrpE [Francisella cf. novicida Fx1]
          Length = 195

 Score =  108 bits (269), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 95/150 (63%), Gaps = 9/150 (6%)

Query: 38  NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD 97
           +  ++F+D+ LR  AEMEN+R+R +R+  +A+ + I KFA+++L V D++ +AL      
Sbjct: 54  DSCDQFKDEALRAKAEMENIRKRAERDVSNARKFGIEKFAKELLPVIDSIEQAL------ 107

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
               E K E  + ++ EGIE+T + ++  L++ GV+++D K +KF+PN+H+AM   P+  
Sbjct: 108 --KHEVKLEEAI-AMKEGIELTAKMLVDILKKNGVEELDPKGEKFDPNLHEAMAMIPNPE 164

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISK 187
              NTI  V Q GY +N R++R A V I K
Sbjct: 165 FEDNTIFDVFQKGYMLNGRIVRAAKVVIVK 194


>gi|254491185|ref|ZP_05104366.1| co-chaperone GrpE [Methylophaga thiooxidans DMS010]
 gi|224463698|gb|EEF79966.1| co-chaperone GrpE [Methylophaga thiooxydans DMS010]
          Length = 181

 Score =  108 bits (269), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 108/173 (62%), Gaps = 8/173 (4%)

Query: 15  NPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIA 74
           N S  N     E+S   + E++ ++++E  ++ L   A++EN+RRR  R+ + A  +++ 
Sbjct: 17  NDSEENVQPEVEQSTEKLLEDARSKADEHWNELLLARADLENMRRRHARDLESAHKHALD 76

Query: 75  KFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKK 134
           KF  ++L + D+L   L +A     N E   E+ L+++ EG+EMT + ++S + + G+++
Sbjct: 77  KFVNELLPICDSLELGLSAA-----NGE---EATLETVREGMEMTLKMLLSNIGKLGLEQ 128

Query: 135 IDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           ++ + Q F+P +HQA+  +P + + AN +I V+Q GY+ N R+LRPA+V +S+
Sbjct: 129 VNPEGQAFDPELHQAVSMQPSEGIEANQVITVMQKGYSFNGRLLRPAMVVVSQ 181


>gi|188533124|ref|YP_001906921.1| Heat shock protein [Erwinia tasmaniensis Et1/99]
 gi|226737134|sp|B2VEC6|GRPE_ERWT9 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|188028166|emb|CAO96024.1| Heat shock protein [Erwinia tasmaniensis Et1/99]
          Length = 194

 Score =  108 bits (269), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 93/147 (63%), Gaps = 8/147 (5%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            RD  LR  AE+EN+RRR + + + A  +++ KF+ ++L V D+L RAL+ A  D +N E
Sbjct: 55  VRDAQLRAQAEIENIRRRAELDVEKAHKFALEKFSNELLPVIDSLERALEVA--DKSNPE 112

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
                 L ++IEGI++T + ++  + ++GV+ +   +  FNP +HQAM     + V  N 
Sbjct: 113 ------LAAMIEGIDLTMKSLLGAVRKFGVEVVGDTNVPFNPEVHQAMSMMESEEVEPNH 166

Query: 163 IIKVVQDGYAINERVLRPALVSISKGK 189
           ++ V+Q GY +N R+LRPA+V+++K K
Sbjct: 167 VMMVMQRGYTLNGRLLRPAMVAVAKSK 193


>gi|50419777|ref|XP_458420.1| DEHA2C16830p [Debaryomyces hansenii CBS767]
 gi|52782854|sp|Q6BTP9|GRPE_DEBHA RecName: Full=GrpE protein homolog, mitochondrial; Flags: Precursor
 gi|49654086|emb|CAG86502.1| DEHA2C16830p [Debaryomyces hansenii]
          Length = 243

 Score =  108 bits (269), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 87/146 (59%), Gaps = 4/146 (2%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           + ++ Y R IA+  NL+  T  EK+ A+ +++ KFA+D+L   DN   AL++   D    
Sbjct: 98  DMKNHYARAIADFRNLQESTKLEKQKARDFALQKFAKDLLESVDNFDLALNAVKEDTL-- 155

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
             K+ S +K+L +G++MTR     TL R+G++K+D   ++F+PN H+A FE         
Sbjct: 156 --KNNSEVKNLYDGVDMTRNVFEKTLARHGIEKVDPIGEQFDPNQHEATFEIAQPDKEPG 213

Query: 162 TIIKVVQDGYAINERVLRPALVSISK 187
           T+  V Q+GY +N RVLRPA V + K
Sbjct: 214 TVFHVQQNGYTLNSRVLRPAKVGVVK 239


>gi|208779935|ref|ZP_03247279.1| co-chaperone GrpE [Francisella novicida FTG]
 gi|208744390|gb|EDZ90690.1| co-chaperone GrpE [Francisella novicida FTG]
          Length = 195

 Score =  108 bits (269), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 96/150 (64%), Gaps = 9/150 (6%)

Query: 38  NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD 97
           +  ++F+D+ LR  AEMEN+R+R +R+  +A+ + I KFA+++L V D++ +AL      
Sbjct: 54  DSCDQFKDEALRAKAEMENIRKRAERDVSNARKFGIEKFAKELLPVIDSIEQAL------ 107

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
             +  K  ES+  ++ EGIE+T + ++  L++ GV+++D K +KF+PN+H+AM   P+  
Sbjct: 108 -KHEVKLEESI--AMKEGIELTAKMLVDILKKNGVEELDPKGEKFDPNLHEAMAMIPNPE 164

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISK 187
              NTI  V Q GY +N R++R A V I K
Sbjct: 165 FEDNTIFDVFQKGYMLNGRIVRAAKVVIVK 194


>gi|301059192|ref|ZP_07200130.1| co-chaperone GrpE [delta proteobacterium NaphS2]
 gi|300446682|gb|EFK10509.1| co-chaperone GrpE [delta proteobacterium NaphS2]
          Length = 200

 Score =  108 bits (269), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 91/143 (63%), Gaps = 9/143 (6%)

Query: 45  DKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKK 104
           D YLR  AEMEN+++R  +EK++   Y      + +L V+DNL +ALD +         K
Sbjct: 66  DNYLRSQAEMENMKKRFQKEKQELVKYGNEILTKQLLPVADNLEKALDHS---------K 116

Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTII 164
            E+ L++L EG+++T + ++S LE+ GV+ + A    F+PN H+A+ E+  D+    T++
Sbjct: 117 DENSLEALREGVDLTLKGLISVLEKAGVEVVQAIGAPFDPNFHEAVSEQMDDSAEPGTVL 176

Query: 165 KVVQDGYAINERVLRPALVSISK 187
           K +Q GY +N+R++RPA+V ++K
Sbjct: 177 KELQKGYLLNDRLIRPAMVIVNK 199


>gi|301026814|ref|ZP_07190216.1| co-chaperone GrpE [Escherichia coli MS 196-1]
 gi|299879560|gb|EFI87771.1| co-chaperone GrpE [Escherichia coli MS 196-1]
 gi|327252318|gb|EGE63990.1| protein grpE [Escherichia coli STEC_7v]
 gi|332754038|gb|EGJ84410.1| protein grpE [Shigella flexneri K-671]
          Length = 179

 Score =  108 bits (269), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 93/148 (62%), Gaps = 10/148 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LRV AEMENLRRRT+ + + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 41  RDGILRVKAEMENLRRRTELDIEKAHKFALEKFINELLPVIDSLDRALEVA--DKANPD- 97

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                + +++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+   E  D  P N 
Sbjct: 98  -----MSAMVEGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGN- 151

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ ++Q GY +N R +R A+V+++K K 
Sbjct: 152 VLGIMQKGYTLNGRTIRAAMVTVAKAKA 179


>gi|82658254|ref|NP_001032461.1| grpE protein homolog 1, mitochondrial [Danio rerio]
 gi|81294299|gb|AAI08003.1| GrpE-like 1, mitochondrial [Danio rerio]
          Length = 217

 Score =  108 bits (269), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 104/184 (56%), Gaps = 15/184 (8%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           E++  +++ P  A  +  EEK+++   EE L   ++  DKY R +A+ ENLR+R+ +   
Sbjct: 44  EESGAQKQEPGTAEKAFLEEKTQL---EEQL---KDVTDKYKRALADTENLRQRSQKMID 97

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAP---LDLANSEKKSESVLKSLIEGIEMTRREM 123
           DA+ Y I  F +D+L V+D L +A +S P   +  AN        LK+L +G+ MT  ++
Sbjct: 98  DAKLYGIQGFCKDLLEVADILEKATESVPKTEISAANPH------LKNLYDGLVMTEVQI 151

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
               +++G+ K+    QKF+P  H+A+F  P +     TI  V + GY ++ R LRPALV
Sbjct: 152 QKVFQKHGLVKLSPDGQKFDPYEHEAVFHAPVEGKEPGTIALVTKVGYKLHGRTLRPALV 211

Query: 184 SISK 187
            + K
Sbjct: 212 GVVK 215


>gi|330937930|gb|EGH41717.1| heat shock protein GrpE [Pseudomonas syringae pv. pisi str. 1704B]
          Length = 187

 Score =  108 bits (269), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 101/167 (60%), Gaps = 13/167 (7%)

Query: 25  EEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVS 84
           E  + + + EE L  ++   D+ LRV A+++N+RRR +++ + A  +++ KFA D+L + 
Sbjct: 23  ELTTRVQVLEEQLAAAQ---DQSLRVAADLQNVRRRAEQDVEKAHKFALEKFAGDLLPII 79

Query: 85  DNLSRALD-SAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFN 143
           D+L R LD S+P D        ES+ + +  GIE+T +    TL+RY ++ ID   Q F+
Sbjct: 80  DSLERGLDLSSPDD--------ESI-RPMRGGIELTLKMFQDTLKRYQLEAIDPHGQPFS 130

Query: 144 PNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
            + HQAM  +    V  NT++KV Q GY +N R+LRPA+V +SK  +
Sbjct: 131 ADQHQAMAMQESADVEPNTVLKVFQKGYQLNGRLLRPAMVVVSKAPS 177


>gi|148245084|ref|YP_001219778.1| molecular chaperone GrpE [Candidatus Vesicomyosocius okutanii HA]
 gi|146326911|dbj|BAF62054.1| molecular chaperone GrpE [Candidatus Vesicomyosocius okutanii HA]
          Length = 191

 Score =  108 bits (269), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 94/141 (66%), Gaps = 8/141 (5%)

Query: 45  DKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKK 104
           DK LR  AEMENL+RR  ++ ++A  +++ +F + +L V D+LS  + +A        ++
Sbjct: 57  DKLLRSRAEMENLKRRNAKDVENAHKFALDRFVKALLEVKDSLSMGIKTA--------QE 108

Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTII 164
            ++ +K ++EG+EMT +  +STL+++GV+ I+ + + FNP +H+A+   P      N+++
Sbjct: 109 EKATVKHIVEGLEMTDKVFLSTLKKFGVEMINPEGETFNPELHEAVTMVPMTDKDPNSVL 168

Query: 165 KVVQDGYAINERVLRPALVSI 185
           +VVQ G+ +NER++RPA+V +
Sbjct: 169 EVVQFGFTLNERLVRPAMVVV 189


>gi|224824612|ref|ZP_03697719.1| GrpE protein [Lutiella nitroferrum 2002]
 gi|224603105|gb|EEG09281.1| GrpE protein [Lutiella nitroferrum 2002]
          Length = 181

 Score =  107 bits (268), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 59/152 (38%), Positives = 95/152 (62%), Gaps = 16/152 (10%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRAL--DSAPLDLA 99
           E R+++LR  AEMENLRRRT  E  +AQ Y+I KFA ++L+V D+L  AL   S   D  
Sbjct: 43  EAREQFLRSRAEMENLRRRTAEEVVNAQKYAINKFANELLAVKDSLEMALADQSGQFD-- 100

Query: 100 NSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVP 159
                      +L  G+++T ++++S  ++  +K+I+   +  +P+ HQA+  E  D  P
Sbjct: 101 -----------NLKFGVDLTLKQLVSAFDKAQIKEINPVGEALDPHRHQAISTEEADAEP 149

Query: 160 ANTIIKVVQDGYAINERVLRPALVSISKGKTQ 191
            NT+++V+Q GY + +RVLRPA+V ++K K+Q
Sbjct: 150 -NTVLRVMQKGYQVADRVLRPAMVVVAKAKSQ 180


>gi|323341741|ref|ZP_08081974.1| chaperone GrpE [Erysipelothrix rhusiopathiae ATCC 19414]
 gi|322464166|gb|EFY09359.1| chaperone GrpE [Erysipelothrix rhusiopathiae ATCC 19414]
          Length = 191

 Score =  107 bits (268), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 99/170 (58%), Gaps = 12/170 (7%)

Query: 17  SNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKF 76
           SN+ +  +E    I+  E    + E  ++ Y +++A+ ENL++R  RE    + Y I  F
Sbjct: 33  SNSENEASETDEAIDENEALRKEIETLKNDYFKMLADTENLKKRLQREHDQLRKYRIQGF 92

Query: 77  ARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID 136
           A D+L V DNL RAL            K E+  ++L EG++M   ++M++L+  GV+ I+
Sbjct: 93  AADVLPVLDNLERAL------------KQETTDEALREGVQMIYDQLMASLKAEGVEPIN 140

Query: 137 AKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           A +Q F+PN+HQAM  E  + V +N +I+  Q GY + +R+LR +LV +S
Sbjct: 141 ALNQPFDPNIHQAMMTEEKEGVESNIVIEEFQKGYMLKDRILRASLVKVS 190


>gi|241668196|ref|ZP_04755774.1| co-chaperone GrpE [Francisella philomiragia subsp. philomiragia
           ATCC 25015]
 gi|254876731|ref|ZP_05249441.1| co-chaperone grpE [Francisella philomiragia subsp. philomiragia
           ATCC 25015]
 gi|254842752|gb|EET21166.1| co-chaperone grpE [Francisella philomiragia subsp. philomiragia
           ATCC 25015]
          Length = 191

 Score =  107 bits (268), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 93/145 (64%), Gaps = 9/145 (6%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
           F+D+ LR  AEMEN+R+R +R+  +A+ + I KFA+++L V D++ +AL          E
Sbjct: 55  FKDEALRARAEMENVRKRAERDVSNARKFGIEKFAKELLPVIDSIEQAL--------KHE 106

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
            K E  + ++ EGIE+T + ++ TL++ G++++D K +KF+PN+H+AM   P+     NT
Sbjct: 107 VKLEEAI-AMKEGIELTSKMLVDTLKKNGLEELDPKGEKFDPNLHEAMAMIPNPEFEDNT 165

Query: 163 IIKVVQDGYAINERVLRPALVSISK 187
           I  V Q GY +N RV+R A V I K
Sbjct: 166 IFDVFQKGYMLNGRVVRAAKVVIVK 190


>gi|255932039|ref|XP_002557576.1| Pc12g07410 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211582195|emb|CAP80368.1| Pc12g07410 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 244

 Score =  107 bits (268), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 56/161 (34%), Positives = 97/161 (60%), Gaps = 7/161 (4%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           E+   ++ EF+DK+LR +AE  NL  R  R+   A+ ++I  FA+D+L   DN  RAL +
Sbjct: 82  EQKTKEAIEFKDKWLRSVAESRNLVERNKRDMDAARKFAIQGFAKDLLDSIDNFDRALLA 141

Query: 94  APLD-LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGV------KKIDAKDQKFNPNM 146
            P + LA ++ +    L+ L++G+ MT++ +++TL+++G+      +K+D K QKF+ N+
Sbjct: 142 VPAEKLAAAKTEENKDLQDLVDGLHMTQKILLNTLQKHGLERFDPSEKVDGKAQKFDANL 201

Query: 147 HQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           H+A F  P   +    ++ V   G+ +N RVLR A V + K
Sbjct: 202 HEATFMAPAAGLEDGDVMHVQSKGFRLNGRVLRAAKVGVVK 242


>gi|256269600|gb|EEU04882.1| Mge1p [Saccharomyces cerevisiae JAY291]
 gi|259149711|emb|CAY86515.1| Mge1p [Saccharomyces cerevisiae EC1118]
 gi|323302954|gb|EGA56758.1| Mge1p [Saccharomyces cerevisiae FostersB]
 gi|323307290|gb|EGA60570.1| Mge1p [Saccharomyces cerevisiae FostersO]
 gi|323331553|gb|EGA72968.1| Mge1p [Saccharomyces cerevisiae AWRI796]
 gi|323346422|gb|EGA80710.1| Mge1p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 228

 Score =  107 bits (268), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 62/174 (35%), Positives = 101/174 (58%), Gaps = 10/174 (5%)

Query: 20  NSSTAEEKSEINIPEESLN----QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAK 75
           N    EE+SEI   E  L+    ++ E +D+ LR +A+  NL++ T ++ + A+ +++ K
Sbjct: 57  NEDLTEEQSEIKKLESQLSAKTKEASELKDRLLRSVADFRNLQQVTKKDIQKAKDFALQK 116

Query: 76  FARDMLSVSDNLSRALDSAPL-DLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKK 134
           FA+D+L   DN   AL++    DL  S++ S+     L  G+ MTR    +TL ++G++K
Sbjct: 117 FAKDLLESVDNFGHALNAFKEEDLQKSKEISD-----LYTGVRMTRDVFENTLRKHGIEK 171

Query: 135 IDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           +D   + F+PN H+A FE P       T+  V Q G+ +N+RV+RPA V I KG
Sbjct: 172 LDPLGEPFDPNKHEATFELPQPDKEPGTVFHVQQLGFTLNDRVIRPAKVGIVKG 225


>gi|149176810|ref|ZP_01855421.1| GrpE protein [Planctomyces maris DSM 8797]
 gi|148844451|gb|EDL58803.1| GrpE protein [Planctomyces maris DSM 8797]
          Length = 182

 Score =  107 bits (268), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 97/157 (61%), Gaps = 9/157 (5%)

Query: 36  SLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAP 95
           ++++ +E +D++LR  AE++N+R+R  +E +  + Y+ A F +D+L   DNL RA+D+A 
Sbjct: 35  AISERDENQDRFLRSQAELDNVRKRHQKEMELLRQYAAAPFIQDLLPALDNLKRAVDAA- 93

Query: 96  LDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPH 155
                   +S   +  L +G+EM  ++++  L ++ V  IDA  + F+PN+H+A+ + P 
Sbjct: 94  --------ESADQVGDLKQGVEMVAKQLLDVLSKHNVTPIDALGKPFDPNLHEALQQMPS 145

Query: 156 DTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQN 192
           D  P  T+I+ ++ G+ +N+RV+RP  V +S G  + 
Sbjct: 146 DEHPPMTVIQELEQGFILNDRVVRPTKVIVSSGPAEG 182


>gi|49082586|gb|AAT50693.1| PA4762 [synthetic construct]
          Length = 187

 Score =  107 bits (268), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 93/150 (62%), Gaps = 8/150 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D+ LR++A+++N+RRR +++ + A  +++ KFA D+L+V D L R L+        S+ 
Sbjct: 38  QDQALRMVADLQNVRRRAEQDVEKAHKFALEKFAGDLLAVVDTLERGLEM-------SDP 90

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
             E++ K + EG+E+T +    TL RY V+ ++ + + FNP  HQAM  +   +    ++
Sbjct: 91  NDEAI-KPMREGMELTLKMFDDTLRRYQVEALNPEGEPFNPEQHQAMAMQESASAEPGSV 149

Query: 164 IKVVQDGYAINERVLRPALVSISKGKTQNP 193
           +KV Q GY +N R+LRPA+V +SK   + P
Sbjct: 150 LKVFQKGYLLNGRLLRPAMVVVSKAPAETP 179


>gi|15599956|ref|NP_253450.1| heat shock protein GrpE [Pseudomonas aeruginosa PAO1]
 gi|107103859|ref|ZP_01367777.1| hypothetical protein PaerPA_01004930 [Pseudomonas aeruginosa PACS2]
 gi|116052909|ref|YP_793226.1| heat shock protein GrpE [Pseudomonas aeruginosa UCBPP-PA14]
 gi|254238503|ref|ZP_04931826.1| heat shock protein GrpE [Pseudomonas aeruginosa C3719]
 gi|254244337|ref|ZP_04937659.1| heat shock protein GrpE [Pseudomonas aeruginosa 2192]
 gi|296391589|ref|ZP_06881064.1| heat shock protein GrpE [Pseudomonas aeruginosa PAb1]
 gi|313109743|ref|ZP_07795683.1| heat shock protein GrpE [Pseudomonas aeruginosa 39016]
 gi|52782978|sp|Q9HV42|GRPE_PSEAE RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|122257080|sp|Q02FR0|GRPE_PSEAB RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|9951026|gb|AAG08148.1|AE004890_1 heat shock protein GrpE [Pseudomonas aeruginosa PAO1]
 gi|115588130|gb|ABJ14145.1| heat shock protein GrpE [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126170434|gb|EAZ55945.1| heat shock protein GrpE [Pseudomonas aeruginosa C3719]
 gi|126197715|gb|EAZ61778.1| heat shock protein GrpE [Pseudomonas aeruginosa 2192]
 gi|310882185|gb|EFQ40779.1| heat shock protein GrpE [Pseudomonas aeruginosa 39016]
          Length = 186

 Score =  107 bits (268), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 93/150 (62%), Gaps = 8/150 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D+ LR++A+++N+RRR +++ + A  +++ KFA D+L+V D L R L+        S+ 
Sbjct: 38  QDQALRMVADLQNVRRRAEQDVEKAHKFALEKFAGDLLAVVDTLERGLEM-------SDP 90

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
             E++ K + EG+E+T +    TL RY V+ ++ + + FNP  HQAM  +   +    ++
Sbjct: 91  NDEAI-KPMREGMELTLKMFDDTLRRYQVEALNPEGEPFNPEQHQAMAMQESASAEPGSV 149

Query: 164 IKVVQDGYAINERVLRPALVSISKGKTQNP 193
           +KV Q GY +N R+LRPA+V +SK   + P
Sbjct: 150 LKVFQKGYLLNGRLLRPAMVVVSKAPAETP 179


>gi|329896049|ref|ZP_08271285.1| Heat shock protein GrpE [gamma proteobacterium IMCC3088]
 gi|328922009|gb|EGG29373.1| Heat shock protein GrpE [gamma proteobacterium IMCC3088]
          Length = 190

 Score =  107 bits (268), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 57/155 (36%), Positives = 96/155 (61%), Gaps = 9/155 (5%)

Query: 35  ESLNQS-EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           E+L Q+  E ++  LR  A+  N +RR ++E + A+ +++  F+R++L V+DNL RAL  
Sbjct: 43  EALEQALGEAKEAVLRAQADAINAQRRAEKEIEKARKFALEGFSREVLVVADNLERALS- 101

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
               + N E +S   +K ++EGIE+T +     L ++ V+ +D   + F+P +HQAM   
Sbjct: 102 ----VVNPEDES---VKPIVEGIELTLKSFSDVLAKFNVEAVDPHGEPFDPQVHQAMSMV 154

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           P+  V  NT+I V+Q GY +N R++RPA+V +SK 
Sbjct: 155 PNPEVEPNTVIAVMQKGYTLNGRLIRPAMVMVSKA 189


>gi|115314943|ref|YP_763666.1| chaperone GrpE [Francisella tularensis subsp. holarctica OSU18]
 gi|122325043|sp|Q0BLK5|GRPE_FRATO RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|115129842|gb|ABI83029.1| chaperone GrpE [Francisella tularensis subsp. holarctica OSU18]
          Length = 195

 Score =  107 bits (268), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 95/150 (63%), Gaps = 9/150 (6%)

Query: 38  NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD 97
           +  ++F+D+ LR  AEMEN+R+R +R+  +A+ + I KFA+++L V D++ +AL      
Sbjct: 54  DSCDQFKDEALRAKAEMENIRKRAERDVSNARKFGIEKFAKELLPVIDSIEQAL------ 107

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
               E K E  + ++ EGIE+T + ++  L++ GV+++D K +KF+PN+H+AM   P+  
Sbjct: 108 --KHEVKLEEAI-AMKEGIELTAKILVDILKKNGVEELDPKGEKFDPNLHEAMAMIPNPE 164

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISK 187
              NTI  V Q GY +N R++R A V I K
Sbjct: 165 FEDNTIFDVFQKGYMLNGRIVRAAKVVIVK 194


>gi|260598992|ref|YP_003211563.1| heat shock protein GrpE [Cronobacter turicensis z3032]
 gi|260218169|emb|CBA33010.1| Protein grpE [Cronobacter turicensis z3032]
          Length = 203

 Score =  107 bits (268), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 54/147 (36%), Positives = 93/147 (63%), Gaps = 8/147 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LR+ AEMENLRRRT+++ + A  +++ KF  ++L V D+L RAL+     +AN E 
Sbjct: 65  RDNVLRMKAEMENLRRRTEQDIEKAHKFALEKFINELLPVIDSLDRALE-----VANKEN 119

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           +    + +++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+     + V  N +
Sbjct: 120 QD---MAAMVEGIELTLKSMLDVVRKFGVEVIADTNVPLDPNVHQAIAMVESEDVAPNHV 176

Query: 164 IKVVQDGYAINERVLRPALVSISKGKT 190
           + V+Q GY +N R +R A+V+++K K 
Sbjct: 177 LAVMQKGYTLNGRTIRAAMVTVAKAKA 203


>gi|254373224|ref|ZP_04988713.1| chaperone protein grpE [Francisella tularensis subsp. novicida
           GA99-3549]
 gi|151570951|gb|EDN36605.1| chaperone protein grpE [Francisella novicida GA99-3549]
          Length = 195

 Score =  107 bits (268), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 95/150 (63%), Gaps = 9/150 (6%)

Query: 38  NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD 97
           +  ++F+D+ LR  AEMEN+R+R +R+  +A+ + I KFA+++L V D++ +AL      
Sbjct: 54  DSCDQFKDEALRAKAEMENIRKRAERDVSNARKFGIEKFAKELLPVIDSIEQAL------ 107

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
               E K E  + ++ EGIE+T + ++  L++ GV+++D K +KF+PN+H+AM   P+  
Sbjct: 108 --KHEVKLEEAI-AMKEGIELTAKMLVDILKKNGVEELDPKGEKFDPNLHEAMAMIPNPE 164

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISK 187
              NTI  V Q GY +N R++R A V I K
Sbjct: 165 FEDNTIFDVFQKGYMLNGRIVRAAKVVIVK 194


>gi|6324806|ref|NP_014875.1| Mge1p [Saccharomyces cerevisiae S288c]
 gi|585221|sp|P38523|GRPE_YEAST RecName: Full=GrpE protein homolog, mitochondrial; Flags: Precursor
 gi|457594|dbj|BAA05058.1| GrpE homologue [Saccharomyces cerevisiae]
 gi|468512|emb|CAA55145.1| GRPE [Saccharomyces cerevisiae]
 gi|493576|gb|AAA19253.1| Mge1p [Saccharomyces cerevisiae]
 gi|1420533|emb|CAA99452.1| MGE1 [Saccharomyces cerevisiae]
 gi|151945320|gb|EDN63563.1| mitochondrial grpe [Saccharomyces cerevisiae YJM789]
 gi|190407540|gb|EDV10807.1| hypothetical protein SCRG_01618 [Saccharomyces cerevisiae RM11-1a]
 gi|207341003|gb|EDZ69181.1| YOR232Wp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|285815109|tpg|DAA11002.1| TPA: Mge1p [Saccharomyces cerevisiae S288c]
 gi|323352157|gb|EGA84694.1| Mge1p [Saccharomyces cerevisiae VL3]
          Length = 228

 Score =  107 bits (268), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 62/174 (35%), Positives = 101/174 (58%), Gaps = 10/174 (5%)

Query: 20  NSSTAEEKSEINIPEESLN----QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAK 75
           N    EE+SEI   E  L+    ++ E +D+ LR +A+  NL++ T ++ + A+ +++ K
Sbjct: 57  NEDLTEEQSEIKKLESQLSAKTKEASELKDRLLRSVADFRNLQQVTKKDIQKAKDFALQK 116

Query: 76  FARDMLSVSDNLSRALDSAPL-DLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKK 134
           FA+D+L   DN   AL++    DL  S++ S+     L  G+ MTR    +TL ++G++K
Sbjct: 117 FAKDLLESVDNFGHALNAFKEEDLQKSKEISD-----LYTGVRMTRDVFENTLRKHGIEK 171

Query: 135 IDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           +D   + F+PN H+A FE P       T+  V Q G+ +N+RV+RPA V I KG
Sbjct: 172 LDPLGEPFDPNKHEATFELPQPDKEPGTVFHVQQLGFTLNDRVIRPAKVGIVKG 225


>gi|269468561|gb|EEZ80210.1| molecular chaperone GrpE [uncultured SUP05 cluster bacterium]
          Length = 181

 Score =  107 bits (268), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 106/176 (60%), Gaps = 12/176 (6%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEF----RDKYLRVIAEMENLRRRTDREKKDAQ 69
           K P + N     +++E N  +  L Q+++      DK LR  AEMENL+RR  ++ ++A 
Sbjct: 12  KKPKDENIKKKTKETEENDLQSQLEQAQQSAKDNWDKLLRSQAEMENLKRRNAKDLENAH 71

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
            +++  F + +L V D+L+  L +A     N EK   + ++ +IEG+EMT +  +ST+E+
Sbjct: 72  KFALDGFVKALLEVKDSLTMGLKTA-----NEEK---ATIEHIIEGLEMTDKVFLSTMEK 123

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
           +GVK I  + + FNP  H+A+   P     +N++++VVQ G+ +N R++RPA+V +
Sbjct: 124 FGVKAIRPEGETFNPEFHEAVTMVPVPDKESNSVLEVVQTGFTLNGRLVRPAMVIV 179


>gi|283786233|ref|YP_003366098.1| heat shock protein (heat shock protein B25.3) [Citrobacter
           rodentium ICC168]
 gi|282949687|emb|CBG89306.1| heat shock protein (heat shock protein B25.3) [Citrobacter
           rodentium ICC168]
          Length = 197

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 94/147 (63%), Gaps = 10/147 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LR+ AEMENLRRRT+++ + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 59  RDSMLRMKAEMENLRRRTEQDVEKAHKFALEKFVNELLPVIDSLDRALEVA--DKANPD- 115

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                + +++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+   E  +  P N 
Sbjct: 116 -----MAAMVEGIELTLKSMLDVVRKFGVEVIAETNVALDPNVHQAIAMVESEEVAPGN- 169

Query: 163 IIKVVQDGYAINERVLRPALVSISKGK 189
           ++ ++Q GY +N R +R A+V+++K K
Sbjct: 170 VLGIMQKGYTLNGRTIRAAMVTVAKAK 196


>gi|323978477|gb|EGB73560.1| GrpE protein [Escherichia coli TW10509]
          Length = 241

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 91/147 (61%), Gaps = 10/147 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LRV AEMENLRRRT+ + + A  +++ KF  ++L V D+L RAL+ A         
Sbjct: 104 RDGILRVKAEMENLRRRTELDIEKAHKFALEKFINELLPVIDSLDRALEVA--------D 155

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
           K+   + +++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+   E  D  P N 
Sbjct: 156 KTNPDMSAMVEGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGN- 214

Query: 163 IIKVVQDGYAINERVLRPALVSISKGK 189
           ++ ++Q GY +N R +R A+V+++K K
Sbjct: 215 VLGIMQKGYTLNGRTIRAAMVTVAKAK 241


>gi|221219864|gb|ACM08593.1| GrpE protein homolog 1, mitochondrial precursor [Salmo salar]
          Length = 216

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 102/178 (57%), Gaps = 9/178 (5%)

Query: 11  DKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQS 70
           D+    S A    AEEK ++   EE L   +E  DKY R +A+ ENLR R+ +  +D + 
Sbjct: 45  DQNAEQSAAEKVLAEEKGQL---EEQL---KEVTDKYKRALADTENLRTRSQKMVEDTKL 98

Query: 71  YSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERY 130
           Y I  F +D+L V+D L +A +S P +  +S+K     LK+L +G+ MT +++     ++
Sbjct: 99  YGIQGFCKDLLEVADILEKATESVPSEEVSSQKNPH--LKNLYDGLVMTDKQIQKVFTKH 156

Query: 131 GVKKIDA-KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           G+ K++    QKF+P  H+A+F  P +     T+  V + GY ++ R LRPALV ++K
Sbjct: 157 GLVKLNPDGGQKFDPYEHEALFHSPVEGKEPGTVAIVTKVGYKLHGRTLRPALVGVAK 214


>gi|156932845|ref|YP_001436761.1| heat shock protein GrpE [Cronobacter sakazakii ATCC BAA-894]
 gi|166215262|sp|A7MHW7|GRPE_ENTS8 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|156531099|gb|ABU75925.1| hypothetical protein ESA_00642 [Cronobacter sakazakii ATCC BAA-894]
          Length = 197

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 54/147 (36%), Positives = 93/147 (63%), Gaps = 8/147 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LR+ AEMENLRRRT+++ + A  +++ KF  ++L V D+L RAL+     +AN E 
Sbjct: 59  RDTVLRMKAEMENLRRRTEQDIEKAHKFALEKFINELLPVIDSLDRALE-----VANKEN 113

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           +    + +++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+     + V  N +
Sbjct: 114 QD---MAAMVEGIELTLKSMLDVVRKFGVEVIADTNVPLDPNVHQAIAMVESEDVAPNHV 170

Query: 164 IKVVQDGYAINERVLRPALVSISKGKT 190
           + V+Q GY +N R +R A+V+++K K 
Sbjct: 171 LAVMQKGYTLNGRTIRAAMVTVAKAKA 197


>gi|170719890|ref|YP_001747578.1| heat shock protein GrpE [Pseudomonas putida W619]
 gi|254799608|sp|B1J253|GRPE_PSEPW RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|169757893|gb|ACA71209.1| GrpE protein [Pseudomonas putida W619]
          Length = 184

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 105/184 (57%), Gaps = 17/184 (9%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           ++EK+++ E+  +  N +  +E  E         Q    +D+ LR +A+++N+RRR +++
Sbjct: 6   LNEKDLNAEEAGAVDNGARVQELEE---------QLAAAKDQSLRAVADLQNVRRRAEQD 56

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
            + A  +++ KFA D+L V       +DS  L LA+S  + E V K + EG+E+T +   
Sbjct: 57  VEKAHKFALEKFAGDLLPV-------IDSLELALAHSSAEDEQV-KKIREGVELTLKMFQ 108

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
            TL+RY ++ ID   Q FN   HQAM  +    V  N+++ V Q GY +N R+LRPA+V 
Sbjct: 109 DTLKRYNLEAIDPHGQPFNAEHHQAMAMQESAEVEPNSVLNVFQKGYLLNGRLLRPAMVV 168

Query: 185 ISKG 188
           +SK 
Sbjct: 169 VSKA 172


>gi|168773461|ref|ZP_02798468.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4196]
 gi|189009971|ref|ZP_03006161.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4076]
 gi|189402159|ref|ZP_03006607.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4401]
 gi|189403162|ref|ZP_03006980.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4486]
 gi|195939664|ref|ZP_03085046.1| heat shock protein GrpE [Escherichia coli O157:H7 str. EC4024]
 gi|208805710|ref|ZP_03248047.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4206]
 gi|208812975|ref|ZP_03254304.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4045]
 gi|208821074|ref|ZP_03261394.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4042]
 gi|209400581|ref|YP_002272083.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4115]
 gi|254794559|ref|YP_003079396.1| heat shock protein GrpE [Escherichia coli O157:H7 str. TW14359]
 gi|226737127|sp|B5Z231|GRPE_ECO5E RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|187770604|gb|EDU34448.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4196]
 gi|189003442|gb|EDU72428.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4076]
 gi|189357337|gb|EDU75756.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4401]
 gi|189362004|gb|EDU80423.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4486]
 gi|208725511|gb|EDZ75112.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4206]
 gi|208734252|gb|EDZ82939.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4045]
 gi|208741197|gb|EDZ88879.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4042]
 gi|209161981|gb|ACI39414.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4115]
 gi|209762512|gb|ACI79568.1| heat shock protein GrpE [Escherichia coli]
 gi|209762516|gb|ACI79570.1| heat shock protein GrpE [Escherichia coli]
 gi|254593959|gb|ACT73320.1| heat shock protein [Escherichia coli O157:H7 str. TW14359]
          Length = 197

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 93/148 (62%), Gaps = 10/148 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LRV AEMENLRRRT+ + + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 59  RDGILRVKAEMENLRRRTELDIEKAHKFALEKFINELLPVIDSLDRALEVA--DKANPD- 115

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                + +++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+   E  D  P N 
Sbjct: 116 -----MSAMVEGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGN- 169

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ ++Q GY +N R +R A+V+++K K 
Sbjct: 170 VLGIMQKGYTLNGRTIRAAMVTVAKVKA 197


>gi|290476145|ref|YP_003469045.1| Hsp 24 nucleotide exchange factor [Xenorhabdus bovienii SS-2004]
 gi|289175478|emb|CBJ82281.1| Hsp 24 nucleotide exchange factor [Xenorhabdus bovienii SS-2004]
          Length = 193

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/155 (36%), Positives = 94/155 (60%), Gaps = 9/155 (5%)

Query: 34  EESLNQSEEF-RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALD 92
           EE L Q++   RD  LR  AE+EN+RRRT+ + + A  +++ +FA ++L V DNL RAL+
Sbjct: 47  EEQLKQAQIGERDAMLRARAEVENIRRRTELDIEKAHKFALERFANELLPVIDNLERALE 106

Query: 93  SAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFE 152
           +          +S   L  +IEG+E+T +   + + ++G++ +   +  FNP +HQAM  
Sbjct: 107 AV--------DRSNDALLPMIEGVELTLKSFTNAVGKFGIEVVGDTNVPFNPEVHQAMTM 158

Query: 153 EPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
              D    N ++ V+Q GY +N R+LRPA+V++SK
Sbjct: 159 MESDQHEPNHVMLVMQKGYTLNGRLLRPAMVAVSK 193


>gi|257092141|ref|YP_003165782.1| GrpE protein [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
 gi|257044665|gb|ACV33853.1| GrpE protein [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
          Length = 188

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 96/166 (57%), Gaps = 26/166 (15%)

Query: 34  EESLNQSE----EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSR 89
           EESL Q+E    E+ D +LR  AE EN+RRR   +   A  YSI +FAR++L+V D+L  
Sbjct: 40  EESLRQAELKAAEYHDAWLRAKAEAENVRRRAQEDIVKASKYSIDRFARELLAVKDSLEA 99

Query: 90  ALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQA 149
           AL +  L            + S+  G E+T +++++  E+  + +I+   QKF+P+ HQA
Sbjct: 100 ALSTETL-----------TVDSVRSGTELTLKQLVAAFEKSALTEINPLGQKFDPHHHQA 148

Query: 150 MF-----EEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           +      +EP      NT++ V+Q GY + +RVLRPALV ++K  T
Sbjct: 149 ISVVESQQEP------NTVVTVLQKGYLLADRVLRPALVVVAKSTT 188


>gi|255722459|ref|XP_002546164.1| hypothetical protein CTRG_00946 [Candida tropicalis MYA-3404]
 gi|240136653|gb|EER36206.1| hypothetical protein CTRG_00946 [Candida tropicalis MYA-3404]
          Length = 242

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 85/144 (59%), Gaps = 4/144 (2%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           ++ Y R IA+  +L+  T  E + A+ +++ KFA+D+L   DN + AL      +     
Sbjct: 98  KNHYARAIADFRHLQETTKVEVQKAKDFALQKFAKDLLDSLDNFNLALGH----VKEETL 153

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           K+ + +K+L EG++MT+     TL +YG+ KID  D+ F+PN+H+A F+  H      TI
Sbjct: 154 KTNAEVKNLYEGVDMTKNVFEKTLNKYGINKIDPIDEPFDPNLHEATFQMVHPDKQPGTI 213

Query: 164 IKVVQDGYAINERVLRPALVSISK 187
             V Q GY +NERVLRPA V + K
Sbjct: 214 FHVQQVGYTLNERVLRPAKVGVVK 237


>gi|115384182|ref|XP_001208638.1| hypothetical protein ATEG_01273 [Aspergillus terreus NIH2624]
 gi|114196330|gb|EAU38030.1| hypothetical protein ATEG_01273 [Aspergillus terreus NIH2624]
          Length = 247

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 56/153 (36%), Positives = 92/153 (60%), Gaps = 7/153 (4%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           + +DKY+R +A+  NL+ RT RE ++A++++I +FA D+L   DN  RAL + P D  +S
Sbjct: 93  DLKDKYVRSVADFLNLQERTKREMENARNFAIQRFAVDLLESVDNFDRALLAVPEDKLSS 152

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI-------DAKDQKFNPNMHQAMFEEP 154
           +      L++ +EG++MT+  MM+ L+++G+++        D K QKF+PN H+A F   
Sbjct: 153 DSPEHKDLQNFVEGVKMTQNIMMNALKKHGLERFDPSEPAEDGKAQKFDPNRHEATFMAK 212

Query: 155 HDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            D      I+ V   G+ +N RVLR A V + K
Sbjct: 213 VDGKENGDIMYVQSKGFTLNGRVLRAAKVGVVK 245


>gi|304570544|ref|YP_265794.2| GrpE protein (HSP-70 cofactor) [Candidatus Pelagibacter ubique
           HTCC1062]
          Length = 211

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 69/179 (38%), Positives = 104/179 (58%), Gaps = 14/179 (7%)

Query: 24  AEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSV 83
            EE  EI  PEE +   +E  DK  R  AEMEN RRR ++EK DA  Y    FA++ L++
Sbjct: 36  TEEAKEIT-PEEKI---KELEDKLTRTFAEMENQRRRFEKEKDDAFDYGGFSFAKEALNL 91

Query: 84  SDNLSRA---LDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQ 140
            DNL R+   L+S  + L ++E      LK  +E  E+  ++M+S   + G+  + +  +
Sbjct: 92  IDNLERSKQILESDEV-LKDTE-----ALKKTLEHFEIISKDMVSIFSKNGITPVVSIGK 145

Query: 141 KFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKE 199
           K +PN HQAM E   D     TI++ +Q G+ + +R+LRPALV +SK KT+ P ++K E
Sbjct: 146 KLDPNQHQAMMEIDDDQKEPGTIVQEIQKGFMMKDRLLRPALVGVSK-KTKTPDDQKSE 203


>gi|146312735|ref|YP_001177809.1| heat shock protein GrpE [Enterobacter sp. 638]
 gi|167008733|sp|A4WDH8|GRPE_ENT38 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|145319611|gb|ABP61758.1| GrpE protein [Enterobacter sp. 638]
          Length = 197

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 92/146 (63%), Gaps = 8/146 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           R+  LRV AEMENLRRRT+ + + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 59  REGVLRVKAEMENLRRRTELDVEKAHKFALEKFVNELLPVIDSLDRALEVA--DKANPD- 115

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
                + +++EG+E+T + M+  + ++GV+ +   +   +PN+HQA+     + V A  +
Sbjct: 116 -----MTAMVEGLELTLKSMLDVVRKFGVEVVAETNVALDPNVHQAIAMVESEDVAAGNV 170

Query: 164 IKVVQDGYAINERVLRPALVSISKGK 189
           + V+Q GY +N R +R A+V+++K K
Sbjct: 171 LAVMQKGYTLNGRTIRAAMVTVAKAK 196


>gi|149375771|ref|ZP_01893539.1| Molecular chaperone GrpE (heat shock protein) [Marinobacter
           algicola DG893]
 gi|149359896|gb|EDM48352.1| Molecular chaperone GrpE (heat shock protein) [Marinobacter
           algicola DG893]
          Length = 201

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 106/170 (62%), Gaps = 8/170 (4%)

Query: 20  NSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARD 79
           +S+ A  +SEI + +    Q++EF+++ LR  AEM+N+RRR + + + A  +++ KF ++
Sbjct: 31  DSAEAGPESEIEVLK---AQAQEFQEQMLRSQAEMQNVRRRAEIDVEKAHKFALEKFVKE 87

Query: 80  MLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKD 139
           +L V+D+L +A++S         + +  ++ S+ EG+EMT    M +L ++ V +++   
Sbjct: 88  LLPVADSLEKAVEST-----EGHENAGELVASIREGVEMTLNLFMGSLGKFNVVQLNPVG 142

Query: 140 QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
           + F+P  H+AM   P      N+++ VVQ GY +N+R++RPA+V ++K +
Sbjct: 143 EPFDPQQHEAMSMVPAPDAEPNSVVAVVQKGYTLNDRLVRPAMVVVAKAE 192


>gi|323335443|gb|EGA76729.1| Mge1p [Saccharomyces cerevisiae Vin13]
          Length = 228

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 62/174 (35%), Positives = 100/174 (57%), Gaps = 10/174 (5%)

Query: 20  NSSTAEEKSEINIPEESLN----QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAK 75
           N    EE+SEI   E  L+    ++ E +D+ LR +A+  NL++ T ++   A+ +++ K
Sbjct: 57  NEDLTEEQSEIKKLESQLSAKTKEASELKDRLLRSVADFRNLQQVTKKDIXKAKDFALQK 116

Query: 76  FARDMLSVSDNLSRALDSAPL-DLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKK 134
           FA+D+L   DN   AL++    DL  S++ S+     L  G+ MTR    +TL ++G++K
Sbjct: 117 FAKDLLESVDNFGHALNAFKEEDLQKSKEISD-----LYTGVRMTRDVFENTLRKHGIEK 171

Query: 135 IDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           +D   + F+PN H+A FE P       T+  V Q G+ +N+RV+RPA V I KG
Sbjct: 172 LDPLGEPFDPNKHEATFELPQPDKEPGTVFHVQQLGFTLNDRVIRPAKVGIVKG 225


>gi|94676994|ref|YP_589038.1| co-chaperone GrpE [Baumannia cicadellinicola str. Hc (Homalodisca
           coagulata)]
 gi|123260501|sp|Q1LSM6|GRPE_BAUCH RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|94220144|gb|ABF14303.1| co-chaperone GrpE [Baumannia cicadellinicola str. Hc (Homalodisca
           coagulata)]
          Length = 198

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/147 (38%), Positives = 93/147 (63%), Gaps = 8/147 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LR  AE+EN+RRR + E +    +S+ +F  ++L V DNL RAL+        S+K
Sbjct: 60  RDLLLRSKAEIENMRRRNEIEVEKVYKFSLERFVSELLPVIDNLERALEM-------SDK 112

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
            S++ L S IEGIE+T + +++ ++++G+K +      FNP++HQAM     +    N +
Sbjct: 113 SSQN-LASTIEGIELTLKSLLNVVQKFGIKVVSETHVPFNPDIHQAMTILESEEHEPNHV 171

Query: 164 IKVVQDGYAINERVLRPALVSISKGKT 190
           I V+Q GY +N R++RPA+V++SK K+
Sbjct: 172 IIVMQKGYLLNGRLIRPAMVTVSKTKS 198


>gi|149926209|ref|ZP_01914471.1| Putative heat shock protein [Limnobacter sp. MED105]
 gi|149825027|gb|EDM84239.1| Putative heat shock protein [Limnobacter sp. MED105]
          Length = 199

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 94/158 (59%), Gaps = 15/158 (9%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           E + ++ E+ ++ YLR+ A+MENLRRRT  +   A  Y+I  FA  ++ V D+L  AL  
Sbjct: 53  ENAHHEVEKSKEVYLRLAADMENLRRRTQEDVAKAHKYAIESFAESLVPVRDSLEMAL-- 110

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
                   E ++   LK   +G+  T R++ +  ER  V  ++   +KFNPN HQA+   
Sbjct: 111 ------AVENQTPEALK---DGVAATLRQLEAAFERGKVVVLNPVGEKFNPNQHQAVAMV 161

Query: 154 PHDTV-PA---NTIIKVVQDGYAINERVLRPALVSISK 187
           P D+V PA   N ++ V+Q GY IN+RVLRPALVS+++
Sbjct: 162 PGDSVDPAVASNHVVAVLQKGYLINDRVLRPALVSVAQ 199


>gi|156098693|ref|XP_001615362.1| co-chaperone GrpE [Plasmodium vivax SaI-1]
 gi|148804236|gb|EDL45635.1| co-chaperone GrpE, putative [Plasmodium vivax]
          Length = 306

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 96/154 (62%), Gaps = 4/154 (2%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           EE +  ++  ++KYL V+AE ENLR R  +E ++++ Y I+ FA+ +L V+DNLS A+ +
Sbjct: 156 EEKMVDNKILKEKYLSVLAENENLRHRYVKEIENSKLYCISNFAKSLLDVADNLSLAIKN 215

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
              +   S K++E +  ++ +GI+MT   + +   +YG+ K D  ++KFNP  H+A+FE 
Sbjct: 216 INEE---SLKQNEEI-SNIYKGIQMTETILHNIFNKYGIDKYDPINEKFNPLFHEALFEI 271

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
             DT    T+  VVQ GY I +R+LR A V + K
Sbjct: 272 NDDTKEKGTVATVVQQGYKIKDRILRAAKVGVVK 305


>gi|118579829|ref|YP_901079.1| GrpE protein [Pelobacter propionicus DSM 2379]
 gi|166215273|sp|A1ANV1|GRPE_PELPD RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|118502539|gb|ABK99021.1| GrpE protein [Pelobacter propionicus DSM 2379]
          Length = 190

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 101/174 (58%), Gaps = 16/174 (9%)

Query: 17  SNANSSTAEEKSEINIPEESLNQSE----EFRDKYLRVIAEMENLRRRTDREKKDAQSYS 72
           S A ++T EE+  I+  EE L   E    E  D+++R  A++EN R+R++REK++  +Y 
Sbjct: 25  SAAEAATPEER--ISRLEEQLAAKEAECRENWDRFVRERADLENFRKRSNREKEELLNYG 82

Query: 73  IAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGV 132
                 ++L V DNL RAL  A          +E+    L EG++M    +++ ++++GV
Sbjct: 83  TKSLLEEILPVVDNLERALSHA----------NENGSTGLTEGVQMIHGLLLNAMKKFGV 132

Query: 133 KKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
             ++     F+P+ HQAM + P D  P NT+++  Q GY + ER+LRPA+VS++
Sbjct: 133 TPLETSGAPFDPSFHQAMTQIPTDEHPPNTVVEEFQKGYLLKERLLRPAMVSVA 186


>gi|68475146|ref|XP_718291.1| potential mitochondrial presequence-associated import motor subunit
           [Candida albicans SC5314]
 gi|68475339|ref|XP_718192.1| potential mitochondrial presequence-associated import motor subunit
           [Candida albicans SC5314]
 gi|46439949|gb|EAK99260.1| potential mitochondrial presequence-associated import motor subunit
           [Candida albicans SC5314]
 gi|46440052|gb|EAK99362.1| potential mitochondrial presequence-associated import motor subunit
           [Candida albicans SC5314]
 gi|238879623|gb|EEQ43261.1| conserved hypothetical protein [Candida albicans WO-1]
          Length = 242

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 56/149 (37%), Positives = 86/149 (57%), Gaps = 4/149 (2%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           ++ Y R IA+  +L+  T  E + A+ +++ KFA+D+L   DN + AL     D      
Sbjct: 98  KNHYARAIADFRHLQETTKTEVQKAKDFALQKFAKDLLDSLDNFNLALGHVKEDTL---- 153

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           K    ++SL EG++MT+     TL +YG++KID  DQ F+PN+H+A F+  +      T+
Sbjct: 154 KLNDEVRSLYEGVDMTKTVFEKTLNKYGIEKIDPIDQVFDPNLHEATFQMANPGKEPGTV 213

Query: 164 IKVVQDGYAINERVLRPALVSISKGKTQN 192
             V Q GY +NERVLRPA V + K +  N
Sbjct: 214 FHVQQVGYTLNERVLRPAKVGVVKSEDDN 242


>gi|238920934|ref|YP_002934449.1| co-chaperone GrpE [Edwardsiella ictaluri 93-146]
 gi|238870503|gb|ACR70214.1| co-chaperone GrpE [Edwardsiella ictaluri 93-146]
          Length = 192

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 98/151 (64%), Gaps = 12/151 (7%)

Query: 40  SEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLA 99
            E  R+  LR  A+++N+RRR +++ + A  +++ KF+ ++L V DNL RAL+ A  D +
Sbjct: 52  GEHEREIMLRARADVDNIRRRAEQDVEKAHKFALEKFSGELLPVIDNLERALELA--DKS 109

Query: 100 NSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM--FEEPHDT 157
           N+E      L S+IEG+E+T + ++  + ++GV+++   +  FNP +HQAM     P D 
Sbjct: 110 NTE------LVSMIEGVELTLKSLLDVVRKFGVEQVAEVNVPFNPEVHQAMTMMASP-DH 162

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISKG 188
            P N ++ V+Q GY +N R++RPA+V++SKG
Sbjct: 163 AP-NQVMMVMQKGYTLNGRLIRPAMVAVSKG 192


>gi|260771332|ref|ZP_05880258.1| heat shock protein GrpE [Vibrio furnissii CIP 102972]
 gi|260613648|gb|EEX38841.1| heat shock protein GrpE [Vibrio furnissii CIP 102972]
          Length = 200

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 95/146 (65%), Gaps = 8/146 (5%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E +D  LR  A++EN+RRR+++E   A+ Y++++F  ++L V DN+ RA+ +A  D  N 
Sbjct: 63  EQQDAVLRARADVENMRRRSEQEVDKARKYALSRFIEELLPVLDNMERAIQAA--DGENE 120

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
                 V+K ++EG+E+T +  +  + ++G+K+I+ + + FNP  HQAM  +      +N
Sbjct: 121 ------VVKPILEGVELTHKTFVDAVAKFGLKEINPEGEAFNPEFHQAMSIQESPDHASN 174

Query: 162 TIIKVVQDGYAINERVLRPALVSISK 187
           T++ V+Q GY +N RV+RPA+V ++K
Sbjct: 175 TVMFVMQKGYELNGRVVRPAMVMVAK 200


>gi|218961070|ref|YP_001740845.1| GrpE protein [Candidatus Cloacamonas acidaminovorans]
 gi|167729727|emb|CAO80639.1| GrpE protein [Candidatus Cloacamonas acidaminovorans]
          Length = 185

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 91/156 (58%), Gaps = 11/156 (7%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E++DKYLR +AE EN R+RT  EK +    +  KFA ++  V DN  RA+  A       
Sbjct: 39  EWKDKYLRCMAEFENFRKRTISEKAEWIRLATQKFALEICDVLDNFERAIQQA-----TE 93

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
           E+KS    K    G+ M  +++   LE+ GVKKI+A  + FNP  H+A+   P D    N
Sbjct: 94  EEKSTPFGK----GVLMIEQQLRKALEKEGVKKIEALGEPFNPEFHEALAHIPSDQ-EEN 148

Query: 162 TIIKVVQDGYAINERVLRPALVSISKG-KTQNPTEE 196
           T+  ++Q+GY ++++VLRP  V++S G K  N ++E
Sbjct: 149 TVTAIIQNGYIMHDKVLRPVRVAVSNGSKINNESQE 184


>gi|154310391|ref|XP_001554527.1| hypothetical protein BC1G_07115 [Botryotinia fuckeliana B05.10]
 gi|150851447|gb|EDN26640.1| hypothetical protein BC1G_07115 [Botryotinia fuckeliana B05.10]
          Length = 242

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 92/152 (60%), Gaps = 6/152 (3%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAP---LDL 98
           E +DK LR IAE  NL+ RT R+ + A+ ++I KFA+D++   DN  RAL + P   L +
Sbjct: 89  ELKDKLLRSIAEFRNLQERTKRDMQAAKDFAIQKFAKDLVDSVDNFDRALTTVPAEKLSV 148

Query: 99  ANSEK-KSESVLKSLIEGIEMTRREMMSTLERYGVKKID--AKDQKFNPNMHQAMFEEPH 155
           +  E+ + +  L +L EG++MT   +MSTL+++G+++ D   + +KFNPN H+A F  P 
Sbjct: 149 SAEERNEHQQDLITLHEGLKMTENILMSTLKKHGLERFDPSVESEKFNPNEHEATFMTPM 208

Query: 156 DTVPANTIIKVVQDGYAINERVLRPALVSISK 187
                 T+    Q G+ +N R+LR A V + K
Sbjct: 209 AGKEDGTVFHTQQKGFKLNGRILRAAKVGVVK 240


>gi|221068655|ref|ZP_03544760.1| GrpE protein [Comamonas testosteroni KF-1]
 gi|220713678|gb|EED69046.1| GrpE protein [Comamonas testosteroni KF-1]
          Length = 181

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 93/156 (59%), Gaps = 13/156 (8%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           EE   +S E  D+YLR  A+ EN+RRR + E   A+ + I  FA  +L V D+L  AL  
Sbjct: 38  EELKAKSAELADQYLRAKADAENMRRRAEEEVTKARKFGIESFAESLLPVIDSLDAAL-- 95

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID-AKDQKFNPNMHQAMFE 152
             +  A  E+        L EG + T R++ S LER  V+ I+ A  +KF+P+ HQA+  
Sbjct: 96  -AIQNATPEQ--------LREGSDATLRQLTSALERNKVQAINPAAGEKFDPHHHQAISM 146

Query: 153 EPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
            P D  PANT++ V+Q GY I +R+LRPALV++++G
Sbjct: 147 VPADQ-PANTVVAVLQKGYVIADRILRPALVTVAQG 181


>gi|254483127|ref|ZP_05096361.1| co-chaperone GrpE [marine gamma proteobacterium HTCC2148]
 gi|214036649|gb|EEB77322.1| co-chaperone GrpE [marine gamma proteobacterium HTCC2148]
          Length = 201

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 52/145 (35%), Positives = 91/145 (62%), Gaps = 8/145 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LR  A+ +N++RR +++ + A+ +++ +FA D+L V DNL RAL++A  D      
Sbjct: 64  RDAALRAQADAQNVKRRAEQDVEKARKFALERFASDLLPVVDNLERALEAASGD------ 117

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
             +  +K + EG+E+T +  +  L +  V  +D + + F+PN+HQA+    +  V  NT+
Sbjct: 118 --DEAIKPIAEGVELTLKSFIDVLGKNKVDVVDPQGEPFDPNLHQAITMIENKEVEPNTV 175

Query: 164 IKVVQDGYAINERVLRPALVSISKG 188
             V+Q GY++N R++RPA+V +SKG
Sbjct: 176 TAVMQKGYSLNGRLIRPAMVMVSKG 200


>gi|301105118|ref|XP_002901643.1| Mitochondrial Protein Translocase (MPT) Family [Phytophthora
           infestans T30-4]
 gi|262100647|gb|EEY58699.1| Mitochondrial Protein Translocase (MPT) Family [Phytophthora
           infestans T30-4]
          Length = 218

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 97/155 (62%), Gaps = 1/155 (0%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           EE   Q+++  D+ LR +A+ EN+RR +  +  +A+ ++I+KFA+ +L VSDNL RA +S
Sbjct: 61  EELTTQNKDMNDRLLRALADAENVRRISRVDVNNAREFAISKFAKALLDVSDNLKRAHES 120

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
             +     EK+ +++ + L EG+ MT +++      + + ++ A   KF+PN+H A+FE 
Sbjct: 121 IDVATLQPEKQLDAI-EMLHEGVVMTEQQLQKVFREFKINQVGAVGDKFDPNVHDALFEY 179

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
              T  A +I ++++ GY +NERV+RPA V + K 
Sbjct: 180 EDATKEAGSIGQLMKTGYLLNERVIRPAQVGVVKA 214


>gi|312963099|ref|ZP_07777584.1| Protein grpE [Pseudomonas fluorescens WH6]
 gi|311282610|gb|EFQ61206.1| Protein grpE [Pseudomonas fluorescens WH6]
          Length = 186

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 112/186 (60%), Gaps = 14/186 (7%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           M+++     + P    ++  E  + + + EE L  ++   D+ LRV A+++N+RRR +++
Sbjct: 1   MADEQTQDTQTPEANQAAGDELATRVQVLEEQLAAAQ---DQSLRVAADLQNVRRRAEQD 57

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
            + A  +++ KFA D+L + D+L R      L+L+N + ++   ++ + EGIE+T +   
Sbjct: 58  VEKAHKFALEKFANDLLPIIDSLERG-----LELSNPDDEN---IRPMREGIELTLKMFQ 109

Query: 125 STLERYGVKKIDAK-DQKFNPNMHQAM-FEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
            TL+RY ++ ID +  + FN   HQAM  +E HD  P N+++KV Q GY ++ R+LRPA+
Sbjct: 110 DTLKRYQLETIDPQGGEPFNAEHHQAMAMQESHDLEP-NSVLKVFQKGYLLHGRLLRPAM 168

Query: 183 VSISKG 188
           V +SK 
Sbjct: 169 VVVSKA 174


>gi|91762499|ref|ZP_01264464.1| GrpE protein (HSP-70 cofactor) [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|91718301|gb|EAS84951.1| GrpE protein (HSP-70 cofactor) [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 211

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 68/179 (37%), Positives = 104/179 (58%), Gaps = 14/179 (7%)

Query: 24  AEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSV 83
            EE  E+  PEE +   +E  DK  R  AEMEN RRR ++EK DA  Y    FA++ L++
Sbjct: 36  TEEAKEVT-PEEKI---KELEDKLTRTFAEMENQRRRFEKEKDDAFDYGGFSFAKEALNL 91

Query: 84  SDNLSRA---LDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQ 140
            DNL R+   L+S  + L ++E      LK  +E  E+  ++M+S   + G+  + +  +
Sbjct: 92  IDNLERSKQILESDEV-LKDTE-----ALKKTLEHFEIISKDMVSIFSKNGITPVVSIGK 145

Query: 141 KFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKE 199
           K +PN HQAM E   D     TI++ +Q G+ + +R+LRPALV +SK KT+ P ++K E
Sbjct: 146 KLDPNQHQAMMEIDDDQKEPGTIVQEIQKGFMMKDRLLRPALVGVSK-KTKTPDDQKSE 203


>gi|315180932|gb|ADT87846.1| heat shock protein GrpE [Vibrio furnissii NCTC 11218]
          Length = 200

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 95/146 (65%), Gaps = 8/146 (5%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E +D  LR  A++EN+RRR+++E   A+ Y++++F  ++L V DN+ RA+ +A  D  N 
Sbjct: 63  EQQDAVLRARADVENMRRRSEQEIDKARKYALSRFIEELLPVLDNMERAIQAA--DGENE 120

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
                 V+K ++EG+E+T +  +  + ++G+K+I+ + + FNP  HQAM  +      +N
Sbjct: 121 ------VVKPILEGVELTHKTFVDAVAKFGLKEINPEGEAFNPEFHQAMSIQESPDHASN 174

Query: 162 TIIKVVQDGYAINERVLRPALVSISK 187
           T++ V+Q GY +N RV+RPA+V ++K
Sbjct: 175 TVMFVMQKGYELNGRVVRPAMVMVAK 200


>gi|94265731|ref|ZP_01289468.1| GrpE protein [delta proteobacterium MLMS-1]
 gi|93453744|gb|EAT04120.1| GrpE protein [delta proteobacterium MLMS-1]
          Length = 234

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 88/151 (58%), Gaps = 12/151 (7%)

Query: 41  EEFRDK---YLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD 97
           EE R K    +R+ AE EN ++R  RE++    Y+  +  RD+L   DNL RA++     
Sbjct: 92  EELRAKEEQMMRLAAEFENYKKRMQRERETTLKYAEEELLRDLLPTLDNLERAIEQG--- 148

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
                + +E V  +L+EG+EMT    ++TL+++G+K +  + + F+PN H+AM  E  D 
Sbjct: 149 -----RNTEDV-TALLEGVEMTYEGFLATLQKFGIKPLAGEGEAFDPNFHEAMAMEDSDQ 202

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISKG 188
           VPANT+I   Q GY   +R+LR A V +S G
Sbjct: 203 VPANTVINEYQKGYLYKDRLLRAAKVVVSGG 233


>gi|120556270|ref|YP_960621.1| GrpE protein [Marinobacter aquaeolei VT8]
 gi|120326119|gb|ABM20434.1| GrpE protein [Marinobacter aquaeolei VT8]
          Length = 245

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 52/164 (31%), Positives = 105/164 (64%), Gaps = 8/164 (4%)

Query: 25  EEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVS 84
           E+ SE+++ ++ L   +E++++ LR  AEM+N+RRR + + + A  +++ KF +++L V+
Sbjct: 80  EQGSELDVLQQKL---QEYQEQALRAQAEMQNVRRRAEIDVEKAHKFALEKFVKELLPVA 136

Query: 85  DNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNP 144
           D+L +A++S         + +  ++ S+ EG+EMT    M++L+++ V++++   + F+P
Sbjct: 137 DSLEKAVEST-----EGHENAGELVASIREGVEMTLTLFMNSLKKFNVEQLNPVGEPFDP 191

Query: 145 NMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
             H+AM   P      N+++ VVQ GY +N RV+RPA+V ++K 
Sbjct: 192 QQHEAMSMVPAPDAEPNSVVAVVQKGYLLNGRVVRPAMVVVAKA 235


>gi|257066658|ref|YP_003152914.1| GrpE protein [Anaerococcus prevotii DSM 20548]
 gi|256798538|gb|ACV29193.1| GrpE protein [Anaerococcus prevotii DSM 20548]
          Length = 178

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 94/166 (56%), Gaps = 22/166 (13%)

Query: 22  STAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDML 81
           S A E +E+N          E++++Y R++A+ EN ++R +  K D + ++ +     +L
Sbjct: 35  SKASETAEVN----------EYQERYQRLLADFENYKKREEASKADFKKFAQSSLIEKLL 84

Query: 82  SVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQK 141
            V DNL RAL  A  D A             +EG+ MTR+E+M  LE  G+++I +   +
Sbjct: 85  PVIDNLDRALAKADEDDA------------FVEGVIMTRKELMKVLENEGLEEIASDGCE 132

Query: 142 FNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           F+ N+HQA+  E +D V  N II+  Q GY +N RVLRPA+V +SK
Sbjct: 133 FDHNIHQAVLAEENDEVEENHIIETFQKGYKLNGRVLRPAMVKVSK 178


>gi|332184404|gb|AEE26658.1| Heat shock protein GrpE [Francisella cf. novicida 3523]
          Length = 195

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 58/150 (38%), Positives = 94/150 (62%), Gaps = 9/150 (6%)

Query: 38  NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD 97
           +  + F+D+ LR  AEMEN+R+R +R+  +A+ + I KFA+++L V D++ +AL      
Sbjct: 54  DNCDRFKDEALRAKAEMENIRKRAERDISNARKFGIEKFAKELLPVIDSIEQAL------ 107

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
               E K E  + ++ EGIE+T + ++  L++ GV+++D K +KF+PN+H+AM   P+  
Sbjct: 108 --KHEVKLEEAV-AMKEGIELTAKMLVDILKKNGVEELDPKGEKFDPNLHEAMAMIPNPE 164

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISK 187
              NTI  V Q GY +N RV+R A V I K
Sbjct: 165 FEDNTIFDVFQKGYMLNGRVVRAAKVVIVK 194


>gi|168041950|ref|XP_001773453.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162675329|gb|EDQ61826.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 302

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 92/154 (59%), Gaps = 6/154 (3%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E +DK LR  AE+EN+  R  RE +  + +++  FA+ +L V+DNL RA  + P +L   
Sbjct: 148 ELQDKVLRGYAEVENVMARARREAESTRKFALQGFAKGLLDVADNLGRATGAVPENLRKL 207

Query: 102 EKKSE------SVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPH 155
           +   E       VL +L++G+EMT +++     + G++K +++ ++F+PN H AMFE   
Sbjct: 208 DSTLEDSSGAAKVLITLLQGVEMTEKQLQQVFRQNGLEKFESEGKEFDPNYHSAMFELED 267

Query: 156 DTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
           +T    T+  V + GY +++RV+RPA V + K K
Sbjct: 268 ETKTPGTVAIVTKVGYLLHDRVIRPAEVGVIKAK 301


>gi|56708330|ref|YP_170226.1| heat shock protein GrpE [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|110670801|ref|YP_667358.1| heat shock protein GrpE [Francisella tularensis subsp. tularensis
           FSC198]
 gi|134301631|ref|YP_001121599.1| co-chaperone GrpE [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|224457454|ref|ZP_03665927.1| co-chaperone GrpE [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|254370952|ref|ZP_04986956.1| chaperone protein grpE [Francisella tularensis subsp. tularensis
           FSC033]
 gi|254875152|ref|ZP_05247862.1| co-chaperone grpE [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|81677036|sp|Q5NFG6|GRPE_FRATT RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|123359427|sp|Q14GW8|GRPE_FRAT1 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|166215265|sp|A4IX27|GRPE_FRATW RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|54114293|gb|AAV29780.1| NT02FT0234 [synthetic construct]
 gi|56604822|emb|CAG45903.1| Chaperone protein grpE (heat shock protein family 70 cofactor)
           [Francisella tularensis subsp. tularensis SCHU S4]
 gi|110321134|emb|CAL09286.1| Chaperone protein grpE (heat shock protein family 70 cofactor)
           [Francisella tularensis subsp. tularensis FSC198]
 gi|134049408|gb|ABO46479.1| co-chaperone GrpE [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|151569194|gb|EDN34848.1| chaperone protein grpE [Francisella tularensis subsp. tularensis
           FSC033]
 gi|254841151|gb|EET19587.1| co-chaperone grpE [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|282159567|gb|ADA78958.1| co-chaperone GrpE [Francisella tularensis subsp. tularensis
           NE061598]
          Length = 195

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 95/150 (63%), Gaps = 9/150 (6%)

Query: 38  NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD 97
           +  ++F+D+ LR  AEMEN+R+R +R+  +A+ + I KF++++L V D++ +AL      
Sbjct: 54  DSCDQFKDEALRAKAEMENIRKRAERDVSNARKFGIEKFSKELLPVIDSIEQAL------ 107

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
               E K E  + ++ EGIE+T + ++  L++ GV+++D K +KF+PN+H+AM   P+  
Sbjct: 108 --KHEVKLEEAI-AMKEGIELTAKMLVDILKKNGVEELDPKGEKFDPNLHEAMAMIPNPE 164

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISK 187
              NTI  V Q GY +N R++R A V I K
Sbjct: 165 FEDNTIFDVFQKGYMLNGRIVRAAKVVIVK 194


>gi|331005324|ref|ZP_08328711.1| Heat shock protein GrpE [gamma proteobacterium IMCC1989]
 gi|330420863|gb|EGG95142.1| Heat shock protein GrpE [gamma proteobacterium IMCC1989]
          Length = 195

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 49/146 (33%), Positives = 95/146 (65%), Gaps = 8/146 (5%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            +++ LR  A+ +N+RRR++++ + A+ +++ KF  D+L V+DNL RA+ +      N E
Sbjct: 57  LKEQVLRAHADAQNVRRRSEQDVEKARKFALEKFVADLLPVADNLERAIAAG-----NPE 111

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
            +++   K+++EG+E+T + +  TL+++ V+ +D   + F+P +HQAM   P+  +  NT
Sbjct: 112 DETQ---KAVLEGVELTLKSLQDTLKKHKVEMVDPAGEPFDPQLHQAMTMVPNPDMEPNT 168

Query: 163 IIKVVQDGYAINERVLRPALVSISKG 188
           ++ V Q GY +N R++RPA+V +S  
Sbjct: 169 VMDVFQKGYTLNGRLVRPAMVVVSSA 194


>gi|224476689|ref|YP_002634295.1| heat shock protein GrpE [Staphylococcus carnosus subsp. carnosus
           TM300]
 gi|254799611|sp|B9DNK1|GRPE_STACT RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|222421296|emb|CAL28110.1| putative GrpE protein (HSP-70 cofactor) [Staphylococcus carnosus
           subsp. carnosus TM300]
          Length = 198

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 102/175 (58%), Gaps = 12/175 (6%)

Query: 13  EKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYS 72
           E +  N +S+  +++ EI   +E +N+ EE   KYLR+ AE EN +RR   E +  ++Y 
Sbjct: 36  EDDVQNDSSAVDDKEKEIQQLKEEVNEQEE---KYLRLYAEFENYKRRIQNENQTLKTYQ 92

Query: 73  IAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGV 132
                 D+L   DN+ RAL          E + ES  KSL +G++M    ++  LE  G+
Sbjct: 93  AQCVLTDILPTIDNIERAL--------QIEGEDES-FKSLQKGVQMVYESLLRALEENGL 143

Query: 133 KKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +KI+A  Q+F+PN HQA+ ++  D+  +N + + +Q GY + +RVLRP++V +++
Sbjct: 144 EKIEAVGQQFDPNFHQAVMQDEDDSFESNAVTQELQTGYKLKDRVLRPSMVKVNQ 198


>gi|257455998|ref|ZP_05621207.1| co-chaperone GrpE [Enhydrobacter aerosaccus SK60]
 gi|257446587|gb|EEV21621.1| co-chaperone GrpE [Enhydrobacter aerosaccus SK60]
          Length = 193

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 58/171 (33%), Positives = 103/171 (60%), Gaps = 18/171 (10%)

Query: 16  PSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAK 75
           PS+ N ST E++       E   + +E ++ + R  AE  N R R ++E +  + +++ K
Sbjct: 40  PSDINLSTYEQRIA-----ELEGEVKEAKEAHARANAEAYNARNRMEQETEKTKKFALEK 94

Query: 76  FARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI 135
           FA+D+L   DNL RA++S           S+S    ++EG+++T + +++ LERYGVK +
Sbjct: 95  FAKDLLDTVDNLERAIES-----------SQSDNDPVLEGVKLTHKSLLAVLERYGVKVV 143

Query: 136 DAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           D + + FN ++H+A+  +P  +  AN + +V+Q GY +NER+LRPA+V + 
Sbjct: 144 DPQGETFNADLHEAVGIDPEAS--ANQVGQVLQKGYTLNERLLRPAMVRVG 192


>gi|148284141|ref|YP_001248231.1| heat shock molecular chaperone protein [Orientia tsutsugamushi str.
           Boryong]
 gi|146739580|emb|CAM79327.1| heat shock molecular chaperone protein [Orientia tsutsugamushi str.
           Boryong]
          Length = 198

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 62/179 (34%), Positives = 104/179 (58%), Gaps = 7/179 (3%)

Query: 15  NPSNANS------STAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           N  NA+S      S+ +E S  +I     N+  +  +  LR IAE +N  +R +R+ ++ 
Sbjct: 19  NQDNADSQQVDKKSSNQEVSNDDIINNKDNEIAQLNNDLLRAIAENDNTIKRYERQLQEV 78

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
           + Y+I  FA+DMLSV D+LS AL +    L NS  +  + +K+ I GIEMT+++  S L 
Sbjct: 79  KEYAIFNFAKDMLSVLDDLSLALSNMEQQLDNSNNQENNKIKNAITGIEMTQKKFGSILS 138

Query: 129 RYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           +YG++K + K  + F+ N+H  +           T++ V+Q GY + +R+LRPA+VS++
Sbjct: 139 QYGIQKFEPKTGEPFDSNIHHVISLVKDTKCAKGTVVSVIQVGYKLKDRLLRPAIVSVA 197


>gi|242309740|ref|ZP_04808895.1| protein grpE [Helicobacter pullorum MIT 98-5489]
 gi|239523741|gb|EEQ63607.1| protein grpE [Helicobacter pullorum MIT 98-5489]
          Length = 184

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 107/187 (57%), Gaps = 4/187 (2%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           M+ +M ++N +K  +P + N+   +E S  +  E   N+ +E  D+YLR  A+ EN ++R
Sbjct: 1   MKFYMQDEN-EKIDSPQDENTQEEQEISAQDSKESLENKIKELEDQYLRTYADFENTKKR 59

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
             REK  A  Y+  K A+D+L   D L  AL +      NS++    +L  + EGI +T 
Sbjct: 60  LMREKDQALEYAYEKIAKDLLPSIDTLEIALKTIKESKENSDQT--EILGKIEEGIALTL 117

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
             ++ TL ++G++ IDA  + F+PN H A+ +   D+  A  I+  +Q GY   ERVLRP
Sbjct: 118 DNLLKTLAKHGIEPIDASGE-FDPNFHDAIMQVQSDSHNAGEIVAEMQKGYKYKERVLRP 176

Query: 181 ALVSISK 187
           ++VSI+K
Sbjct: 177 SMVSIAK 183


>gi|62257364|gb|AAX77712.1| unknown protein [synthetic construct]
          Length = 230

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 95/150 (63%), Gaps = 9/150 (6%)

Query: 38  NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD 97
           +  ++F+D+ LR  AEMEN+R+R +R+  +A+ + I KF++++L V D++ +AL      
Sbjct: 80  DSCDQFKDEALRAKAEMENIRKRAERDVSNARKFGIEKFSKELLPVIDSIEQAL------ 133

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
               E K E  + ++ EGIE+T + ++  L++ GV+++D K +KF+PN+H+AM   P+  
Sbjct: 134 --KHEVKLEEAI-AMKEGIELTAKMLVDILKKNGVEELDPKGEKFDPNLHEAMAMIPNPE 190

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISK 187
              NTI  V Q GY +N R++R A V I K
Sbjct: 191 FEDNTIFDVFQKGYMLNGRIVRAAKVVIVK 220


>gi|157964777|ref|YP_001499601.1| GrpE protein [Rickettsia massiliae MTU5]
 gi|157844553|gb|ABV85054.1| GrpE protein [Rickettsia massiliae MTU5]
          Length = 194

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 105/170 (61%), Gaps = 10/170 (5%)

Query: 21  SSTAEEKSEINIPEESLNQSE--EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFAR 78
           +  AEE  E   PE +  ++E  E +DK +R  AE++N R+R ++ + +A+ Y+IA FA+
Sbjct: 30  TDIAEEIVETTNPEITALKAEIEELKDKLIRTTAEIDNTRKRLEKARDEAKDYAIATFAK 89

Query: 79  DMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
           ++L+VSDNLSRAL   P   ANS+ +    + ++I G++MT+ E+     ++ +++I  +
Sbjct: 90  ELLNVSDNLSRALAHKP---ANSDVE----VTNIIAGVQMTKDELDKIFHKHHIEEIKPE 142

Query: 139 -DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
               FN N+H A+ +  H     N+II ++Q GY I +R+LRPA V + K
Sbjct: 143 IGSMFNYNLHNAIAQVEHPDHAPNSIITLMQSGYKIRDRLLRPATVQVVK 192


>gi|149246401|ref|XP_001527670.1| hypothetical protein LELG_00190 [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146447624|gb|EDK42012.1| hypothetical protein LELG_00190 [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 253

 Score =  105 bits (263), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 53/144 (36%), Positives = 89/144 (61%), Gaps = 4/144 (2%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           ++ Y R  A+  +L+  T  E + A+++++ KFA+D+L   DN   AL     +    EK
Sbjct: 111 KNHYTRAKADFRHLQETTKVEVEKAKNFALQKFAKDLLESVDNFDLALGHVKQE--TLEK 168

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
            +E  +K+L +G+ MT+   + TL ++G+KKI+  D+ F+PN+H+A+FE PH      T+
Sbjct: 169 NTE--VKNLYDGVNMTKDVFLKTLFKFGIKKIEPLDEPFDPNLHEAVFEAPHPDKTPGTV 226

Query: 164 IKVVQDGYAINERVLRPALVSISK 187
             V Q+G+ +N+RVLRPA V + K
Sbjct: 227 FFVQQNGFTLNDRVLRPAKVGLVK 250


>gi|221126677|ref|XP_002159590.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
          Length = 163

 Score =  105 bits (263), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 93/143 (65%), Gaps = 4/143 (2%)

Query: 45  DKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKK 104
           DKY+R +AE EN+RRR  +   DA+ +++  F++D+L V+D L +A+ S P+D    E +
Sbjct: 25  DKYIRSLAECENVRRRGVKMVSDAKLFAVQGFSKDLLEVADILEKAMLSVPID----ELQ 80

Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTII 164
              +LK+L +G+ MT   +     ++G++K++  ++KF+PN H+A+F++      + T++
Sbjct: 81  KNELLKNLYDGLVMTEAHLQKVFLKHGLQKVNPINEKFDPNFHEALFQKSIPGKASGTVV 140

Query: 165 KVVQDGYAINERVLRPALVSISK 187
           +V + GY +N R +R ALV +++
Sbjct: 141 EVNKPGYLLNGRPVRAALVGVAQ 163


>gi|225719934|emb|CAM82753.1| GrpE protein [Plasmodium falciparum]
          Length = 298

 Score =  105 bits (263), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 55/154 (35%), Positives = 92/154 (59%), Gaps = 4/154 (2%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           EE +  ++  ++KYL V+AE ENLR R  +E + ++ Y I+ FA+ +L V+DNLS A+  
Sbjct: 148 EEKMVDNKVLKEKYLSVLAENENLRNRYMKEIETSKLYCISNFAKSLLDVADNLSLAIK- 206

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
              ++     K+   + ++ +GIEMT   + +   +YG+ K +  ++KFNP +H+A+FE 
Sbjct: 207 ---NINEESLKTNEEINNIYKGIEMTETILHNIFNKYGIDKYNPINEKFNPQLHEAIFEI 263

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
              T    T+  V+Q GY I +R+LR A V + K
Sbjct: 264 NDSTKEKGTVATVIQHGYKIKDRILRAAKVGVVK 297


>gi|113867157|ref|YP_725646.1| molecular chaperone GrpE [Ralstonia eutropha H16]
 gi|113525933|emb|CAJ92278.1| molecular chaperone GrpE [Ralstonia eutropha H16]
          Length = 186

 Score =  105 bits (263), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 88/151 (58%), Gaps = 12/151 (7%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           ++ E  D Y+R +AE EN+RRR   +   A  ++I  FA ++L V D+L  AL     D+
Sbjct: 48  KAREHYDLYMRAVAEGENIRRRAQEDVAKAHKFAIENFADNLLPVMDSLQAALADGSGDI 107

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
           A            L EG+E+T R++ +  ER  + +++   +KF+P+ HQA+   P D  
Sbjct: 108 AK-----------LREGVELTARQLAAAFERGKIVELNPVGEKFDPHRHQAISMVPADQE 156

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISKGK 189
           P NT++ V+Q GY I ERVLRPALV+++  K
Sbjct: 157 P-NTVVTVLQRGYTIAERVLRPALVTVAAPK 186


>gi|198414812|ref|XP_002123689.1| PREDICTED: similar to GrpE protein homolog 1, mitochondrial
           precursor (Mt-GrpE#1) (HMGE) [Ciona intestinalis]
          Length = 211

 Score =  105 bits (263), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 57/164 (34%), Positives = 97/164 (59%), Gaps = 3/164 (1%)

Query: 25  EEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVS 84
           EE  E+   E+ + +  E  DKY R +AE EN+R R  +E +DA+ + I  F +D+++V+
Sbjct: 47  EETPEVAASEQEIKKLNETIDKYQRSLAETENVRSRLRKEIEDAKLFGIQAFCKDLITVA 106

Query: 85  DNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDA-KDQKFN 143
           D +  A+ S P +    E ++  V KS  EG+ +T +E+    +R+G+K ++  +  KF+
Sbjct: 107 DVMKMAVTSIPEN--ELENETNKVWKSFYEGVCLTDKELHKVFDRHGLKLLEPEQGDKFD 164

Query: 144 PNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           P  H+A+FE P DT+   ++  V + GY +  R LRPA V +S+
Sbjct: 165 PYDHEALFEVPIDTLEPGSVAHVERIGYKLKGRTLRPAQVGVSR 208


>gi|167837754|ref|ZP_02464637.1| co-chaperone GrpE [Burkholderia thailandensis MSMB43]
          Length = 178

 Score =  105 bits (263), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 86/148 (58%), Gaps = 12/148 (8%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E ++ +LR  AE EN+RRR   +   A  ++I  FA  +L V D+L  A+     DLA  
Sbjct: 43  ELQESFLRAKAETENVRRRAQEDVAKAHKFAIENFAEHLLPVLDSLEAAVGDTSGDLAKV 102

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
                       EG+E+T R++ S LE+  V  ++   +KF+P++HQA+   P D  P N
Sbjct: 103 R-----------EGVELTLRQLTSALEKGRVAALNPVGEKFDPHLHQAISMVPADQEP-N 150

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGK 189
           T++ V+Q GY I +RVLRPALV++S+ K
Sbjct: 151 TVVAVLQKGYTIADRVLRPALVTVSQPK 178


>gi|160915812|ref|ZP_02078020.1| hypothetical protein EUBDOL_01828 [Eubacterium dolichum DSM 3991]
 gi|158432288|gb|EDP10577.1| hypothetical protein EUBDOL_01828 [Eubacterium dolichum DSM 3991]
          Length = 201

 Score =  105 bits (263), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 51/143 (35%), Positives = 90/143 (62%), Gaps = 9/143 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           ++ Y +  A+ ENL++R   E  + + Y I  FA ++L + DNL RAL+          K
Sbjct: 67  KNAYFKAYADAENLKKRLQAEADNVRKYRIQSFAVEVLPIIDNLERALNV---------K 117

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
             +  LK+ ++G EM  +++++TLE+ GVK+I+A ++ F+PN+HQA+ +E  + V +  +
Sbjct: 118 SDDESLKNYVKGFEMIYQQLIATLEKEGVKEIEALNKPFDPNVHQALMQESVEGVESGIV 177

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
           ++V+Q GY + +RVLR  LV +S
Sbjct: 178 VEVLQKGYMLKDRVLRATLVKVS 200


>gi|91205421|ref|YP_537776.1| GrpE protein [Rickettsia bellii RML369-C]
 gi|157827024|ref|YP_001496088.1| GrpE protein [Rickettsia bellii OSU 85-389]
 gi|122990920|sp|Q1RIX7|GRPE_RICBR RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|166215283|sp|A8GW24|GRPE_RICB8 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|91068965|gb|ABE04687.1| GrpE protein [Rickettsia bellii RML369-C]
 gi|157802328|gb|ABV79051.1| GrpE protein [Rickettsia bellii OSU 85-389]
          Length = 176

 Score =  105 bits (262), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 55/150 (36%), Positives = 97/150 (64%), Gaps = 8/150 (5%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           Q EE +DK +R  AE++N R+R ++ + +A+ Y+I  FA+++L+VSDNLSRAL+  PLD 
Sbjct: 32  QIEELKDKLIRASAEIDNTRKRLEKARDEARDYAITTFAKELLNVSDNLSRALEHKPLD- 90

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDT 157
           A+ E      + ++I G++MT+ E+     ++ +++I  +    F+ N+H A+ +  H  
Sbjct: 91  ASVE------VTNIIAGVQMTKDELDKVFHKHHIEEIKPEIGSTFDYNLHNAISQIEHPD 144

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISK 187
              N++I ++Q GY I +R+LRPA V ++K
Sbjct: 145 HEPNSVINIMQVGYRIKDRLLRPATVQVTK 174


>gi|283780797|ref|YP_003371552.1| GrpE protein [Pirellula staleyi DSM 6068]
 gi|283439250|gb|ADB17692.1| GrpE protein [Pirellula staleyi DSM 6068]
          Length = 177

 Score =  105 bits (262), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 65/188 (34%), Positives = 99/188 (52%), Gaps = 24/188 (12%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQS--------EEFRDKYLRVIAEMENLRRR 60
            ID   +PS        + +E  I E +  Q         +E  ++ LR  AE+EN R+R
Sbjct: 2   TIDPTSDPS-------ADATEAAIGETAFQQQLAKLEAEVKEANERVLRGQAELENYRKR 54

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           + RE +D + Y+    ARD+LSV DNL RALD+A         K+ES    L+ G++M  
Sbjct: 55  SRRELEDDRKYAALPLARDLLSVIDNLQRALDAA--------AKAESS-GDLLLGVKMVL 105

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
            ++   L ++    I+   Q F+PN HQA+ +EP D   A  + +  Q GY +++RV+RP
Sbjct: 106 GQLQGILAQHQCVPIETVGQAFDPNFHQAIAQEPSDEHAAGVVTRAAQVGYKLHDRVIRP 165

Query: 181 ALVSISKG 188
           A V +S G
Sbjct: 166 AQVFVSTG 173


>gi|258597308|ref|XP_001347929.2| co-chaperone GrpE, putative [Plasmodium falciparum 3D7]
 gi|161338467|emb|CAL91034.1| GrpE protein [Plasmodium falciparum]
 gi|254832655|gb|AAN35842.2| co-chaperone GrpE, putative [Plasmodium falciparum 3D7]
          Length = 301

 Score =  105 bits (262), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 55/154 (35%), Positives = 92/154 (59%), Gaps = 4/154 (2%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           EE +  ++  ++KYL V+AE ENLR R  +E + ++ Y I+ FA+ +L V+DNLS A+  
Sbjct: 151 EEKMVDNKVLKEKYLSVLAENENLRNRYMKEIETSKLYCISNFAKSLLDVADNLSLAIK- 209

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
              ++     K+   + ++ +GIEMT   + +   +YG+ K +  ++KFNP +H+A+FE 
Sbjct: 210 ---NINEESLKTNEEINNIYKGIEMTETILHNIFNKYGIDKYNPINEKFNPQLHEAIFEI 266

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
              T    T+  V+Q GY I +R+LR A V + K
Sbjct: 267 NDSTKEKGTVATVIQHGYKIKDRILRAAKVGVVK 300


>gi|194289242|ref|YP_002005149.1| heat shock protein grpe [Cupriavidus taiwanensis LMG 19424]
 gi|254799588|sp|B3R450|GRPE_CUPTR RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|193223077|emb|CAQ69082.1| Hsp 24 nucleotide exchange factor [Cupriavidus taiwanensis LMG
           19424]
          Length = 191

 Score =  105 bits (262), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 88/151 (58%), Gaps = 12/151 (7%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           ++ E  D Y+R +AE EN+RRR   +   A  ++I  FA ++L V D+L  AL     D+
Sbjct: 53  KASEHYDLYMRAVAEGENIRRRAQEDVAKAHKFAIENFADNLLPVMDSLQAALADGSGDI 112

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
           A            L EG+E+T R++ +  ER  + +++   +KF+P+ HQA+   P D  
Sbjct: 113 AK-----------LREGVELTARQLAAAFERGKIVELNPVGEKFDPHRHQAISMVPADQE 161

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISKGK 189
           P NT++ V+Q GY I +RVLRPALV+++  K
Sbjct: 162 P-NTVVTVLQRGYTIADRVLRPALVTVAAPK 191


>gi|260942283|ref|XP_002615440.1| hypothetical protein CLUG_04323 [Clavispora lusitaniae ATCC 42720]
 gi|238850730|gb|EEQ40194.1| hypothetical protein CLUG_04323 [Clavispora lusitaniae ATCC 42720]
          Length = 241

 Score =  105 bits (262), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 87/152 (57%), Gaps = 14/152 (9%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           + ++ Y R +A+  NL+  T +E + A+ +++ KFA+D+L   DN + AL+S        
Sbjct: 96  DMKNHYARAVADFRNLQETTKKEMQKARDFALQKFAKDLLESLDNFTLALNSV------- 148

Query: 102 EKKSESV-----LKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHD 156
             K E++     +K+L +G+ MT+     TL R+G++KI    + F+PN H+A FE P  
Sbjct: 149 --KEETLETNEEVKNLFDGVSMTKNVFEKTLARHGIEKIHPMGEPFDPNQHEATFEIPQP 206

Query: 157 TVPANTIIKVVQDGYAINERVLRPALVSISKG 188
                TI  V Q GY +N+RVLRPA V + KG
Sbjct: 207 DKEPGTIFHVQQPGYTLNKRVLRPAKVGLVKG 238


>gi|189184293|ref|YP_001938078.1| heat shock protein GrpE [Orientia tsutsugamushi str. Ikeda]
 gi|189181064|dbj|BAG40844.1| heat shock protein GrpE [Orientia tsutsugamushi str. Ikeda]
          Length = 198

 Score =  105 bits (262), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 62/179 (34%), Positives = 105/179 (58%), Gaps = 7/179 (3%)

Query: 15  NPSNANSSTAEEKSEIN-IPEESL-----NQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           N  NA+S   ++KS    +P + +     N+  +  +  LR IAE +N  +R +R+ ++ 
Sbjct: 19  NQDNADSQQVDKKSSNQEVPNDDIINNKDNEIAQLNNDLLRAIAENDNTIKRYERQLQEV 78

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
           + Y+I  FA+DMLSV D+LS AL +    L NS  +  + +K+ I GIEMT+++  S L 
Sbjct: 79  KEYAIFNFAKDMLSVLDDLSLALSNMEQQLDNSNNQENNKIKNAITGIEMTQKKFGSILS 138

Query: 129 RYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           +YG++K + K  + F+ N+H  +           TI+ V+Q GY + +R+LRPA+VS++
Sbjct: 139 QYGIQKFEPKTGEPFDSNIHHVLSLVKDIKYAKGTIVNVMQIGYKLKDRLLRPAIVSVA 197


>gi|116492661|ref|YP_804396.1| molecular chaperone GrpE (heat shock protein) [Pediococcus
           pentosaceus ATCC 25745]
 gi|122265875|sp|Q03FR8|GRPE_PEDPA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|116102811|gb|ABJ67954.1| Molecular chaperone GrpE (heat shock protein) [Pediococcus
           pentosaceus ATCC 25745]
          Length = 190

 Score =  105 bits (262), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 90/148 (60%), Gaps = 13/148 (8%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           +E  DKY+R  AE+ N+RRR ++E+     Y   K A+ +L   DNL RAL         
Sbjct: 55  DELSDKYIRAQAEIVNMRRRNEKEQASLIKYDGQKLAKAILPALDNLERAL--------- 105

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEP-HDTVP 159
                ES  + L++G++M + +++  L+   V +I+A+ Q F+PNMHQA+   P  D  P
Sbjct: 106 ---AVESASEQLLKGVKMVQTDLLKALKENHVAEIEAEGQAFDPNMHQAVQTVPADDDHP 162

Query: 160 ANTIIKVVQDGYAINERVLRPALVSISK 187
           A+T+++V+Q GY + +RVLRPA+V +++
Sbjct: 163 ADTVVQVLQKGYILKDRVLRPAMVIVAQ 190


>gi|332703265|ref|ZP_08423353.1| Protein grpE [Desulfovibrio africanus str. Walvis Bay]
 gi|332553414|gb|EGJ50458.1| Protein grpE [Desulfovibrio africanus str. Walvis Bay]
          Length = 182

 Score =  105 bits (262), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 84/145 (57%), Gaps = 9/145 (6%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            +D  LR +AE EN++RR  REK++ Q +++     D+L V DNL  AL  A        
Sbjct: 45  LKDDKLRALAETENVKRRLMREKEEFQKFAVEGVLADLLPVLDNLDMALAYA-------- 96

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
           +KSE+  K  ++G+EMTR+  +  L  +G++      ++FNP  H+A+  EP    P N 
Sbjct: 97  EKSEAC-KGFVQGVEMTRKVFLDILASHGLEATGGAGEEFNPEWHEAVGAEPSKDFPENH 155

Query: 163 IIKVVQDGYAINERVLRPALVSISK 187
           + +++Q GY +  R+LRPA V ISK
Sbjct: 156 VCQLLQKGYKLKGRLLRPAKVLISK 180


>gi|313899541|ref|ZP_07833050.1| co-chaperone GrpE [Clostridium sp. HGF2]
 gi|312955648|gb|EFR37307.1| co-chaperone GrpE [Clostridium sp. HGF2]
          Length = 206

 Score =  105 bits (262), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 85/143 (59%), Gaps = 9/143 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           ++ Y +  A+ ENL++R   E  + + Y I  FA ++L V DNL RALD          K
Sbjct: 72  KNAYFKAYADTENLKKRLQSESDNVRKYRIQSFAMEILPVLDNLERALDV---------K 122

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
             +  +K+  +G EM  ++++  L + GVK+I+A D+ F+PN HQA+ +E  D V +  +
Sbjct: 123 VDDQNVKNYAKGFEMIYQQLVHILNQEGVKEIEALDKPFDPNFHQALMQEAKDGVESGMV 182

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
           I+V+Q GY + +RVLR  LV +S
Sbjct: 183 IEVLQKGYMLKDRVLRATLVKVS 205


>gi|138896078|ref|YP_001126531.1| heat shock protein GrpE [Geobacillus thermodenitrificans NG80-2]
 gi|196248972|ref|ZP_03147672.1| GrpE protein [Geobacillus sp. G11MC16]
 gi|166215266|sp|A4IR32|GRPE_GEOTN RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|134267591|gb|ABO67786.1| Heat-shock protein GrpE [Geobacillus thermodenitrificans NG80-2]
 gi|196211848|gb|EDY06607.1| GrpE protein [Geobacillus sp. G11MC16]
          Length = 220

 Score =  105 bits (262), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 102/177 (57%), Gaps = 16/177 (9%)

Query: 15  NPSNANSSTAEE----KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQS 70
           +P+   S  AEE    K+++   EE L + E+   +YLR+ A+ EN RRR  +E + A+ 
Sbjct: 56  DPAEQTSVEAEELAKAKAQVAELEEKLAEMEK---RYLRLYADFENFRRRARQEMEAAEK 112

Query: 71  YSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERY 130
           Y     A D+L V DN  RAL          E ++E   KS+++G+EM  R ++  L + 
Sbjct: 113 YRAQSLASDLLPVLDNFERAL--------KIETENEQA-KSILQGVEMVYRSLLDALRKE 163

Query: 131 GVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           GV+ I+A  + F+P++HQA+ +        NT+++ +Q GY + +R+LRPA+V +S+
Sbjct: 164 GVEVIEAVGKPFDPHLHQAVMQTDEGGYEPNTVVEELQKGYKLKDRILRPAMVKVSQ 220


>gi|149424842|ref|XP_001521091.1| PREDICTED: similar to GrpE protein homolog 1, mitochondrial
           precursor (Mt-GrpE#1) (HMGE), partial [Ornithorhynchus
           anatinus]
          Length = 285

 Score =  105 bits (262), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 62/178 (34%), Positives = 104/178 (58%), Gaps = 11/178 (6%)

Query: 11  DKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQS 70
           D++  PS+A  +  EEK ++   EE L ++ E   KY R +A+ ENLR+R+ +   +A+ 
Sbjct: 116 DQKPEPSSAEKTLIEEKVKL---EEQLKETME---KYKRALADTENLRQRSQKMVDEAKL 169

Query: 71  YSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESV-LKSLIEGIEMTRREMMSTLER 129
           Y I  F +D+L V+D L +A +S P      E K E+  LK+L EG+ MT  ++    ++
Sbjct: 170 YGIQGFCKDLLEVADILEKATESVP----QEEIKEENPHLKNLYEGLVMTEVQIQKVFKK 225

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +G+ K++    +F+P  H+A+F  P +     T+  V + GY ++ R LRPALV ++K
Sbjct: 226 HGLLKLNPVGARFDPYEHEALFHTPVEGKEPGTVALVTKVGYKLHGRTLRPALVGVAK 283


>gi|218893857|ref|YP_002442726.1| heat shock protein GrpE [Pseudomonas aeruginosa LESB58]
 gi|254799607|sp|B7V1H4|GRPE_PSEA8 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|218774085|emb|CAW29901.1| heat shock protein GrpE [Pseudomonas aeruginosa LESB58]
          Length = 186

 Score =  105 bits (262), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 52/150 (34%), Positives = 93/150 (62%), Gaps = 8/150 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D+ LR++A+++N+RRR +++ + A  +++ KFA D+L+V D L R L+        S+ 
Sbjct: 38  QDQALRMVADLQNVRRRAEQDVEKAHKFALEKFAGDLLAVVDTLERGLEM-------SDP 90

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
             E++ K + EG+E+T +    TL RY V+ ++ + + FNP  +QAM  +   +    ++
Sbjct: 91  NDEAI-KPMREGMELTLKMFDDTLRRYQVEALNPEGEPFNPEQYQAMAMQESASAEPGSV 149

Query: 164 IKVVQDGYAINERVLRPALVSISKGKTQNP 193
           +KV Q GY +N R+LRPA+V +SK   + P
Sbjct: 150 LKVFQKGYLLNGRLLRPAMVVVSKAPAETP 179


>gi|324518850|gb|ADY47220.1| GrpE protein [Ascaris suum]
          Length = 277

 Score =  105 bits (261), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 56/156 (35%), Positives = 90/156 (57%), Gaps = 16/156 (10%)

Query: 37  LNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPL 96
           L +   F+DKY R +A+ EN+RRR  ++ ++A+ ++I  F +D+L V+D          L
Sbjct: 127 LEECTSFKDKYTRALADTENVRRRGQKQVEEAKLFAIQGFCKDLLEVAD---------IL 177

Query: 97  DLANSEKKSESV-----LKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMF 151
           DLA    K E V     +KSL EG+EMTR  +     ++G+KK+  + +KF+PNMH+A+F
Sbjct: 178 DLAVGSMKKEDVETNPQIKSLHEGVEMTRTVLEKVFTKHGLKKLSPEGEKFDPNMHEAVF 237

Query: 152 EEPHDTV--PANTIIKVVQDGYAINERVLRPALVSI 185
           + P D        + +V+  GYA+  R +R A V +
Sbjct: 238 QVPKDQTKYGPGYVAQVMTIGYALQGRPIRAAKVGV 273


>gi|118497870|ref|YP_898920.1| chaperone GrpE (heat shock protein). Hsp70/Hsc70 protein regulator
           activity [Francisella tularensis subsp. novicida U112]
 gi|194323843|ref|ZP_03057619.1| co-chaperone GrpE [Francisella tularensis subsp. novicida FTE]
 gi|166215264|sp|A0Q7F1|GRPE_FRATN RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|118423776|gb|ABK90166.1| chaperone GrpE (heat shock protein). Hsp70/Hsc70 protein regulator
           activity [Francisella novicida U112]
 gi|194322207|gb|EDX19689.1| co-chaperone GrpE [Francisella tularensis subsp. novicida FTE]
          Length = 195

 Score =  105 bits (261), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 94/150 (62%), Gaps = 9/150 (6%)

Query: 38  NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD 97
           +  ++F+D+ LR  AEMEN+R+R +R+  +A+ + I KFA+++L V D++ +AL      
Sbjct: 54  DSCDQFKDEALRAKAEMENIRKRAERDVSNARKFGIEKFAKELLPVIDSIEQAL------ 107

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
               E K E  + ++ EGIE+T + ++  L++ GV+++  K +KF+PN+H+AM   P+  
Sbjct: 108 --KHEVKLEEAI-AMKEGIELTAKMLVDILKKNGVEELHPKGEKFDPNLHEAMAMIPNPE 164

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISK 187
              NTI  V Q GY +N R++R A V I K
Sbjct: 165 FEDNTIFDVFQKGYMLNGRIVRAAKVVIVK 194


>gi|241958030|ref|XP_002421734.1| GrpE protein homolog, mitochondrial precursor, putative;
           mitochondrial matrix protein, putative [Candida
           dubliniensis CD36]
 gi|223645079|emb|CAX39673.1| GrpE protein homolog, mitochondrial precursor, putative [Candida
           dubliniensis CD36]
          Length = 241

 Score =  105 bits (261), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 55/149 (36%), Positives = 85/149 (57%), Gaps = 4/149 (2%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           ++ Y R +A+  +L+  T  E + A+ +++ KFA+D+L   DN + AL     D      
Sbjct: 97  KNHYARAVADFRHLQETTKTEVQKAKDFALQKFAKDLLDSLDNFNLALGHVKEDTL---- 152

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           K    ++SL EG++MT+     TL +YG++KID  DQ F+PN+H+A F+         T+
Sbjct: 153 KLNDEVRSLYEGVDMTKTVFEKTLNKYGIEKIDPIDQVFDPNLHEATFQMASPGKEPGTV 212

Query: 164 IKVVQDGYAINERVLRPALVSISKGKTQN 192
             V Q GY +NERVLRPA V + K +  N
Sbjct: 213 FHVQQVGYTLNERVLRPAKVGVVKSEDDN 241


>gi|2392281|pdb|1DKG|A Chain A, Crystal Structure Of The Nucleotide Exchange Factor Grpe
           Bound To The Atpase Domain Of The Molecular Chaperone
           Dnak
 gi|2392282|pdb|1DKG|B Chain B, Crystal Structure Of The Nucleotide Exchange Factor Grpe
           Bound To The Atpase Domain Of The Molecular Chaperone
           Dnak
          Length = 197

 Score =  105 bits (261), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 56/148 (37%), Positives = 92/148 (62%), Gaps = 10/148 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LRV AEMENLRRRT+ + + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 59  RDGILRVKAEMENLRRRTELDIEKAHKFALEKFINELLPVIDSLDRALEVA--DKANPD- 115

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
                + +++E IE+T + M+  + ++GV+ I   +   +PN+HQA+   E  D  P N 
Sbjct: 116 -----MSAMVEDIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGN- 169

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ ++Q GY +N R +R A+V+++K K 
Sbjct: 170 VLGIMQKGYTLNGRTIRAAMVTVAKAKA 197


>gi|221481522|gb|EEE19908.1| co-chaperone GrpE, putative [Toxoplasma gondii GT1]
          Length = 347

 Score =  105 bits (261), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 92/163 (56%), Gaps = 20/163 (12%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS-------- 93
           E +DK LR  A+MEN R R  +E    + Y+++ FA+ ML V+D ++ A +S        
Sbjct: 184 ELQDKALRAFADMENARMRHQKEMASLKDYAVSDFAKAMLEVADAMAYATNSLKEAVQTD 243

Query: 94  --------APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPN 145
                     LD+A  + +    L+ + +G+++T   +  TL+R+GV++ + + +KFNP 
Sbjct: 244 ALIGPEENGDLDVATLKAR----LQQIYDGVKLTENLLHKTLDRFGVEQYNPEGEKFNPA 299

Query: 146 MHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           +H+A+FE  H       + +V+Q GY I ERVLR A V +SKG
Sbjct: 300 LHEALFELEHPEKAKGEVAQVIQRGYKIKERVLRAAKVGVSKG 342


>gi|237838707|ref|XP_002368651.1| co-chaperone GrpE, putative [Toxoplasma gondii ME49]
 gi|211966315|gb|EEB01511.1| co-chaperone GrpE, putative [Toxoplasma gondii ME49]
          Length = 347

 Score =  105 bits (261), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 92/163 (56%), Gaps = 20/163 (12%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS-------- 93
           E +DK LR  A+MEN R R  +E    + Y+++ FA+ ML V+D ++ A +S        
Sbjct: 184 ELQDKALRAFADMENARMRHQKEMASLKDYAVSDFAKAMLEVADAMAYATNSLKEAVQTD 243

Query: 94  --------APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPN 145
                     LD+A  + +    L+ + +G+++T   +  TL+R+GV++ + + +KFNP 
Sbjct: 244 ALIGPEENGDLDVATLKAR----LQQIYDGVKLTENLLHKTLDRFGVEQYNPEGEKFNPA 299

Query: 146 MHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           +H+A+FE  H       + +V+Q GY I ERVLR A V +SKG
Sbjct: 300 LHEALFELEHPEKAKGEVAQVIQRGYKIKERVLRAAKVGVSKG 342


>gi|104780011|ref|YP_606509.1| heat shock protein GrpE [Pseudomonas entomophila L48]
 gi|122985962|sp|Q1IF60|GRPE_PSEE4 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|95108998|emb|CAK13694.1| heat shock protein GrpE [Pseudomonas entomophila L48]
          Length = 184

 Score =  105 bits (261), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 60/183 (32%), Positives = 109/183 (59%), Gaps = 12/183 (6%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           M+++ +D EKN ++  +      + +   EE L  +   +D+ LR  A+++N+RRR +++
Sbjct: 1   MADEQLD-EKNLNSEEAGAVNGDARVQELEEQLAAA---KDQSLRAAADLQNIRRRAEQD 56

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
            + A  +++ KFA D+L + D+L R L+     L+N++   +  +K + EGIE+T +   
Sbjct: 57  VEKAHKFALEKFAGDLLPIIDSLERGLE-----LSNAD---DDTIKPMREGIELTLKMFH 108

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
            TL+RY ++ ++   + FN   HQAM  +    V  N+++KV Q GY +N R+LRPA+V 
Sbjct: 109 DTLKRYNLEALEPHGEPFNAEHHQAMAMQESADVEPNSVLKVFQKGYLLNGRLLRPAMVV 168

Query: 185 ISK 187
           +SK
Sbjct: 169 VSK 171


>gi|156843906|ref|XP_001645018.1| hypothetical protein Kpol_1072p30 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156115673|gb|EDO17160.1| hypothetical protein Kpol_1072p30 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 233

 Score =  105 bits (261), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 57/168 (33%), Positives = 95/168 (56%), Gaps = 8/168 (4%)

Query: 25  EEKSEINIPEESLN----QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDM 80
           EE+ +I   E  LN    ++ E +D+ LR +A+  NL+  T ++ + A+ +++ KFA+D+
Sbjct: 65  EEQKKIKELETKLNTKTKEAVELKDRLLRSVADFRNLQEVTKKDVQKARDFALQKFAKDL 124

Query: 81  LSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQ 140
           L   DN   AL++        + K    +  L  G++MTR     TL+++G++K+D   +
Sbjct: 125 LESVDNFGHALNA----FQEDDIKGNKEIHDLYTGVKMTRDIFEKTLKKHGIEKLDPMGE 180

Query: 141 KFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
            F+PN H+A FE  H      T+  V Q G+ +N+RV+RPA V I KG
Sbjct: 181 AFDPNKHEATFELAHPDKEPGTVFHVQQIGFTLNDRVIRPAKVGIVKG 228


>gi|221505480|gb|EEE31125.1| co-chaperone GrpE, putative [Toxoplasma gondii VEG]
          Length = 347

 Score =  105 bits (261), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 92/163 (56%), Gaps = 20/163 (12%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS-------- 93
           E +DK LR  A+MEN R R  +E    + Y+++ FA+ ML V+D ++ A +S        
Sbjct: 184 ELQDKALRAFADMENARMRHQKEMASLKDYAVSDFAKAMLEVADAMAYATNSLKEAVQTD 243

Query: 94  --------APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPN 145
                     LD+A  + +    L+ + +G+++T   +  TL+R+GV++ + + +KFNP 
Sbjct: 244 ALIGPEENGDLDVATLKAR----LQQIYDGVKLTENLLHKTLDRFGVEQYNPEGEKFNPA 299

Query: 146 MHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           +H+A+FE  H       + +V+Q GY I ERVLR A V +SKG
Sbjct: 300 LHEALFELEHPEKAKGEVAQVIQRGYKIKERVLRAAKVGVSKG 342


>gi|68063513|ref|XP_673751.1| co-chaperone GrpE [Plasmodium berghei strain ANKA]
 gi|56491825|emb|CAI01968.1| co-chaperone GrpE, putative [Plasmodium berghei]
          Length = 211

 Score =  105 bits (261), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 54/146 (36%), Positives = 90/146 (61%), Gaps = 4/146 (2%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           +E L  ++  ++KYL V+AE ENLR R  +E ++++ Y I+ FA+ +L V+DNLS A+  
Sbjct: 70  DEKLVDNQVLKEKYLSVLAEKENLRTRYMKEIENSKLYCISNFAKSLLDVADNLSLAIK- 128

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
              +++    KS   + ++ +GIEMT   + +   +YG+ K +  ++KFNP  H+A+FE 
Sbjct: 129 ---NISEESLKSNEEINNIYKGIEMTETILHNIFNKYGIDKYNPINEKFNPMFHEAIFEV 185

Query: 154 PHDTVPANTIIKVVQDGYAINERVLR 179
              T    T+  V+Q GY IN+R+LR
Sbjct: 186 SDTTKEKGTVATVIQPGYKINDRILR 211


>gi|52782982|sp|Q9KWS8|GRPE_BACTR RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|9309332|dbj|BAB03214.1| grpE [Geobacillus thermoglucosidasius]
          Length = 224

 Score =  105 bits (261), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 52/146 (35%), Positives = 86/146 (58%), Gaps = 9/146 (6%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E  ++YLR+ A+ EN RRRT RE + A+ Y       D+L V DN  RAL          
Sbjct: 88  EMENRYLRLYADFENFRRRTRREMEAAEKYRAQSLVSDLLPVLDNFERALKI-------- 139

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
            K  +   KS+++G+EM  R ++  L++ GV+ I+A  + F+P++HQA+ +        N
Sbjct: 140 -KAEDEQAKSILQGMEMVYRSVLDALKKEGVEAIEAVGKPFDPHLHQAVMQVEDSNYEPN 198

Query: 162 TIIKVVQDGYAINERVLRPALVSISK 187
           T+++ +Q GY + +RV+RPA+V +S+
Sbjct: 199 TVVEELQKGYKLKDRVIRPAMVKVSQ 224


>gi|319760664|ref|YP_004124602.1| protein grpE [Candidatus Blochmannia vafer str. BVAF]
 gi|318039378|gb|ADV33928.1| protein grpE [Candidatus Blochmannia vafer str. BVAF]
          Length = 196

 Score =  104 bits (260), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 99/175 (56%), Gaps = 9/175 (5%)

Query: 17  SNANSSTAEEKSEINIPEESLNQSEEF-RDKYLRVIAEMENLRRRTDREKKDAQSYSIAK 75
           SN N+    +  +I   E  L+Q +E  RD  LR+ AE+EN+RRR  +E + A  +++ +
Sbjct: 30  SNINNIIDLKNDQIIKLELQLSQLKEHERDTVLRLQAEIENIRRRNIQEIEKAHKFALER 89

Query: 76  FARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI 135
           F  ++L V DNL RAL            ++ +    ++EGI++T +  + T+ ++GV+ I
Sbjct: 90  FVAELLPVIDNLERALGMVD--------RTNNSFSMIVEGIDLTLKSFLDTVYKFGVESI 141

Query: 136 DAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
                 FNP +HQA+         AN ++ ++Q GY +N R++RPA+V++SK K 
Sbjct: 142 HEIHVPFNPEIHQAISTIESKECQANQVLTIIQKGYLLNGRLIRPAMVTVSKSKC 196


>gi|83719694|ref|YP_441853.1| heat shock protein GrpE [Burkholderia thailandensis E264]
 gi|167618790|ref|ZP_02387421.1| co-chaperone GrpE [Burkholderia thailandensis Bt4]
 gi|257138021|ref|ZP_05586283.1| heat shock protein GrpE [Burkholderia thailandensis E264]
 gi|123767684|sp|Q2SYZ6|GRPE_BURTA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|83653519|gb|ABC37582.1| co-chaperone GrpE [Burkholderia thailandensis E264]
          Length = 178

 Score =  104 bits (260), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 56/148 (37%), Positives = 87/148 (58%), Gaps = 12/148 (8%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E ++ +LR  AE EN+RRR   +   A  ++I  FA ++L V D+L  A+     DLA  
Sbjct: 43  ELQESFLRAKAETENVRRRAQDDVAKAHKFAIESFAENLLPVLDSLEAAVGDTSGDLAKV 102

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
                       EG+E+T R++ S LE+  V  ++   +KF+P++HQA+   P D  P N
Sbjct: 103 R-----------EGVELTLRQLTSALEKGRVAALNPVGEKFDPHLHQAISMVPADQEP-N 150

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGK 189
           T++ V+Q GY I +RVLRPALV++++ K
Sbjct: 151 TVVAVLQKGYTIADRVLRPALVTVAQPK 178


>gi|167740048|ref|ZP_02412822.1| co-chaperone GrpE [Burkholderia pseudomallei 14]
          Length = 185

 Score =  104 bits (260), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 56/148 (37%), Positives = 87/148 (58%), Gaps = 12/148 (8%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E ++ +LR  AE EN+RRR   +   A  ++I  FA ++L V D+L  A+     DLA  
Sbjct: 50  ELQESFLRAKAETENVRRRAQDDVAKAHKFAIEGFAENLLPVLDSLEAAVGDTSGDLAKV 109

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
                       EG+E+T R++ S LE+  V  ++   +KF+P++HQA+   P D  P N
Sbjct: 110 R-----------EGVELTLRQLTSALEKGRVAALNPVGEKFDPHLHQAISMVPADQEP-N 157

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGK 189
           T++ V+Q GY I +RVLRPALV++++ K
Sbjct: 158 TVVAVLQKGYTIADRVLRPALVTVAQPK 185


>gi|167035720|ref|YP_001670951.1| heat shock protein GrpE [Pseudomonas putida GB-1]
 gi|189041746|sp|B0KIS6|GRPE_PSEPG RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|166862208|gb|ABZ00616.1| GrpE protein [Pseudomonas putida GB-1]
          Length = 184

 Score =  104 bits (260), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 64/184 (34%), Positives = 103/184 (55%), Gaps = 17/184 (9%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           ++EK+++ E+  +  N +  +E  E         Q    +D+ LRV AE +N  RR ++E
Sbjct: 6   LNEKDLNAEEAAAVDNGARVQELEE---------QLAAAKDQSLRVAAEAQNSIRRAEQE 56

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
              A+ +++ KF+ D+L V D+L        L LA+S    E V K + EG+E+T +   
Sbjct: 57  VDKARKFALEKFSSDLLPVIDSLE-------LALAHSSADDEHV-KQIREGVELTLKMFQ 108

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
            TL+RY ++ +D   Q FNP  HQAM  + +  V  N+++ V Q GY +N R+LRPA+V 
Sbjct: 109 DTLKRYNLEAVDPHGQPFNPEHHQAMAMQENAEVEPNSVLNVFQKGYLLNGRLLRPAMVV 168

Query: 185 ISKG 188
           +SK 
Sbjct: 169 VSKA 172


>gi|53720437|ref|YP_109423.1| heat shock protein GrpE [Burkholderia pseudomallei K96243]
 gi|53725766|ref|YP_103887.1| heat shock protein GrpE [Burkholderia mallei ATCC 23344]
 gi|67642153|ref|ZP_00440914.1| co-chaperone GrpE [Burkholderia mallei GB8 horse 4]
 gi|76809228|ref|YP_334695.1| heat shock protein GrpE [Burkholderia pseudomallei 1710b]
 gi|121600962|ref|YP_991847.1| co-chaperone GrpE [Burkholderia mallei SAVP1]
 gi|124386129|ref|YP_001027086.1| co-chaperone GrpE [Burkholderia mallei NCTC 10229]
 gi|126441538|ref|YP_001060291.1| co-chaperone GrpE [Burkholderia pseudomallei 668]
 gi|126448278|ref|YP_001081737.1| co-chaperone GrpE [Burkholderia mallei NCTC 10247]
 gi|126451559|ref|YP_001067550.1| co-chaperone GrpE [Burkholderia pseudomallei 1106a]
 gi|134280430|ref|ZP_01767141.1| co-chaperone GrpE [Burkholderia pseudomallei 305]
 gi|166998822|ref|ZP_02264674.1| co-chaperone GrpE [Burkholderia mallei PRL-20]
 gi|167721075|ref|ZP_02404311.1| co-chaperone GrpE [Burkholderia pseudomallei DM98]
 gi|167817264|ref|ZP_02448944.1| co-chaperone GrpE [Burkholderia pseudomallei 91]
 gi|167825674|ref|ZP_02457145.1| co-chaperone GrpE [Burkholderia pseudomallei 9]
 gi|167847162|ref|ZP_02472670.1| co-chaperone GrpE [Burkholderia pseudomallei B7210]
 gi|167895745|ref|ZP_02483147.1| co-chaperone GrpE [Burkholderia pseudomallei 7894]
 gi|167904136|ref|ZP_02491341.1| co-chaperone GrpE [Burkholderia pseudomallei NCTC 13177]
 gi|167912395|ref|ZP_02499486.1| co-chaperone GrpE [Burkholderia pseudomallei 112]
 gi|167920349|ref|ZP_02507440.1| co-chaperone GrpE [Burkholderia pseudomallei BCC215]
 gi|217420744|ref|ZP_03452249.1| co-chaperone GrpE [Burkholderia pseudomallei 576]
 gi|226194197|ref|ZP_03789796.1| co-chaperone GrpE [Burkholderia pseudomallei Pakistan 9]
 gi|237813681|ref|YP_002898132.1| co-chaperone GrpE [Burkholderia pseudomallei MSHR346]
 gi|242316934|ref|ZP_04815950.1| co-chaperone GrpE [Burkholderia pseudomallei 1106b]
 gi|254178889|ref|ZP_04885543.1| co-chaperone GrpE [Burkholderia mallei ATCC 10399]
 gi|254180758|ref|ZP_04887356.1| co-chaperone GrpE [Burkholderia pseudomallei 1655]
 gi|254191593|ref|ZP_04898096.1| co-chaperone GrpE [Burkholderia pseudomallei Pasteur 52237]
 gi|254194978|ref|ZP_04901408.1| co-chaperone GrpE [Burkholderia pseudomallei S13]
 gi|254202597|ref|ZP_04908960.1| co-chaperone GrpE [Burkholderia mallei FMH]
 gi|254207935|ref|ZP_04914285.1| co-chaperone GrpE [Burkholderia mallei JHU]
 gi|254261491|ref|ZP_04952545.1| co-chaperone GrpE [Burkholderia pseudomallei 1710a]
 gi|254299152|ref|ZP_04966602.1| co-chaperone GrpE [Burkholderia pseudomallei 406e]
 gi|254355925|ref|ZP_04972203.1| co-chaperone GrpE [Burkholderia mallei 2002721280]
 gi|81684997|sp|Q62HD3|GRPE_BURMA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|81690244|sp|Q63R45|GRPE_BURPS RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|123598097|sp|Q3JP08|GRPE_BURP1 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|166215252|sp|A3MNA1|GRPE_BURM7 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|166215253|sp|A2S567|GRPE_BURM9 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|166215254|sp|A1V0U4|GRPE_BURMS RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|166215255|sp|A3NYX9|GRPE_BURP0 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|166215256|sp|A3ND70|GRPE_BURP6 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|52210851|emb|CAH36839.1| putative heat shock protein [Burkholderia pseudomallei K96243]
 gi|52429189|gb|AAU49782.1| co-chaperone GrpE [Burkholderia mallei ATCC 23344]
 gi|76578681|gb|ABA48156.1| co-chaperone GrpE [Burkholderia pseudomallei 1710b]
 gi|121229772|gb|ABM52290.1| co-chaperone GrpE [Burkholderia mallei SAVP1]
 gi|124294149|gb|ABN03418.1| co-chaperone GrpE [Burkholderia mallei NCTC 10229]
 gi|126221031|gb|ABN84537.1| co-chaperone GrpE [Burkholderia pseudomallei 668]
 gi|126225201|gb|ABN88741.1| co-chaperone GrpE [Burkholderia pseudomallei 1106a]
 gi|126241148|gb|ABO04241.1| co-chaperone GrpE [Burkholderia mallei NCTC 10247]
 gi|134248437|gb|EBA48520.1| co-chaperone GrpE [Burkholderia pseudomallei 305]
 gi|147746844|gb|EDK53921.1| co-chaperone GrpE [Burkholderia mallei FMH]
 gi|147751829|gb|EDK58896.1| co-chaperone GrpE [Burkholderia mallei JHU]
 gi|148024900|gb|EDK83078.1| co-chaperone GrpE [Burkholderia mallei 2002721280]
 gi|157808965|gb|EDO86135.1| co-chaperone GrpE [Burkholderia pseudomallei 406e]
 gi|157939264|gb|EDO94934.1| co-chaperone GrpE [Burkholderia pseudomallei Pasteur 52237]
 gi|160694803|gb|EDP84811.1| co-chaperone GrpE [Burkholderia mallei ATCC 10399]
 gi|169651727|gb|EDS84420.1| co-chaperone GrpE [Burkholderia pseudomallei S13]
 gi|184211297|gb|EDU08340.1| co-chaperone GrpE [Burkholderia pseudomallei 1655]
 gi|217396156|gb|EEC36173.1| co-chaperone GrpE [Burkholderia pseudomallei 576]
 gi|225933662|gb|EEH29650.1| co-chaperone GrpE [Burkholderia pseudomallei Pakistan 9]
 gi|237503333|gb|ACQ95651.1| co-chaperone GrpE [Burkholderia pseudomallei MSHR346]
 gi|238523246|gb|EEP86686.1| co-chaperone GrpE [Burkholderia mallei GB8 horse 4]
 gi|242140173|gb|EES26575.1| co-chaperone GrpE [Burkholderia pseudomallei 1106b]
 gi|243064907|gb|EES47093.1| co-chaperone GrpE [Burkholderia mallei PRL-20]
 gi|254220180|gb|EET09564.1| co-chaperone GrpE [Burkholderia pseudomallei 1710a]
          Length = 185

 Score =  104 bits (260), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 56/148 (37%), Positives = 87/148 (58%), Gaps = 12/148 (8%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E ++ +LR  AE EN+RRR   +   A  ++I  FA ++L V D+L  A+     DLA  
Sbjct: 50  ELQESFLRAKAETENVRRRAQDDVAKAHKFAIEGFAENLLPVLDSLEAAVGDTSGDLAKV 109

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
                       EG+E+T R++ S LE+  V  ++   +KF+P++HQA+   P D  P N
Sbjct: 110 R-----------EGVELTLRQLTSALEKGRVAALNPVGEKFDPHLHQAISMVPADQEP-N 157

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGK 189
           T++ V+Q GY I +RVLRPALV++++ K
Sbjct: 158 TVVAVLQKGYTIADRVLRPALVTVAQPK 185


>gi|153869428|ref|ZP_01999027.1| GrpE protein [Beggiatoa sp. PS]
 gi|152074078|gb|EDN70975.1| GrpE protein [Beggiatoa sp. PS]
          Length = 237

 Score =  104 bits (260), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 110/184 (59%), Gaps = 10/184 (5%)

Query: 13  EKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYS 72
           E+NP +  ++ + E+    + EE+  ++E   D  LR  AE +NL++R  RE ++ + + 
Sbjct: 60  EENPIDEAATLSIEEITRQLAEET-QKAENHWDNLLRKQAEYDNLQKRMTREVENVRKFG 118

Query: 73  IAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGV 132
           + K A ++L+V D++   +D+A         K E+ L S+ EG+ +T + +   + ++G+
Sbjct: 119 LEKIATELLTVKDSMELGIDAA--------TKPETNLDSIHEGMTLTLKMLSDVMAKFGI 170

Query: 133 KKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG-KTQ 191
           ++I+  ++KFNP  H+AM  +P  +V   T++ V Q GY +NER+LRPA V ++K  +T+
Sbjct: 171 QEINPIEEKFNPQWHEAMAMQPMPSVEDGTVLLVHQKGYLLNERLLRPARVVVAKAVQTE 230

Query: 192 NPTE 195
            P E
Sbjct: 231 KPIE 234


>gi|121607968|ref|YP_995775.1| heat shock protein GrpE [Verminephrobacter eiseniae EF01-2]
 gi|226737235|sp|A1WGK0|GRPE_VEREI RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|121552608|gb|ABM56757.1| GrpE protein [Verminephrobacter eiseniae EF01-2]
          Length = 181

 Score =  104 bits (260), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 87/152 (57%), Gaps = 13/152 (8%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           +S E  D++LR  AE EN RRR + E   A+ + I  FA  +L V+D+L  AL       
Sbjct: 42  KSAELADQFLRAKAEAENARRRAEDEVAKARKFGIESFAESLLPVADSLDAAL------- 94

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID-AKDQKFNPNMHQAMFEEPHDT 157
                  E+  + L EG + T R++ STLER  V  I+ A   KF+P+ HQA+   P + 
Sbjct: 95  ----AIKEATPQQLREGADATLRQLTSTLERNKVLAINPAAGTKFDPHQHQAISVVPAEQ 150

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISKGK 189
             ANT++ V+Q GY I ERVLRPALV++S  K
Sbjct: 151 -EANTVVAVLQKGYVIAERVLRPALVTVSASK 181


>gi|327270566|ref|XP_003220060.1| PREDICTED: grpE protein homolog 1, mitochondrial-like [Anolis
           carolinensis]
          Length = 225

 Score =  104 bits (260), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 60/182 (32%), Positives = 105/182 (57%), Gaps = 9/182 (4%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
           ++ +++++ +  +A     EEK+++   EE L   +E  DKY R +A+ ENLR+RT +  
Sbjct: 51  NQNHVERKPDSDSATKILMEEKTKL---EEQL---KEINDKYKRALADAENLRQRTQKLV 104

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
           ++A+ Y I  F +D+L V+D L +A +S P       K+    LK+L EG+ MT  ++  
Sbjct: 105 EEAKLYGIQSFCKDLLEVADVLEKATESVP---KEELKEGNPHLKNLYEGLAMTEAQIQK 161

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
             +++G+ K++    KF+P  H+A+F  P +     T+  V + GY ++ R LRPALV +
Sbjct: 162 VFKKHGLIKLNPLGAKFDPYEHEALFHVPMEDKEPGTVALVSKVGYKLHGRTLRPALVGV 221

Query: 186 SK 187
            K
Sbjct: 222 VK 223


>gi|167580686|ref|ZP_02373560.1| co-chaperone GrpE [Burkholderia thailandensis TXDOH]
          Length = 178

 Score =  104 bits (260), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 56/148 (37%), Positives = 87/148 (58%), Gaps = 12/148 (8%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E ++ +LR  AE EN+RRR   +   A  ++I  FA ++L V D+L  A+     DLA  
Sbjct: 43  ELQESFLRAKAETENVRRRAQDDVAKAHKFAIENFAENLLPVLDSLEAAVGDTSGDLAKV 102

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
                       EG+E+T R++ S LE+  V  ++   +KF+P++HQA+   P D  P N
Sbjct: 103 R-----------EGVELTLRQLTSALEKGRVAALNPVGEKFDPHLHQAISMVPADQEP-N 150

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGK 189
           T++ V+Q GY I +RVLRPALV++++ K
Sbjct: 151 TVVAVLQKGYTIADRVLRPALVTVAQPK 178


>gi|116788847|gb|ABK25023.1| unknown [Picea sitchensis]
          Length = 322

 Score =  104 bits (260), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 94/151 (62%), Gaps = 5/151 (3%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS-----APLD 97
            ++K LR  AE+EN+  R  RE +  + ++I  FA+ +L V+DNLSRA        + +D
Sbjct: 159 MQEKVLRSYAEVENVMDRARREAESTKKFAIQSFAKSLLDVADNLSRASSVVKESFSKID 218

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
            +     +  +LK+L+EG+ MT +++   L+++GV++ D  +++F+PNMH A+F+    +
Sbjct: 219 PSKDSSGAAPLLKTLLEGVAMTEKQLSDVLKKHGVERFDPLNEQFDPNMHMAVFQVQDAS 278

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISKG 188
               ++  V++ GY +++RV+RPA V + +G
Sbjct: 279 KQTGSVAVVLKPGYTLHDRVIRPAEVGVVEG 309


>gi|167563984|ref|ZP_02356900.1| co-chaperone GrpE [Burkholderia oklahomensis EO147]
          Length = 185

 Score =  104 bits (260), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 56/148 (37%), Positives = 87/148 (58%), Gaps = 12/148 (8%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E ++ +LR  AE EN+RRR   +   A  ++I  FA ++L V D+L  A+     DLA  
Sbjct: 50  ELQESFLRAKAETENVRRRAQDDVAKAHKFAIENFAENLLPVLDSLEAAVGDTSGDLAKV 109

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
                       EG+E+T R++ S LE+  V  ++   +KF+P++HQA+   P D  P N
Sbjct: 110 R-----------EGVELTLRQLQSALEKGRVAALNPVGEKFDPHLHQAISMVPADQEP-N 157

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGK 189
           T++ V+Q GY I +RVLRPALV++++ K
Sbjct: 158 TVVAVLQKGYTIADRVLRPALVTVAQPK 185


>gi|170572895|ref|XP_001892279.1| GrpE protein homolog, mitochondrial precursor [Brugia malayi]
 gi|158602480|gb|EDP38898.1| GrpE protein homolog, mitochondrial precursor, putative [Brugia
           malayi]
          Length = 257

 Score =  104 bits (260), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 93/156 (59%), Gaps = 16/156 (10%)

Query: 37  LNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPL 96
           L +   F+DKY R +AE+EN+RRR  ++ ++A+ ++I  F +D+L V+D          L
Sbjct: 109 LEEVASFKDKYTRALAEVENVRRRGHKQTEEAKVFAIQXFCKDLLEVAD---------IL 159

Query: 97  DLANSEKKSESV-----LKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMF 151
           DLA    K E +     LK+L EG+EMTR  +  +  ++G+K+I  + +KF+P +H+A+F
Sbjct: 160 DLAVGAVKKEELDKNISLKNLFEGLEMTRTVLQKSFVKHGLKQISPEGEKFDPALHEAVF 219

Query: 152 EEPHDTVP--ANTIIKVVQDGYAINERVLRPALVSI 185
           + P D     +  I +V++ GYA+  R +R A V +
Sbjct: 220 QIPKDKAKFESGYIAQVIKIGYALQNRPIRAAKVGV 255


>gi|326919445|ref|XP_003205991.1| PREDICTED: grpE protein homolog 1, mitochondrial-like isoform 1
           [Meleagris gallopavo]
 gi|326919447|ref|XP_003205992.1| PREDICTED: grpE protein homolog 1, mitochondrial-like isoform 2
           [Meleagris gallopavo]
          Length = 222

 Score =  104 bits (260), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 98/173 (56%), Gaps = 11/173 (6%)

Query: 16  PSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAK 75
           PS A     EEK+++        Q +E  DKY R +A+ EN+R+R+ +  ++A+ Y I  
Sbjct: 58  PSAAERMLTEEKAKLE------EQLKEVTDKYKRALADAENVRQRSQKLVEEAKLYGIQG 111

Query: 76  FARDMLSVSDNLSRALDSAPLDLANSEKKSES-VLKSLIEGIEMTRREMMSTLERYGVKK 134
           F +D+L V+D L +A +S P      E K E+  LKSL EG+ MT  ++    +++G+ +
Sbjct: 112 FCKDLLEVADILEKATESVP----KEEIKDENPHLKSLYEGLVMTEVQIQKVFKKHGLLR 167

Query: 135 IDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           ++    KF+P  H+A+F  P +     TI  V + GY ++ R LRPALV + K
Sbjct: 168 LNPVGAKFDPYEHEALFHAPMEGKEPGTIALVSKIGYKLHGRTLRPALVGVVK 220


>gi|157826033|ref|YP_001493753.1| GrpE protein [Rickettsia akari str. Hartford]
 gi|226737164|sp|A8GPC0|GRPE_RICAH RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|157799991|gb|ABV75245.1| GrpE protein [Rickettsia akari str. Hartford]
          Length = 178

 Score =  104 bits (260), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 61/170 (35%), Positives = 103/170 (60%), Gaps = 18/170 (10%)

Query: 19  ANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFAR 78
           AN    E K+EI          EE +D+ +R  AE++N R+R ++ + +A+ Y+IA FA+
Sbjct: 24  ANPEITELKAEI----------EELKDRLIRTTAEIDNTRKRLEKARDEAKDYAIATFAK 73

Query: 79  DMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
           ++L+VSDNLSRAL   P   ANS+ +    + ++I G++MT+ E+     R+ +++I  +
Sbjct: 74  ELLNVSDNLSRALAHKP---ANSDIE----VTNIIAGVQMTKDELDKIFHRHHIEEIKPE 126

Query: 139 -DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
               F+ N+H A+ +  H     N+II ++Q GY I +R+LRPA V ++K
Sbjct: 127 IGSMFDYNLHNAISQIEHPDHEPNSIITLMQSGYKIRDRLLRPATVQVAK 176


>gi|189425886|ref|YP_001953063.1| GrpE protein [Geobacter lovleyi SZ]
 gi|226737138|sp|B3E7X0|GRPE_GEOLS RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|189422145|gb|ACD96543.1| GrpE protein [Geobacter lovleyi SZ]
          Length = 181

 Score =  104 bits (260), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 102/190 (53%), Gaps = 23/190 (12%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEE-----------FRDKYLRVIAEMENLR 58
           ++KE+         A E +E+  PE+ L Q +E             DK LR  A++EN R
Sbjct: 1   MNKEQQDLQTEQEAAVETAELT-PEQQLVQLQEKLAAKEQEAKDNWDKLLRERADLENYR 59

Query: 59  RRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEM 118
           +R  REK++  +Y I     ++L V DNL RAL+ A          +E  L +L+EG++M
Sbjct: 60  KRASREKEELLNYGIKSLVEEVLPVLDNLERALEHA----------NEDGLPALVEGVKM 109

Query: 119 TRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERV 177
           T   + + L+++GV  +D      F+P  HQAM +      P NTI++  Q GY + ER+
Sbjct: 110 THTLLQTALKKFGVCAVDGNCGTLFDPAFHQAMAQVETSDHPNNTIVQEFQKGYLLKERL 169

Query: 178 LRPALVSISK 187
           LRP++VS++K
Sbjct: 170 LRPSMVSVAK 179


>gi|317052547|ref|YP_004113663.1| GrpE protein [Desulfurispirillum indicum S5]
 gi|316947631|gb|ADU67107.1| GrpE protein [Desulfurispirillum indicum S5]
          Length = 174

 Score =  104 bits (260), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 59/185 (31%), Positives = 110/185 (59%), Gaps = 14/185 (7%)

Query: 5   MSEKNIDK--EKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
           MSE N ++  E+  S A  +T +E + +   E+ + + EE   + LR+ AE EN ++R +
Sbjct: 1   MSEHNTNEASEQAQSPAEGATPDEGAALANLEKRVQEKEE---QLLRLHAEFENFKKRNN 57

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           +E+ DA  ++  +  +D+L++ DNL  A+   P          +   K++ +G+EMTR++
Sbjct: 58  KERHDAVRFANQQIIKDLLTMLDNLDLAISHIP--------AGDEAYKAIRDGVEMTRKQ 109

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
             + LE+YG++++   D +F+PN H+A+ +E       N I+ V+Q GY +++RV+RPA+
Sbjct: 110 FANLLEKYGLQEV-PTDGEFDPNHHEAVMQEASPDHENNHIVAVLQKGYLLHDRVVRPAM 168

Query: 183 VSISK 187
           V + K
Sbjct: 169 VKVCK 173


>gi|83644085|ref|YP_432520.1| molecular chaperone GrpE (heat shock protein) [Hahella chejuensis
           KCTC 2396]
 gi|83632128|gb|ABC28095.1| Molecular chaperone GrpE (heat shock protein) [Hahella chejuensis
           KCTC 2396]
          Length = 286

 Score =  104 bits (260), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 94/145 (64%), Gaps = 5/145 (3%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +++ LRV AEM+N+RRR + +   A+ +++ +F +++L V D+L +A+++       + +
Sbjct: 146 KEQVLRVHAEMQNVRRRAENDVDKARKFALERFVKELLPVVDSLEKAVEAC-----GATE 200

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
            ++S + +L +G+EMT   + S L+++ V+ +D   Q FNP  H+AM   P   V  NT+
Sbjct: 201 SADSQVTTLKDGVEMTLSLLNSGLKKFEVEVVDPMGQPFNPEFHEAMSMAPQADVEPNTV 260

Query: 164 IKVVQDGYAINERVLRPALVSISKG 188
           I V+Q GY ++ R++RPA+V +SKG
Sbjct: 261 IAVLQKGYLLSGRLIRPAMVMVSKG 285


>gi|221056222|ref|XP_002259249.1| co-chaperone grpe [Plasmodium knowlesi strain H]
 gi|193809320|emb|CAQ40022.1| co-chaperone grpe, putative [Plasmodium knowlesi strain H]
          Length = 297

 Score =  104 bits (260), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 95/154 (61%), Gaps = 4/154 (2%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           EE +  ++  ++KYL V+AE EN+R R  +E ++++ Y I+ FA+ +L V+DNLS A+ +
Sbjct: 147 EEKMVDNKILKEKYLSVLAENENIRHRYVKEIENSKLYCISNFAKSLLDVADNLSLAIKN 206

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
              +   S K++E +  ++ +GI+MT   + +   +YG+ K D  ++KFNP  H+A+FE 
Sbjct: 207 INEE---SLKQNEEI-SNIYKGIQMTETILHNIFNKYGIDKYDPINEKFNPLFHEALFEI 262

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
              T    T+  VVQ GY I +R+LR A V + K
Sbjct: 263 NDSTKEKGTVATVVQQGYKIKDRILRAAKVGVVK 296


>gi|167571128|ref|ZP_02364002.1| co-chaperone GrpE [Burkholderia oklahomensis C6786]
          Length = 185

 Score =  104 bits (260), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 56/148 (37%), Positives = 87/148 (58%), Gaps = 12/148 (8%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E ++ +LR  AE EN+RRR   +   A  ++I  FA ++L V D+L  A+     DLA  
Sbjct: 50  ELQESFLRAKAETENVRRRAQDDVAKAHKFAIENFAENLLPVLDSLEAAVGDTSGDLAKV 109

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
                       EG+E+T R++ S LE+  V  ++   +KF+P++HQA+   P D  P N
Sbjct: 110 R-----------EGVELTLRQLQSALEKGRVAALNPVGEKFDPHLHQAISMVPADQEP-N 157

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGK 189
           T++ V+Q GY I +RVLRPALV++++ K
Sbjct: 158 TVVAVLQKGYTIADRVLRPALVTVAQPK 185


>gi|297529329|ref|YP_003670604.1| GrpE protein [Geobacillus sp. C56-T3]
 gi|297252581|gb|ADI26027.1| GrpE protein [Geobacillus sp. C56-T3]
          Length = 213

 Score =  104 bits (259), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 88/146 (60%), Gaps = 9/146 (6%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E   +YLR+ A+ EN RRRT +E + A+ Y     A D+L V DN  RAL    ++  N 
Sbjct: 77  EMEHRYLRLYADFENFRRRTRQEMEAAEKYRAQSLASDLLPVLDNFERALK---IETDNE 133

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
           + KS      +++G+EM  R ++  L++ GV+ I+A  + F+P +HQA+ +   +    N
Sbjct: 134 QAKS------ILQGMEMVYRSLVDALKKEGVEAIEAVGKPFDPYLHQAVMQAEAEGYEPN 187

Query: 162 TIIKVVQDGYAINERVLRPALVSISK 187
           T+++ +Q GY + +RVLRPA+V +S+
Sbjct: 188 TVVEELQKGYKLKDRVLRPAMVKVSQ 213


>gi|261418477|ref|YP_003252159.1| heat shock protein GrpE [Geobacillus sp. Y412MC61]
 gi|319767562|ref|YP_004133063.1| GrpE protein [Geobacillus sp. Y412MC52]
 gi|261374934|gb|ACX77677.1| GrpE protein [Geobacillus sp. Y412MC61]
 gi|317112428|gb|ADU94920.1| GrpE protein [Geobacillus sp. Y412MC52]
          Length = 213

 Score =  104 bits (259), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 88/146 (60%), Gaps = 9/146 (6%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E   +YLR+ A+ EN RRRT +E + A+ Y     A D+L V DN  RAL    ++  N 
Sbjct: 77  EMEHRYLRLYADFENFRRRTRQEMEAAEKYRAQSLASDLLPVLDNFERALK---IETDNE 133

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
           + KS      +++G+EM  R ++  L++ GV+ I+A  + F+P +HQA+ +   +    N
Sbjct: 134 QAKS------ILQGMEMVYRSLVDALKKEGVEAIEAVGKPFDPYLHQAVMQAEAEGYEPN 187

Query: 162 TIIKVVQDGYAINERVLRPALVSISK 187
           T+++ +Q GY + +RVLRPA+V +S+
Sbjct: 188 TVVEELQKGYKLKDRVLRPAMVKVSQ 213


>gi|161525804|ref|YP_001580816.1| heat shock protein GrpE [Burkholderia multivorans ATCC 17616]
 gi|189349475|ref|YP_001945103.1| heat shock protein GrpE [Burkholderia multivorans ATCC 17616]
 gi|221200977|ref|ZP_03574017.1| co-chaperone GrpE [Burkholderia multivorans CGD2M]
 gi|221206571|ref|ZP_03579584.1| co-chaperone GrpE [Burkholderia multivorans CGD2]
 gi|221214428|ref|ZP_03587399.1| co-chaperone GrpE [Burkholderia multivorans CGD1]
 gi|226737115|sp|A9AGC0|GRPE_BURM1 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|56798250|dbj|BAD82892.1| GrpE [Burkholderia multivorans]
 gi|160343233|gb|ABX16319.1| GrpE protein [Burkholderia multivorans ATCC 17616]
 gi|189333497|dbj|BAG42567.1| molecular chaperone [Burkholderia multivorans ATCC 17616]
 gi|221165685|gb|EED98160.1| co-chaperone GrpE [Burkholderia multivorans CGD1]
 gi|221173880|gb|EEE06314.1| co-chaperone GrpE [Burkholderia multivorans CGD2]
 gi|221178827|gb|EEE11234.1| co-chaperone GrpE [Burkholderia multivorans CGD2M]
          Length = 181

 Score =  104 bits (259), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 86/148 (58%), Gaps = 12/148 (8%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E ++ YLR  AE EN+RRR   +   A  ++I  FA  +L V D+L  A+     D+A  
Sbjct: 46  ELQESYLRAKAETENVRRRAQEDVAKAHKFAIESFAEHLLPVLDSLEAAVGDTSGDIAK- 104

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
                     + EG+E+T R++ S LE+  V  I+   +KF+P+ HQA+   P D  P N
Sbjct: 105 ----------VREGVELTLRQLTSALEKGRVVAINPVGEKFDPHRHQAISMVPADQEP-N 153

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGK 189
           T++ V+Q GY I +RVLRPALV++++ K
Sbjct: 154 TVVTVLQKGYTIADRVLRPALVTVAQPK 181


>gi|34581400|ref|ZP_00142880.1| grpE protein [Rickettsia sibirica 246]
 gi|28262785|gb|EAA26289.1| grpE protein [Rickettsia sibirica 246]
          Length = 178

 Score =  104 bits (259), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 95/148 (64%), Gaps = 8/148 (5%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           EE +DK +R  AE++N R+R ++ + +A+ Y+IA FA+++L+VSDNLSRAL   P   AN
Sbjct: 36  EELKDKLIRTTAEIDNTRKRLEKARDEAKDYAIATFAKELLNVSDNLSRALAHKP---AN 92

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVP 159
           S+ +    + ++I G++MT+ E+     ++ +++I  +    F+ N+H A+ +  H    
Sbjct: 93  SDVE----VTNIIAGVQMTKDELDKVFHKHHIEEIKPEIGSMFDYNLHNAIAQVEHPDHA 148

Query: 160 ANTIIKVVQDGYAINERVLRPALVSISK 187
            N+II ++Q GY I +R+LRPA V + K
Sbjct: 149 PNSIITLMQSGYKIRDRLLRPATVQVVK 176


>gi|307109239|gb|EFN57477.1| hypothetical protein CHLNCDRAFT_11196 [Chlorella variabilis]
          Length = 153

 Score =  104 bits (259), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 58/153 (37%), Positives = 89/153 (58%), Gaps = 7/153 (4%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           E+ +DK LR +A+MENLR RT R   + + +++    +++L V+DNL RA  S P +  +
Sbjct: 1   EDLKDKLLRTLADMENLRERTARTSAETKQFAVQGLVKNLLEVADNLERAAGSVPPEDVH 60

Query: 101 SEK-----KSESVLKSLIEGIEMTRREMM--STLERYGVKKIDAKDQKFNPNMHQAMFEE 153
            +      ++  +L+SL EG+ MT   +M  S     GV + D    KF+PN+H A+FE 
Sbjct: 61  QDSEIDRDRALKLLRSLREGVLMTDTVLMKASRAGWGGVTRYDPLGDKFDPNLHNALFEV 120

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           P  T    T+  VV+ GY +NERV+R A V +S
Sbjct: 121 PDATKDPGTVAVVVKRGYELNERVVRAAEVGVS 153


>gi|119190135|ref|XP_001245674.1| hypothetical protein CIMG_05115 [Coccidioides immitis RS]
          Length = 252

 Score =  104 bits (259), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 56/153 (36%), Positives = 90/153 (58%), Gaps = 10/153 (6%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD-LAN 100
           + +DKYLR +A+  NL+ RT R+   A+S++I +F  D++   DN  RAL++ P + L N
Sbjct: 101 DLKDKYLRSVADFRNLQERTKRDVDAARSFAIQRFGADLIESIDNFERALEAVPSEKLNN 160

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID------AKDQKFNPNMHQAMFEEP 154
            E K    L  L +G++MT + +M+TL+++G+++ D       K QKF+P +H+A F  P
Sbjct: 161 GENKD---LADLYDGLKMTEKVIMNTLKKHGLERFDPSELVEGKPQKFDPKLHEATFMAP 217

Query: 155 HDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
                   I+ V   G+ +N RVLR A V + K
Sbjct: 218 APGKEDGDILHVQTKGFILNGRVLRAAKVGVVK 250


>gi|330807467|ref|YP_004351929.1| Chaperone protein (heat shock protein) [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|327375575|gb|AEA66925.1| Chaperone protein (heat shock protein) [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
          Length = 188

 Score =  104 bits (259), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 107/180 (59%), Gaps = 14/180 (7%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +N+D  +   ++    A   + + + EE L  ++   D+ LRV A+++N+RRR +++ + 
Sbjct: 10  QNLDANQASQDSGEDLA---ARVQVLEEQLAGAQ---DQALRVAADLQNVRRRAEQDVEK 63

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A  +++ +FA D+L + D+L R L+     L+N + ++   ++ + EGIE+T +    TL
Sbjct: 64  AHKFALERFAGDLLPIIDSLERGLE-----LSNPDDEN---IRPMREGIELTLKMFQDTL 115

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +RY ++ +D   + FN   HQAM  +    V  N+++KV Q GY +N R+LRPA+V +SK
Sbjct: 116 KRYQLETLDPHGEPFNAEHHQAMAMQESADVEPNSVLKVFQKGYLLNGRLLRPAMVVVSK 175


>gi|268679983|ref|YP_003304414.1| GrpE protein [Sulfurospirillum deleyianum DSM 6946]
 gi|268618014|gb|ACZ12379.1| GrpE protein [Sulfurospirillum deleyianum DSM 6946]
          Length = 186

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 98/165 (59%), Gaps = 8/165 (4%)

Query: 23  TAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLS 82
           + E+KSE+   EE   +  E  DKYLR  A+ +N++RR ++EK  A +Y+   FARD+L 
Sbjct: 30  SCEQKSEV---EELKAKVAELEDKYLRANADFDNMKRRLEKEKMQAIAYAHEVFARDLLP 86

Query: 83  VSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKF 142
             D+L  A+ +      N++  S  +   + EG+E+T  +   T E++GV+ +D  +  F
Sbjct: 87  AIDSLEMAILAGN----NADVDSADLFVKVKEGLELTIEQFRKTFEKHGVELVDI-EGTF 141

Query: 143 NPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +PN H+A+ +   +   +  I++V Q GY I ER+LRPA+VSI K
Sbjct: 142 DPNFHEAVMQVESEEKSSGEILQVFQKGYKIKERILRPAMVSIVK 186


>gi|303322541|ref|XP_003071262.1| co-chaperone GrpE family protein [Coccidioides posadasii C735 delta
           SOWgp]
 gi|240110964|gb|EER29117.1| co-chaperone GrpE family protein [Coccidioides posadasii C735 delta
           SOWgp]
 gi|320033024|gb|EFW14974.1| mitochondrial co-chaperone GrpE [Coccidioides posadasii str.
           Silveira]
          Length = 252

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 56/153 (36%), Positives = 90/153 (58%), Gaps = 10/153 (6%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD-LAN 100
           + +DKYLR +A+  NL+ RT R+   A+S++I +F  D++   DN  RAL++ P + L N
Sbjct: 101 DLKDKYLRSVADFRNLQERTKRDVDAARSFAIQRFGADLIESIDNFERALEAVPSEKLNN 160

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID------AKDQKFNPNMHQAMFEEP 154
            E K    L  L +G++MT + +M+TL+++G+++ D       K QKF+P +H+A F  P
Sbjct: 161 GENKD---LADLYDGLKMTEKVIMNTLKKHGLERFDPSELVEGKPQKFDPKLHEATFMAP 217

Query: 155 HDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
                   I+ V   G+ +N RVLR A V + K
Sbjct: 218 APGKEDGDILHVQTKGFILNGRVLRAAKVGVVK 250


>gi|156056012|ref|XP_001593930.1| hypothetical protein SS1G_05358 [Sclerotinia sclerotiorum 1980]
 gi|154703142|gb|EDO02881.1| hypothetical protein SS1G_05358 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 242

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 94/152 (61%), Gaps = 6/152 (3%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN- 100
           + +DK LR IA+  NL+ RT R+ + A+ ++I KFA+D++   DNL RAL + P +  + 
Sbjct: 89  DLKDKLLRSIADFRNLQERTKRDMQAAKDFAIQKFAKDLVDSVDNLDRALTTVPAEKLSV 148

Query: 101 -SEKKSESV--LKSLIEGIEMTRREMMSTLERYGVKKID--AKDQKFNPNMHQAMFEEPH 155
            +EK++E    L +L EG++MT   +MSTL+++G+++ D   + +KFNPN H+A F  P 
Sbjct: 149 PAEKRNEHQQDLITLHEGLKMTEDILMSTLKKHGLERFDPSVESEKFNPNEHEATFMTPM 208

Query: 156 DTVPANTIIKVVQDGYAINERVLRPALVSISK 187
                 T+    Q G+ +N R+LR A V + K
Sbjct: 209 PGKEDGTVFHTQQKGFKLNGRILRAAKVGVVK 240


>gi|121998259|ref|YP_001003046.1| GrpE protein [Halorhodospira halophila SL1]
 gi|166215267|sp|A1WX32|GRPE_HALHL RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|121589664|gb|ABM62244.1| GrpE protein [Halorhodospira halophila SL1]
          Length = 240

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 53/148 (35%), Positives = 91/148 (61%), Gaps = 8/148 (5%)

Query: 40  SEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLA 99
           +EE  D+ LR+ AE+EN RRR +++   A+   + K   D+L V D+L   + +A    A
Sbjct: 85  AEEHWDQVLRMRAELENARRRAEKDVDQAKRQGLEKVCGDLLQVKDSLEMGVQAAEDAEA 144

Query: 100 NSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVP 159
           + EK        L+EG ++T + +    ER+ +++I+ + ++FNP+ H+AM  +P D   
Sbjct: 145 DREK--------LLEGSQLTLKMLNQVFERFEIEEINPQGERFNPDYHEAMAAQPSDEQE 196

Query: 160 ANTIIKVVQDGYAINERVLRPALVSISK 187
            NT+++VVQ GY + +R+LRPALV ++K
Sbjct: 197 PNTVLQVVQKGYRLQDRLLRPALVVVAK 224


>gi|261856069|ref|YP_003263352.1| GrpE protein [Halothiobacillus neapolitanus c2]
 gi|261836538|gb|ACX96305.1| GrpE protein [Halothiobacillus neapolitanus c2]
          Length = 190

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 107/181 (59%), Gaps = 12/181 (6%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           N D  K      S TA E  +  +  E L + ++   + LR+ AEMENLR+R +R+ ++A
Sbjct: 22  NQDMNKEEQAEQSVTANETLDPRVLAEQLAERDQ---EILRLHAEMENLRKRVERDIENA 78

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
           + +++ +F   +L V D+L   + +       SE ++ S L+ + EG EMT    + T+E
Sbjct: 79  RKFALERFVDGLLPVIDSLEMGIQA-------SENENTS-LEKIREGSEMTLNLFLQTME 130

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           ++GV  +    ++FNP+ HQA+  +PH+  PA+ +I V+Q GY + +R++RPALV +SK 
Sbjct: 131 KFGVHPVHPVGERFNPDHHQAISVQPHEG-PADHVISVMQKGYLLRDRLVRPALVVVSKN 189

Query: 189 K 189
           +
Sbjct: 190 Q 190


>gi|126649229|ref|XP_001388287.1| co-chaperone GrpE [Cryptosporidium parvum Iowa II]
 gi|126117209|gb|EAZ51309.1| co-chaperone GrpE, putative [Cryptosporidium parvum Iowa II]
          Length = 234

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 60/151 (39%), Positives = 95/151 (62%), Gaps = 5/151 (3%)

Query: 37  LNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPL 96
           +++ EE ++K LR +AE ENLR+R  ++ + A+ YSI+ FA+ +L VSD+LSRAL S  +
Sbjct: 88  IHKIEESKEKLLRSLAENENLRQRHRKDLEAAREYSISGFAKSLLDVSDSLSRALLS--V 145

Query: 97  DLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHD 156
           D+ N +K S   +KSL  GI MT   +    E +G+K+  +  ++FNP  H+A+FE    
Sbjct: 146 DIENVDKNS---IKSLYNGISMTYSSLEKVFEAHGIKRFQSLGKQFNPKEHEAVFEVKDT 202

Query: 157 TVPANTIIKVVQDGYAINERVLRPALVSISK 187
           + P   + + +  GY I++RVLR A V+  K
Sbjct: 203 SKPKGQVCEELLPGYKIHDRVLRAAKVATIK 233


>gi|13324704|ref|NP_077813.1| grpE protein homolog 1, mitochondrial precursor [Rattus norvegicus]
 gi|6226823|sp|P97576|GRPE1_RAT RecName: Full=GrpE protein homolog 1, mitochondrial; AltName:
           Full=Mt-GrpE#1; Flags: Precursor
 gi|2804584|gb|AAC53534.1| mt-GrpE#1 precursor [Rattus norvegicus]
 gi|67678103|gb|AAH97312.1| GrpE-like 1, mitochondrial [Rattus norvegicus]
 gi|149047377|gb|EDM00047.1| GrpE-like 1, mitochondrial [Rattus norvegicus]
          Length = 217

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 60/179 (33%), Positives = 103/179 (57%), Gaps = 9/179 (5%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           + + + +PS+A+ +  EEK ++   EE L ++ E   KY R +A+ ENLR+R+ +  ++A
Sbjct: 46  HCEPKTDPSSADKTLLEEKVKL---EEQLKETME---KYKRALADTENLRQRSQKLVEEA 99

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
           + Y I  F +D+L V+D L +A  S P +  ++       LKSL EG+ MT  ++     
Sbjct: 100 KLYGIQGFCKDLLEVADILEKATQSVPKEEVSNNNPH---LKSLYEGLVMTEVQIQKVFT 156

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           ++G+ ++D    KF+P  H+A+F  P +     T+  V + GY ++ R LRPALV + K
Sbjct: 157 KHGLLRLDPIGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVK 215


>gi|239948343|ref|ZP_04700096.1| co-chaperone GrpE [Rickettsia endosymbiont of Ixodes scapularis]
 gi|241563426|ref|XP_002401699.1| grpe protein, putative [Ixodes scapularis]
 gi|215501891|gb|EEC11385.1| grpe protein, putative [Ixodes scapularis]
 gi|239922619|gb|EER22643.1| co-chaperone GrpE [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 178

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 96/148 (64%), Gaps = 8/148 (5%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           EE +DK +R  AE++N R+R ++ + +A+ Y+IA FA+++L+VSDNLSRAL   P   AN
Sbjct: 36  EELKDKLIRTTAEIDNTRKRLEKARDEAKDYAIATFAKELLNVSDNLSRALAHKP---AN 92

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVP 159
           S+ +    + ++I G++MT+ E+     ++ +++I  +    F+ N+H A+ +  H    
Sbjct: 93  SDIE----VTNIIAGVQMTKDELDKIFHKHHIEEIKPEIGSMFDYNLHNAISQIEHPDHA 148

Query: 160 ANTIIKVVQDGYAINERVLRPALVSISK 187
            N+II ++Q GY I +R+LRPA V ++K
Sbjct: 149 PNSIITLMQSGYKIRDRLLRPATVQVAK 176


>gi|119503071|ref|ZP_01625156.1| GrpE protein [marine gamma proteobacterium HTCC2080]
 gi|119461417|gb|EAW42507.1| GrpE protein [marine gamma proteobacterium HTCC2080]
          Length = 187

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 92/147 (62%), Gaps = 9/147 (6%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E +D  LR  A+  N++RR ++E   A+ +++ +F  ++L V DN+ RAL++A  D A  
Sbjct: 48  EAKDAALRAQADAVNVQRRAEQEVDKARKFALERFVSELLPVVDNMERALEAAGTDEA-- 105

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
                  +K ++EG+E+T++ ++  L+++GV+ ID   + F+P + QAM    +  V  N
Sbjct: 106 -------VKPIVEGVELTQKSLIDALQKHGVETIDPMGEPFDPQIAQAMSMVENPEVEPN 158

Query: 162 TIIKVVQDGYAINERVLRPALVSISKG 188
           T+I V+Q GY +N R++RPA+V +SK 
Sbjct: 159 TVIAVMQKGYQLNGRLVRPAMVMVSKA 185


>gi|115767169|ref|XP_798953.2| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
 gi|115951747|ref|XP_001179550.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
          Length = 168

 Score =  103 bits (258), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 91/151 (60%), Gaps = 2/151 (1%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           Q  E+ DKY R +AE EN+R R  ++  D++ YSI+ F +D+L V+D L +A  S P D 
Sbjct: 18  QVAEYTDKYKRALAETENVRMRFTKQLNDSKIYSISGFCKDLLEVADILGKATTSVPKD- 76

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID-AKDQKFNPNMHQAMFEEPHDT 157
           A S   +   LK+L EG+ MT  ++     +  ++ I+   ++KF+P++H+A+F+ P   
Sbjct: 77  AVSGADANIHLKNLFEGLVMTETQLQKVFAKNKLEVINPVNNEKFDPHIHEALFQIPVPD 136

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISKG 188
               T+  V + GY ++ER LRPALV ++K 
Sbjct: 137 KEPGTVAVVEKLGYKLHERTLRPALVGVTKA 167


>gi|15892900|ref|NP_360614.1| grpE protein [Rickettsia conorii str. Malish 7]
 gi|229586978|ref|YP_002845479.1| heat shock protein GrpE [Rickettsia africae ESF-5]
 gi|238651084|ref|YP_002916942.1| hypothetical protein RPR_07320 [Rickettsia peacockii str. Rustic]
 gi|22256764|sp|Q92GZ5|GRPE_RICCN RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|259647656|sp|C3PP76|GRPE_RICAE RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|259647657|sp|C4K2U3|GRPE_RICPU RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|15620090|gb|AAL03515.1| grpE protein [Rickettsia conorii str. Malish 7]
 gi|228022028|gb|ACP53736.1| GrpE protein [Rickettsia africae ESF-5]
 gi|238625182|gb|ACR47888.1| hypothetical protein RPR_07320 [Rickettsia peacockii str. Rustic]
          Length = 178

 Score =  103 bits (258), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 61/167 (36%), Positives = 104/167 (62%), Gaps = 10/167 (5%)

Query: 24  AEEKSEINIPEESLNQSE--EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDML 81
           AEE  E   PE +  ++E  E +DK +R  AE++N R+R ++ + +A+ Y+IA FA+++L
Sbjct: 17  AEEIVETANPEVTALKAEIEELKDKLIRTTAEIDNTRKRLEKARDEAKDYAIATFAKELL 76

Query: 82  SVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQ 140
           +VSDNLSRAL   P   ANS+ +    + ++I G++MT+ E+     ++ +++I  +   
Sbjct: 77  NVSDNLSRALAHKP---ANSDVE----VTNIIAGVQMTKDELDKVFHKHHIEEIKPEIGS 129

Query: 141 KFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            F+ N+H A+ +  H     N+II ++Q GY I +R+LRPA V + K
Sbjct: 130 MFDYNLHNAIAQIEHPDHAPNSIITLMQSGYKIRDRLLRPATVQVVK 176


>gi|309777619|ref|ZP_07672570.1| co-chaperone GrpE [Erysipelotrichaceae bacterium 3_1_53]
 gi|308914623|gb|EFP60412.1| co-chaperone GrpE [Erysipelotrichaceae bacterium 3_1_53]
          Length = 210

 Score =  103 bits (258), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 86/143 (60%), Gaps = 9/143 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           ++ Y +  A+ ENL++R   E  + + Y I  FA ++L V DNL RALD          K
Sbjct: 76  KNAYFKAYADTENLKKRLQAESDNVRKYRIQSFAMEILPVLDNLERALDV---------K 126

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
             +  +K+  +G EM  ++++  L++ GVK+I+A D+ F+PN HQA+ +E  + V +  +
Sbjct: 127 VDDQNIKNYAKGFEMIYQQLVHILDKEGVKEIEALDKPFDPNYHQALMQEAKEGVESGMV 186

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
           I+V+Q GY + +RVLR  LV +S
Sbjct: 187 IEVLQKGYMLKDRVLRATLVKVS 209


>gi|296812551|ref|XP_002846613.1| grpE [Arthroderma otae CBS 113480]
 gi|238841869|gb|EEQ31531.1| grpE [Arthroderma otae CBS 113480]
          Length = 243

 Score =  103 bits (258), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 96/155 (61%), Gaps = 11/155 (7%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAP---LDL 98
           + +DKYLR +A+  NL+ RT R+ + A++++I KFA D++   DNL RAL++ P   +D 
Sbjct: 89  DLKDKYLRSVADFRNLQERTRRDIEAARTFAIQKFAGDLIESIDNLERALEAVPAEKVDA 148

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKK------IDAKDQKFNPNMHQAMFE 152
           AN+++  +  +  L  G++MT   +M+TL+++GV +      ID + QKF+P+ H+A+F 
Sbjct: 149 ANAKENKD--VYELYSGLKMTEGILMNTLKKHGVVRFDPSELIDGQPQKFDPSRHEALFM 206

Query: 153 EPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            P +      I+ V   G+ +N R+LR A V + K
Sbjct: 207 SPMEGKQDGEILHVQNKGFTLNGRILRAAKVGVVK 241


>gi|67458794|ref|YP_246418.1| GrpE protein [Rickettsia felis URRWXCal2]
 gi|75535817|sp|Q4UJN5|GRPE_RICFE RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|67004327|gb|AAY61253.1| GrpE protein [Rickettsia felis URRWXCal2]
          Length = 179

 Score =  103 bits (258), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 61/170 (35%), Positives = 102/170 (60%), Gaps = 18/170 (10%)

Query: 19  ANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFAR 78
           AN    E K+EI          EE +DK +R  AE++N R+R ++ + +A+ Y+IA FA+
Sbjct: 24  ANPEITELKAEI----------EELKDKLIRTTAEIDNTRKRLEKARDEAKDYAIATFAK 73

Query: 79  DMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
           ++L+VSDNLSRAL   P   ANS+ +    + ++I G++MT+ E+     ++ +++I  +
Sbjct: 74  ELLNVSDNLSRALAHKP---ANSDIE----VTNIIAGVQMTKDELDKIFHKHHIEEIKPE 126

Query: 139 -DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
               F+ N+H A+ +  H     N+II ++Q GY I +R+LRPA V + K
Sbjct: 127 IGSMFDYNLHNAISQIEHPDHAPNSIITLMQSGYKIRDRLLRPATVQVVK 176


>gi|255713786|ref|XP_002553175.1| KLTH0D10692p [Lachancea thermotolerans]
 gi|238934555|emb|CAR22737.1| KLTH0D10692p [Lachancea thermotolerans]
          Length = 238

 Score =  103 bits (258), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 57/168 (33%), Positives = 100/168 (59%), Gaps = 8/168 (4%)

Query: 24  AEEKSEINIPEESL----NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARD 79
           +EE+ ++   EE L     ++ E++D+ LR +A+  NL+  T ++ + A+ Y++ KFA+D
Sbjct: 71  SEEQKKVQELEEKLAVKDKEAAEYKDRLLRSVADFRNLQEVTKKDIQKAKDYALQKFAKD 130

Query: 80  MLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKD 139
           +L   DN   AL++      ++++ +E  L  L  G++MT+     TL+++G++KID   
Sbjct: 131 LLDSVDNFGHALNA--FKPESTQQSTE--LSELYTGVKMTKDIFEKTLKKHGIEKIDPMG 186

Query: 140 QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           + F+PN H+A FE P+      T+  V Q G+ +N RV+RPA V I K
Sbjct: 187 ETFDPNRHEATFELPNPEKQPGTVFHVQQVGFTLNNRVIRPAKVGIVK 234


>gi|268593266|ref|ZP_06127487.1| co-chaperone GrpE [Providencia rettgeri DSM 1131]
 gi|291311162|gb|EFE51615.1| co-chaperone GrpE [Providencia rettgeri DSM 1131]
          Length = 197

 Score =  103 bits (258), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 54/146 (36%), Positives = 92/146 (63%), Gaps = 12/146 (8%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           R+  LR  AE+EN+RRRT+++ + A  +++ KF+ ++L V DNL RA+++A        +
Sbjct: 62  REAMLRAHAEIENIRRRTEQDIEKAHKFALEKFSNELLPVIDNLERAIEAA------DHE 115

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM--FEEPHDTVPAN 161
             ES  K+++EG+ +T +  +  + ++G++ +   +  FNP +HQAM   E P     AN
Sbjct: 116 SEES--KAMLEGLNLTLKTFLDAVAKFGIEPVSEVNVPFNPEVHQAMTMIESPDHQ--AN 171

Query: 162 TIIKVVQDGYAINERVLRPALVSISK 187
            +I V+Q GY +N R+LRPA+V +SK
Sbjct: 172 HVIDVMQKGYTLNNRLLRPAMVIVSK 197


>gi|88704206|ref|ZP_01101920.1| GrpE protein [Congregibacter litoralis KT71]
 gi|88701257|gb|EAQ98362.1| GrpE protein [Congregibacter litoralis KT71]
          Length = 203

 Score =  103 bits (258), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 90/146 (61%), Gaps = 12/146 (8%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD+ LR  AE +N +RR D++ + A+ +++ +F  ++L V DNL RALD+   D      
Sbjct: 63  RDQALRAQAEAQNAQRRADQDVEKARKFALERFCSELLPVVDNLERALDAINGD------ 116

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQA--MFEEPHDTVPAN 161
             +  L S+ EG+++T +  +  L ++ + ++D   + F+P +HQA  M E P D  P N
Sbjct: 117 --DPALSSIAEGVDLTLKSFVGALGKFQIVQLDPAGEPFDPQLHQAMSMIENP-DAEP-N 172

Query: 162 TIIKVVQDGYAINERVLRPALVSISK 187
           T++ V+Q GY +N R++RPA+V +SK
Sbjct: 173 TVLTVMQKGYTLNGRLVRPAMVMVSK 198


>gi|226311616|ref|YP_002771510.1| GrpE protein [Brevibacillus brevis NBRC 100599]
 gi|226094564|dbj|BAH43006.1| GrpE protein [Brevibacillus brevis NBRC 100599]
          Length = 196

 Score =  103 bits (258), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 53/163 (32%), Positives = 101/163 (61%), Gaps = 12/163 (7%)

Query: 26  EKSEINIPEESLN---QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLS 82
           E +E+N  +E+ +   Q+E+ +++ LR +A+M+NLRRR  +E++D   Y+  K   ++L 
Sbjct: 41  EATEMNWEQEAAHWKAQAEDHQNRMLRAMADMDNLRRRVRKEQEDLAKYASLKIVEELLP 100

Query: 83  VSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKF 142
           V DN  RAL         ++K+S +V +SL+EG+ M  R+M+   ++ G+  I+A+ + F
Sbjct: 101 VLDNFERAL--------AADKESMTV-ESLLEGVNMVYRQMVQVFDKEGLAAIEAQGKPF 151

Query: 143 NPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
           +P++HQA+ +  +    +  ++  +Q GY   +RV+RPA+V +
Sbjct: 152 DPHIHQAVMQTQNPEFESGVVVAELQKGYMFKDRVVRPAMVQV 194


>gi|57530061|ref|NP_001006458.1| grpE protein homolog 1, mitochondrial [Gallus gallus]
 gi|53136716|emb|CAG32687.1| hypothetical protein RCJMB04_32n8 [Gallus gallus]
          Length = 222

 Score =  103 bits (258), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 60/173 (34%), Positives = 98/173 (56%), Gaps = 11/173 (6%)

Query: 16  PSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAK 75
           P+ A     EEK+++        Q +E  DKY R +A+ EN+R+R+ +  ++A+ Y I  
Sbjct: 58  PTAAERMLTEEKAKLE------EQLKEVTDKYKRALADAENVRQRSQKLVEEAKLYGIQS 111

Query: 76  FARDMLSVSDNLSRALDSAPLDLANSEKKSESV-LKSLIEGIEMTRREMMSTLERYGVKK 134
           F +D+L V+D L +A +S P      E K E+  LKSL EG+ MT  ++    +++G+ +
Sbjct: 112 FCKDLLEVADILEKATESVP----KEEIKDENPHLKSLYEGLVMTEVQIQKVFKKHGLLR 167

Query: 135 IDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           ++    KF+P  H+A+F  P +     TI  V + GY ++ R LRPALV + K
Sbjct: 168 LNPVGAKFDPYEHEALFHAPMEGKEPGTIALVSKIGYKLHGRTLRPALVGVVK 220


>gi|302692146|ref|XP_003035752.1| hypothetical protein SCHCODRAFT_84403 [Schizophyllum commune H4-8]
 gi|300109448|gb|EFJ00850.1| hypothetical protein SCHCODRAFT_84403 [Schizophyllum commune H4-8]
          Length = 251

 Score =  103 bits (258), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 60/159 (37%), Positives = 87/159 (54%), Gaps = 17/159 (10%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS-- 101
           R +YL+  A+  NL+R   REK+  + ++I KFA+D+L   D LS AL S P   A    
Sbjct: 92  RLRYLQ--ADFLNLQRNASREKEQTRDFAITKFAKDLLETVDVLSLALKSIPSHHARPQA 149

Query: 102 -------------EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQ 148
                        EK     L  L  G+EMT+R++ STL +Y VK I+    KF+PNMH+
Sbjct: 150 DAPPPPQSADGKPEKGPAEYLHELYNGVEMTQRQLQSTLSKYNVKPIEPLGDKFDPNMHE 209

Query: 149 AMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           A+++ P       T+I V + GY I +RVLR A V +++
Sbjct: 210 ALYQAPIPGKEPGTVIDVQKTGYMIKDRVLRAAQVGVAQ 248


>gi|50290879|ref|XP_447872.1| hypothetical protein [Candida glabrata CBS 138]
 gi|52782863|sp|Q6FPH2|GRPE_CANGA RecName: Full=GrpE protein homolog, mitochondrial; Flags: Precursor
 gi|49527183|emb|CAG60821.1| unnamed protein product [Candida glabrata]
          Length = 231

 Score =  103 bits (257), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 90/150 (60%), Gaps = 6/150 (4%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPL-D 97
           ++ E +D+ LR +A+  NL+  T ++ + A+SY++ KFA+D+L   DN   AL +    D
Sbjct: 85  EAAELKDRLLRSVADFRNLQEVTKKDVEKAKSYALQKFAKDLLESVDNFGHALGAFKEED 144

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
           L  S++ S+     L  G++MTR     TL++YG++K+D   ++F+PN H+A FE     
Sbjct: 145 LEKSKEISD-----LYTGVKMTRDVFEKTLKKYGIEKLDPLGERFDPNKHEATFELAQPD 199

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISK 187
               T+  V Q GY +NERV+RPA V + K
Sbjct: 200 KEPGTVFHVQQLGYTLNERVIRPAKVGVVK 229


>gi|251796217|ref|YP_003010948.1| GrpE protein [Paenibacillus sp. JDR-2]
 gi|247543843|gb|ACT00862.1| GrpE protein [Paenibacillus sp. JDR-2]
          Length = 179

 Score =  103 bits (257), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 58/153 (37%), Positives = 88/153 (57%), Gaps = 9/153 (5%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           EE    +EE + +YLR  A+ +N RRRT +EK+D   Y+  K    +L V DN  RA+ +
Sbjct: 35  EELTKLAEENQQRYLRAQADFDNFRRRTQKEKEDLAQYASMKLIGQLLPVVDNFERAVAA 94

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
           A    AN +       ++L +G++M  R++  TL++ G+K +DA  + FNP  HQA+   
Sbjct: 95  AS---ANQD------FEALAKGVDMIFRQLEQTLQQEGLKAMDAVGEPFNPEFHQAIMTV 145

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
             D      I++ VQ GY + ERVLRPA+V +S
Sbjct: 146 ESDEHEEGIIVEEVQKGYILKERVLRPAMVKVS 178


>gi|302343493|ref|YP_003808022.1| GrpE protein [Desulfarculus baarsii DSM 2075]
 gi|301640106|gb|ADK85428.1| GrpE protein [Desulfarculus baarsii DSM 2075]
          Length = 197

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 88/154 (57%), Gaps = 10/154 (6%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           E+   Q  E  D+++R+ AE +N ++R +REK +    +    A D+L V DNL RAL +
Sbjct: 42  EQCQAQRAELEDRFMRLAAEFDNYKKRGEREKAEFLKRANEAMAGDLLPVLDNLERALGA 101

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
           A           E+  ++L +G+EM   E+  TLER+G++ IDA  Q F+P +H+AM ++
Sbjct: 102 A----------GEADKQTLQKGVEMVLGELRKTLERHGLEAIDALGQPFDPQLHEAMMQQ 151

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            +  V    ++   Q GY    R+LRPA+V ++K
Sbjct: 152 ENPDVEEGAVLSQFQKGYLFQGRLLRPAMVVVAK 185


>gi|119897355|ref|YP_932568.1| heat shock protein GrpE [Azoarcus sp. BH72]
 gi|226737105|sp|A1K4C6|GRPE_AZOSB RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|119669768|emb|CAL93681.1| probable heat shock protein GrpE [Azoarcus sp. BH72]
          Length = 188

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 91/162 (56%), Gaps = 16/162 (9%)

Query: 34  EESLNQSE----EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSR 89
           EE+L Q+E    E  D +LR  AE EN+RRR   +   A  ++  KFA  M+ V D+L  
Sbjct: 39  EETLRQAELKAAEHYDAWLRAKAEGENIRRRAQEDIAKATKFAAEKFASAMVPVKDSLEA 98

Query: 90  ALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQA 149
           AL                 ++ L EG+E+T ++++S  E  G+ + +   QKF+PN HQA
Sbjct: 99  ALAV-----------ENQTVEKLREGVELTLKQLVSAFEGAGLAEENPLGQKFDPNKHQA 147

Query: 150 MFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQ 191
           +     +  P NT+I V+Q GY ++ERV+RPALV +SK K Q
Sbjct: 148 ISAIEAEGEP-NTVINVLQKGYLLHERVVRPALVVVSKAKAQ 188


>gi|3122168|sp|O32481|GRPE_LEGPN RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|2522263|dbj|BAA22782.1| GrpE [Legionella pneumophila]
          Length = 199

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 57/175 (32%), Positives = 101/175 (57%), Gaps = 13/175 (7%)

Query: 12  KEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
           + + P+  + S    + ++ + E+  +++ E   K +R +AE+EN+RRR +RE  +A  Y
Sbjct: 36  QHQEPALGHPSYTALEEQLTLAEQKAHENWE---KSVRALAELENVRRRMEREVANAHKY 92

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
            + K    +L V D+L +AL  A       +K S+    S+ EG+E+T +  +  L+++ 
Sbjct: 93  GVEKLISALLPVVDSLEQALQLA-------DKNSDP---SMHEGLELTMKLFLDALQKFD 142

Query: 132 VKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           V++ID   Q F+P  H+AM  +P    P N++I V Q GY +++RV+RPA V +S
Sbjct: 143 VEQIDPLGQTFDPQQHEAMSMQPAPGAPPNSVITVFQKGYKLSDRVIRPARVIVS 197


>gi|56421040|ref|YP_148358.1| heat shock protein GrpE [Geobacillus kaustophilus HTA426]
 gi|81675749|sp|Q5KWZ6|GRPE_GEOKA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|56380882|dbj|BAD76790.1| chaperone protein (heat shock protein) (HSP-70 cofactor)
           [Geobacillus kaustophilus HTA426]
          Length = 213

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 88/146 (60%), Gaps = 9/146 (6%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E   +YLR+ A+ EN RRRT +E + A+ Y     A D+L V DN  RAL    ++  N 
Sbjct: 77  EMEHRYLRLYADFENFRRRTRQEMEAAEKYRAQSLASDLLPVLDNFERALK---IETDNE 133

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
           + KS      +++G+EM  R ++  L++ GV+ I+A  + F+P +HQA+ +   +    N
Sbjct: 134 QAKS------ILQGMEMVYRSLVDALKKEGVEAIEAVGKPFDPYLHQAVMQAEAEGYEPN 187

Query: 162 TIIKVVQDGYAINERVLRPALVSISK 187
           T+++ +Q GY + +RVLRPA+V +S+
Sbjct: 188 TVVEELQKGYKLKDRVLRPAMVKVSQ 213


>gi|54294924|ref|YP_127339.1| heat-shock protein GrpE(HSP-70 cofactor) [Legionella pneumophila
           str. Lens]
 gi|81679175|sp|Q5WV14|GRPE_LEGPL RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|53754756|emb|CAH16243.1| Heat-shock protein GrpE(HSP-70 cofactor) [Legionella pneumophila
           str. Lens]
 gi|307610752|emb|CBX00359.1| heat-shock protein GrpE(HSP-70 cofactor) [Legionella pneumophila
           130b]
          Length = 199

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 57/175 (32%), Positives = 101/175 (57%), Gaps = 13/175 (7%)

Query: 12  KEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
           + + P+  + S    + ++ + E+  +++ E   K +R +AE+EN+RRR +RE  +A  Y
Sbjct: 36  QHQEPALGHPSYTALEEQLTLAEQKAHENWE---KSVRALAELENVRRRMEREVANAHKY 92

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
            + K    +L V D+L +AL  A       +K S+    S+ EG+E+T +  +  L+++ 
Sbjct: 93  GVEKLISALLPVVDSLEQALQLA-------DKNSDP---SMHEGLELTMKLFLDALQKFD 142

Query: 132 VKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           V++ID   Q F+P  H+AM  +P    P N++I V Q GY +++RV+RPA V +S
Sbjct: 143 VEQIDPLGQTFDPQQHEAMSMQPAPGAPPNSVITVFQKGYKLSDRVIRPARVIVS 197


>gi|52842243|ref|YP_096042.1| heat shock protein GrpE [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
 gi|81680426|sp|Q5ZTY2|GRPE_LEGPH RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|52629354|gb|AAU28095.1| heat shock protein GrpE [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
          Length = 200

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 57/175 (32%), Positives = 101/175 (57%), Gaps = 13/175 (7%)

Query: 12  KEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
           + + P+  + S    + ++ + E+  +++ E   K +R +AE+EN+RRR +RE  +A  Y
Sbjct: 37  QHQEPALGHPSYTALEEQLTLAEQKAHENWE---KSVRALAELENVRRRMEREVANAHKY 93

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
            + K    +L V D+L +AL  A       +K S+    S+ EG+E+T +  +  L+++ 
Sbjct: 94  GVEKLISALLPVVDSLEQALQLA-------DKNSDP---SMHEGLELTMKLFLDALQKFD 143

Query: 132 VKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           V++ID   Q F+P  H+AM  +P    P N++I V Q GY +++RV+RPA V +S
Sbjct: 144 VEQIDPLGQTFDPQQHEAMSMQPAPGAPPNSVITVFQKGYKLSDRVIRPARVIVS 198


>gi|73670872|ref|YP_306887.1| heat shock protein GrpE [Methanosarcina barkeri str. Fusaro]
 gi|121725578|sp|Q465Y5|GRPE_METBF RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|72398034|gb|AAZ72307.1| heat shock protein [Methanosarcina barkeri str. Fusaro]
          Length = 209

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 94/155 (60%), Gaps = 14/155 (9%)

Query: 45  DKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKK 104
           +KY R+ A+ +N ++RT R+ ++ +   + +   D + V+DN  RAL SA         K
Sbjct: 68  EKYYRLAADFDNFKKRTARQMEENRKAVLEQVLLDFVEVTDNFDRALKSA---------K 118

Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKIDA-KDQKFNPNMHQAMFEEPHDTVPANTI 163
           +   + S++ GIE   R+  S LE+YG++KI++ K  +F+P+ H+A+       VP NTI
Sbjct: 119 TAEDMSSIVSGIEQLSRQFFSILEKYGLEKIESEKASEFDPHRHEAVHHIETSEVPDNTI 178

Query: 164 IKVVQDGYAINERVLRPALVSISKGKTQNPTEEKK 198
           + V + GYA+N +V+RPA+VS+++    NP E +K
Sbjct: 179 VDVYKTGYALNSKVIRPAMVSVAR----NPDEAEK 209


>gi|302879635|ref|YP_003848199.1| GrpE protein [Gallionella capsiferriformans ES-2]
 gi|302582424|gb|ADL56435.1| GrpE protein [Gallionella capsiferriformans ES-2]
          Length = 178

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 54/161 (33%), Positives = 95/161 (59%), Gaps = 16/161 (9%)

Query: 33  PEESLNQSE----EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLS 88
           PEE L  +E    E  D ++   AE EN+RRR   +   AQ +++ +F+ ++L+V D+L 
Sbjct: 30  PEELLQAAERRAQEHYDAWMYAKAESENIRRRASEDVSKAQKFAVERFSNEVLAVKDSLE 89

Query: 89  RALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQ 148
             L               + ++S   G+E+T +++ S  E++ + +I+   +K +P+ HQ
Sbjct: 90  AGL-----------AVETATVESFKSGMELTLKQLSSVFEKFNILEINPVGEKLDPHKHQ 138

Query: 149 AMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
           A+   P + +PANT++ V+Q GY +N+RVLRPALV +S+G+
Sbjct: 139 AISMVPSE-LPANTVVSVMQKGYTLNDRVLRPALVLVSQGQ 178


>gi|13277394|ref|NP_077798.1| grpE protein homolog 1, mitochondrial precursor [Mus musculus]
 gi|52782975|sp|Q99LP6|GRPE1_MOUSE RecName: Full=GrpE protein homolog 1, mitochondrial; AltName:
           Full=Mt-GrpE#1; Flags: Precursor
 gi|12805609|gb|AAH02284.1| GrpE-like 1, mitochondrial [Mus musculus]
 gi|26339532|dbj|BAC33437.1| unnamed protein product [Mus musculus]
 gi|26341190|dbj|BAC34257.1| unnamed protein product [Mus musculus]
 gi|26354260|dbj|BAC40758.1| unnamed protein product [Mus musculus]
 gi|74179956|dbj|BAE36532.1| unnamed protein product [Mus musculus]
 gi|148705558|gb|EDL37505.1| GrpE-like 1, mitochondrial [Mus musculus]
          Length = 217

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 105/180 (58%), Gaps = 11/180 (6%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           + + + +P +A+ +  EEK+++   EE L ++ E   KY R +A+ ENLR+R+ +  ++A
Sbjct: 46  HCEPKTDPPSADKTLLEEKAKL---EEQLRETME---KYKRALADTENLRQRSQKLVEEA 99

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLD-LANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           + Y I  F +D+L V+D L +A  S P + ++N+       LKSL EG+ MT  ++    
Sbjct: 100 KLYGIQGFCKDLLEVADILEKATQSVPKEEISNNNPH----LKSLYEGLVMTEVQIQKVF 155

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            ++G+ ++D    KF+P  H+A+F  P +     T+  V + GY ++ R LRPALV + K
Sbjct: 156 TKHGLLRLDPIGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVK 215


>gi|302659226|ref|XP_003021306.1| hypothetical protein TRV_04582 [Trichophyton verrucosum HKI 0517]
 gi|291185198|gb|EFE40688.1| hypothetical protein TRV_04582 [Trichophyton verrucosum HKI 0517]
          Length = 245

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 95/155 (61%), Gaps = 11/155 (7%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAP---LDL 98
           + +DKYLR +A+  NL+ RT R+ + A++++I KFA D++   DNL RAL + P   +D 
Sbjct: 91  DLKDKYLRSVADFRNLQERTRRDIEAARTFAIQKFAADLIESIDNLERALAAVPPEKVDA 150

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKK------IDAKDQKFNPNMHQAMFE 152
           AN+++  +  +  L  G++MT   +M+TL+++GV +      +D + QKF+P+ H+A+F 
Sbjct: 151 ANAKENKD--VYELFSGLKMTEGVLMNTLKKHGVVRFDPSELVDGQPQKFDPSRHEALFM 208

Query: 153 EPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            P +      I+ V   G+ +N R+LR A V + K
Sbjct: 209 SPMEGKQDGDIMHVQNKGFTLNGRILRAAKVGVVK 243


>gi|148359598|ref|YP_001250805.1| heat shock protein GrpE [Legionella pneumophila str. Corby]
 gi|296107640|ref|YP_003619341.1| Molecular chaperone GrpE (heat shock protein) [Legionella
           pneumophila 2300/99 Alcoy]
 gi|166215269|sp|A5IDK9|GRPE_LEGPC RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|148281371|gb|ABQ55459.1| heat shock protein GrpE [Legionella pneumophila str. Corby]
 gi|295649542|gb|ADG25389.1| Molecular chaperone GrpE (heat shock protein) [Legionella
           pneumophila 2300/99 Alcoy]
          Length = 199

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 57/175 (32%), Positives = 101/175 (57%), Gaps = 13/175 (7%)

Query: 12  KEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
           + + P+  + S    + ++ + E+  +++ E   K +R +AE+EN+RRR +RE  +A  Y
Sbjct: 36  QHQEPALGHPSYTALEEQLTLAEQKAHENWE---KSVRALAELENVRRRMEREVANAHKY 92

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
            + K    +L V D+L +AL  A       +K S+    S+ EG+E+T +  +  L+++ 
Sbjct: 93  GVEKLISALLPVVDSLEQALQLA-------DKNSDP---SMHEGLELTMKLFLDALQKFD 142

Query: 132 VKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           V++ID   Q F+P  H+AM  +P    P N++I V Q GY +++RV+RPA V +S
Sbjct: 143 VEQIDPLGQTFDPQQHEAMSMQPAPGAPPNSVITVFQKGYKLSDRVIRPARVIVS 197


>gi|326469661|gb|EGD93670.1| mitochondrial co-chaperone GrpE [Trichophyton tonsurans CBS 112818]
 gi|326478808|gb|EGE02818.1| HSP-70 cofactor [Trichophyton equinum CBS 127.97]
          Length = 245

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 95/155 (61%), Gaps = 11/155 (7%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAP---LDL 98
           + +DKYLR +A+  NL+ RT R+ + A++++I KFA D++   DNL RAL + P   +D 
Sbjct: 91  DLKDKYLRSVADFRNLQERTRRDIEAARTFAIQKFAADLIESIDNLERALAAVPPEKVDA 150

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKK------IDAKDQKFNPNMHQAMFE 152
           AN+++  +  +  L  G++MT   +M+TL+++GV +      +D + QKF+P+ H+A+F 
Sbjct: 151 ANAKENKD--VYELFSGLKMTEGVLMNTLKKHGVVRFDPSEPVDGQPQKFDPSRHEALFM 208

Query: 153 EPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            P +      I+ V   G+ +N R+LR A V + K
Sbjct: 209 SPMEGKQDGDIMHVQNKGFTLNGRILRAAKVGVVK 243


>gi|154686808|ref|YP_001421969.1| hypothetical protein RBAM_023780 [Bacillus amyloliquefaciens FZB42]
 gi|166215247|sp|A7Z6W2|GRPE_BACA2 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|154352659|gb|ABS74738.1| GrpE [Bacillus amyloliquefaciens FZB42]
          Length = 191

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 54/143 (37%), Positives = 88/143 (61%), Gaps = 9/143 (6%)

Query: 45  DKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKK 104
           +K LRV A+ EN +RR+  E + AQ Y       ++L   DN  RAL          E +
Sbjct: 58  NKLLRVQADFENYKRRSRLEMEAAQKYRSQNVVTEILPALDNFERAL--------QVEAE 109

Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTII 164
           SE   KSL++G+EM RR++M  LE+ GV+ I+A  Q+F+PN+HQA+ +   +   +N +I
Sbjct: 110 SEQT-KSLLQGMEMVRRQLMDALEKEGVEAIEAVGQEFDPNLHQAVMQVEDENFGSNIVI 168

Query: 165 KVVQDGYAINERVLRPALVSISK 187
           + +Q GY + +RV+RP++V +++
Sbjct: 169 EELQKGYKLKDRVIRPSMVKVNQ 191


>gi|168046284|ref|XP_001775604.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162673022|gb|EDQ59551.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 139

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/135 (38%), Positives = 86/135 (63%), Gaps = 1/135 (0%)

Query: 54  MENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL-ANSEKKSESVLKSL 112
           MENL  RT RE +  + YSI  FA+ +L V+DNL RAL++    + A+  + +  +L SL
Sbjct: 1   MENLIDRTRREAESTRKYSIQDFAQSLLDVADNLGRALETVRKSVSADDAEINAKLLVSL 60

Query: 113 IEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYA 172
           +EG+EMT +++M   E++G+ + + +   F+PN HQA+FE         T+  V++ GY 
Sbjct: 61  LEGVEMTDKQLMKVFEKHGLTRFNPEGIVFDPNEHQAVFEVEDANKTPGTVAVVLKTGYK 120

Query: 173 INERVLRPALVSISK 187
           +++RV+RPA+V + K
Sbjct: 121 LHDRVIRPAVVGVVK 135


>gi|157828825|ref|YP_001495067.1| grpE protein [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165933551|ref|YP_001650340.1| heat shock protein GrpE [Rickettsia rickettsii str. Iowa]
 gi|157801306|gb|ABV76559.1| grpE protein [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165908638|gb|ABY72934.1| GrpE [Rickettsia rickettsii str. Iowa]
          Length = 199

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 61/167 (36%), Positives = 104/167 (62%), Gaps = 10/167 (5%)

Query: 24  AEEKSEINIPEESLNQSE--EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDML 81
           AEE  E   PE +  ++E  E +DK +R  AE++N R+R ++ + +A+ Y+IA FA+++L
Sbjct: 38  AEEIVETANPEVTALKAEIEELKDKLIRTTAEIDNTRKRLEKARDEAKDYAIATFAKELL 97

Query: 82  SVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQ 140
           +VSDNLSRAL   P   ANS+ +    + ++I G++MT+ E+     ++ +++I  +   
Sbjct: 98  NVSDNLSRALAHKP---ANSDVE----VTNIIAGVQMTKDELDKVFHKHHIEEIKPEIGS 150

Query: 141 KFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            F+ N+H A+ +  H     N+II ++Q GY I +R+LRPA V + K
Sbjct: 151 MFDYNLHNAIAQIEHPDHAPNSIITLMQSGYKIRDRLLRPATVQVVK 197


>gi|119944677|ref|YP_942357.1| co-chaperone GrpE [Psychromonas ingrahamii 37]
 gi|166215282|sp|A1STE3|GRPE_PSYIN RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|119863281|gb|ABM02758.1| co-chaperone GrpE [Psychromonas ingrahamii 37]
          Length = 206

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/140 (37%), Positives = 83/140 (59%), Gaps = 8/140 (5%)

Query: 49  RVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESV 108
           R  A++ N RR   ++ + A  +++ KFA  +L V D+L  A+  A         K +  
Sbjct: 73  RAQADVVNARRIAAQDVQKAHKFALVKFADGLLPVIDSLEMAISHA--------DKEDET 124

Query: 109 LKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQ 168
           LK +IEG+E+T + M+ T++++G+K ID KD+ F+P  HQAM       V  N +I V+Q
Sbjct: 125 LKPMIEGVELTLKSMLDTVDKFGLKVIDPKDEAFDPEKHQAMSMRAVPDVAPNQVIAVMQ 184

Query: 169 DGYAINERVLRPALVSISKG 188
            GY +N RV+RPA+V +SK 
Sbjct: 185 KGYELNGRVIRPAMVMVSKA 204


>gi|50306825|ref|XP_453388.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|52782859|sp|Q6CRQ1|GRPE_KLULA RecName: Full=GrpE protein homolog, mitochondrial; Flags: Precursor
 gi|49642522|emb|CAH00484.1| KLLA0D07326p [Kluyveromyces lactis]
          Length = 243

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 6/150 (4%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSA-PLD 97
           ++ EF+D+ LR +A+  NL+  T ++ + A+ +++ KFA+D+L   DN   AL++  P  
Sbjct: 95  EASEFKDRLLRSVADFRNLQEVTKKDIQKAKDFALQKFAKDLLESVDNFGHALNAFKPET 154

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
           L  S++     L  L  G++MTR     TL+++G+++++   + F+PN H+A FE P   
Sbjct: 155 LEQSQE-----LSDLYTGVKMTRDVFEKTLKKHGIEQLNPIGESFDPNKHEATFELPQPD 209

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISK 187
               T+  V Q GY +N+RV+RPA V I K
Sbjct: 210 KEPGTVFHVQQIGYTLNDRVIRPAKVGIVK 239


>gi|157803501|ref|YP_001492050.1| hypothetical protein A1E_01600 [Rickettsia canadensis str. McKiel]
 gi|226737165|sp|A8EY32|GRPE_RICCK RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|157784764|gb|ABV73265.1| hypothetical protein A1E_01600 [Rickettsia canadensis str. McKiel]
          Length = 179

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 96/154 (62%), Gaps = 8/154 (5%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           Q EE +DK +R  AE++N R+R ++ + +A+ Y+IA FA+++L+VSDNL+RAL   P  L
Sbjct: 31  QIEELKDKLIRTTAEIDNTRKRLEKARDEAKDYAIATFAKELLNVSDNLARALAHTPAKL 90

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDT 157
                  +  + ++IEG++MT+ E+     ++ +++I  +    F+ N+H A+ +  +  
Sbjct: 91  -------DVEVINIIEGVQMTKDELDKIFHKHHIEEIKPEIGSMFDYNLHNAISQIDNTK 143

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISKGKTQ 191
              N++I V+Q GY I +R+LRPA V ++K   Q
Sbjct: 144 YAPNSVITVMQSGYKIKDRLLRPATVQVTKKPKQ 177


>gi|74137770|dbj|BAE24062.1| unnamed protein product [Mus musculus]
          Length = 217

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 61/181 (33%), Positives = 105/181 (58%), Gaps = 13/181 (7%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           + + + +P +A+ +  EEK+++   EE L ++ E   KY R +A+ ENLR+R+ +  ++A
Sbjct: 46  HCEPKTDPPSADKTLLEEKAKL---EEQLRETME---KYKRALADTENLRQRSQKLVQEA 99

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSES--VLKSLIEGIEMTRREMMST 126
           + Y I  F +D+L V+D L +A  S P      E+ S++   LKSL EG+ MT  ++   
Sbjct: 100 KLYGIQGFCKDLLEVADILEKATQSVP-----KEEISDNNPHLKSLYEGLVMTEVQIQKV 154

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
             ++G+ ++D    KF+P  H+A+F  P +     T+  V + GY ++ R LRPALV + 
Sbjct: 155 FTKHGLLRLDPIGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVV 214

Query: 187 K 187
           K
Sbjct: 215 K 215


>gi|34556918|ref|NP_906733.1| heat shock protein GrpE [Wolinella succinogenes DSM 1740]
 gi|52782901|sp|Q7MA34|GRPE_WOLSU RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|34482633|emb|CAE09633.1| GRPE PROTEIN (HSP-70 COFACTOR) [Wolinella succinogenes]
          Length = 184

 Score =  103 bits (256), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 87/147 (59%), Gaps = 7/147 (4%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E  D YLRV A+ EN ++R +REK  A  Y+  K A+D+L + D L  AL S     AN 
Sbjct: 42  ELEDSYLRVHADFENTKKRLEREKFQALEYAYEKIAKDLLPIVDTLEIALKS-----ANE 96

Query: 102 EKKSESVLKS-LIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
               ES L++   EG+E+T       L+R+G++ I A + +F+P++H+ + + P  +   
Sbjct: 97  VSGEESELQAKFKEGLELTLDNFSKVLQRHGIEMI-ACEGEFDPHLHECIMQVPSPSHQE 155

Query: 161 NTIIKVVQDGYAINERVLRPALVSISK 187
             I++V Q GY   ERVLRPA+VSI+K
Sbjct: 156 GEIVQVFQKGYRYKERVLRPAMVSIAK 182


>gi|332975776|gb|EGK12657.1| heat shock protein GrpE [Desmospora sp. 8437]
          Length = 241

 Score =  103 bits (256), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 91/148 (61%), Gaps = 9/148 (6%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           +++E  +  LR  A++EN RRRT +++++   Y+ A     +L V DNL RALD+     
Sbjct: 102 EADENYEGLLRARADLENFRRRTRKDQQELAKYAAAPLVESLLPVIDNLERALDAG---- 157

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
                KSE   ++L +G+EM  R+++ TLE +G+  I+A+ ++FNP+ H A+ +   D V
Sbjct: 158 ----AKSEEA-EALHKGVEMISRQLLQTLEEHGLSPIEAEGKEFNPHEHNAVMQVEADGV 212

Query: 159 PANTIIKVVQDGYAINERVLRPALVSIS 186
            +  +++ +Q GY   ERV+RP++V +S
Sbjct: 213 ESGMVVEELQKGYRFKERVIRPSMVKVS 240


>gi|264677148|ref|YP_003277054.1| GrpE protein [Comamonas testosteroni CNB-2]
 gi|262207660|gb|ACY31758.1| GrpE protein [Comamonas testosteroni CNB-2]
          Length = 181

 Score =  103 bits (256), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 90/156 (57%), Gaps = 13/156 (8%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           EE   +S +  D+YLR  A+ EN+RRR + E   A+ + I  FA  +L V D+L  AL  
Sbjct: 38  EELKAKSADLADQYLRAKADAENMRRRAEEEVAKARKFGIESFAESLLPVIDSLDAAL-- 95

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID-AKDQKFNPNMHQAMFE 152
                        +  + L EG + T R++ S LER  V  I+ A  +KF+P+ HQA+  
Sbjct: 96  ---------AIQNATPEQLREGSDATLRQLNSALERNKVLAINPAAGEKFDPHHHQAISM 146

Query: 153 EPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
            P D  PANT++ V+Q GY I +R+LRPALV++++G
Sbjct: 147 VPADQ-PANTVVAVLQKGYVIADRILRPALVTVAQG 181


>gi|330719998|gb|EGG98443.1| Heat shock protein GrpE [gamma proteobacterium IMCC2047]
          Length = 205

 Score =  103 bits (256), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/141 (36%), Positives = 88/141 (62%), Gaps = 8/141 (5%)

Query: 48  LRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSES 107
           LR  AEM+N+RRR +R+ ++A  +++ K   ++L V DNL RAL +A      +   S +
Sbjct: 63  LRAHAEMQNIRRRAERDVENAHKFALEKMTNELLVVVDNLERALQAA-----GAADDSST 117

Query: 108 VLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVV 167
            L+   EG+EMT    + TL ++ +++ID + + F+P  HQAM    +  V  NT++ V+
Sbjct: 118 ALR---EGVEMTLDGFVKTLAKFNIEQIDPEGEPFDPQQHQAMSMVENPEVEPNTVVAVL 174

Query: 168 QDGYAINERVLRPALVSISKG 188
           Q GY+++ R++RPA+V +SK 
Sbjct: 175 QKGYSLHGRLVRPAMVMVSKA 195


>gi|154281695|ref|XP_001541660.1| predicted protein [Ajellomyces capsulatus NAm1]
 gi|150411839|gb|EDN07227.1| predicted protein [Ajellomyces capsulatus NAm1]
          Length = 252

 Score =  103 bits (256), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/153 (34%), Positives = 89/153 (58%), Gaps = 7/153 (4%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD-LAN 100
           + +DKYLR +A+  NL+ RT RE + A+S++I +FA D+L   DNL RAL + P++ ++ 
Sbjct: 98  DLKDKYLRSVADFRNLQERTRREIETARSFAIQRFATDLLDSIDNLDRALAAVPVEKISG 157

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKK------IDAKDQKFNPNMHQAMFEEP 154
             ++    L  L+ G+ MT R + STL ++G+++      +D K QKF+P +H+A F   
Sbjct: 158 PGEQENKELAELVSGLRMTERVLFSTLNKHGLERFDPSELVDGKPQKFDPKLHEATFMAA 217

Query: 155 HDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            +      ++     G+ +N R LR A V + K
Sbjct: 218 AEGKEDGDVLHTQTKGFILNGRTLRAAKVGVVK 250


>gi|223984427|ref|ZP_03634564.1| hypothetical protein HOLDEFILI_01858 [Holdemania filiformis DSM
           12042]
 gi|223963603|gb|EEF67978.1| hypothetical protein HOLDEFILI_01858 [Holdemania filiformis DSM
           12042]
          Length = 221

 Score =  103 bits (256), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 84/144 (58%), Gaps = 10/144 (6%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            +++YL+  A+ EN RRR  +E +  + Y I  FA D+L V DNL RAL   P     S 
Sbjct: 87  LKNEYLKAYADTENTRRRLQQEAEQTRKYRIQSFALDILPVLDNLERALAIEPTPETESY 146

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
           +K          G+EM  ++++  L + GV +I+A+ ++F+PN HQA+  E  + V  N 
Sbjct: 147 RK----------GVEMIYQQLIHALTKEGVSEIEAQGKEFDPNFHQALMMEAVEGVEPNH 196

Query: 163 IIKVVQDGYAINERVLRPALVSIS 186
           + +V+Q GY + +R+LR A+V +S
Sbjct: 197 VTEVLQKGYMLKDRILRAAMVKVS 220


>gi|312110167|ref|YP_003988483.1| GrpE protein [Geobacillus sp. Y4.1MC1]
 gi|311215268|gb|ADP73872.1| GrpE protein [Geobacillus sp. Y4.1MC1]
          Length = 224

 Score =  103 bits (256), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 51/146 (34%), Positives = 86/146 (58%), Gaps = 9/146 (6%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E  ++YLR+ A+ EN RRRT +E + A+ Y       D+L V DN  RAL          
Sbjct: 88  EMENRYLRLYADFENFRRRTRQEMEAAEKYRAQSLVSDLLPVLDNFERALKI-------- 139

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
            K  +   KS+++G+EM  R ++  L++ GV+ I+A  + F+P++HQA+ +        N
Sbjct: 140 -KAEDEQAKSILQGMEMVYRSVLDALKKEGVEAIEAVGKPFDPHLHQAVMQVEDSNYEPN 198

Query: 162 TIIKVVQDGYAINERVLRPALVSISK 187
           T+++ +Q GY + +RV+RPA+V +S+
Sbjct: 199 TVVEELQKGYKLKDRVIRPAMVKVSQ 224


>gi|120609914|ref|YP_969592.1| heat shock protein GrpE [Acidovorax citrulli AAC00-1]
 gi|166215245|sp|A1TLI0|GRPE_ACIAC RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|120588378|gb|ABM31818.1| GrpE protein [Acidovorax citrulli AAC00-1]
          Length = 189

 Score =  103 bits (256), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 59/152 (38%), Positives = 87/152 (57%), Gaps = 13/152 (8%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           +S +  D++LR  AE EN RRR D E   A+ + I  FA  +L V+D+L+ AL       
Sbjct: 50  KSADLADQFLRAKAEAENARRRADEEVSKARKFGIESFAESLLPVADSLTAAL------- 102

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID-AKDQKFNPNMHQAMFEEPHDT 157
                  ++ ++ L EG + T R++ S LER  V  I     +KF+P+ HQA+   P + 
Sbjct: 103 ----AIKDATIEQLREGTDATLRQLTSALERNKVLAIQPGAGEKFDPHQHQAISMVPAEQ 158

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISKGK 189
            P NTI+ V+Q GY I +RVLRPALV+++  K
Sbjct: 159 EP-NTIVSVLQKGYVIADRVLRPALVTVAAPK 189


>gi|295399231|ref|ZP_06809213.1| GrpE protein [Geobacillus thermoglucosidasius C56-YS93]
 gi|294978697|gb|EFG54293.1| GrpE protein [Geobacillus thermoglucosidasius C56-YS93]
          Length = 224

 Score =  103 bits (256), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 51/146 (34%), Positives = 86/146 (58%), Gaps = 9/146 (6%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E  ++YLR+ A+ EN RRRT +E + A+ Y       D+L V DN  RAL          
Sbjct: 88  EMENRYLRLYADFENFRRRTRQEMEAAEKYRAQSLVSDLLPVLDNFERALKI-------- 139

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
            K  +   KS+++G+EM  R ++  L++ GV+ I+A  + F+P++HQA+ +        N
Sbjct: 140 -KAEDEQAKSILQGMEMVYRSVLDALKKEGVEAIEAVGKPFDPHLHQAVMQVEDSNYEPN 198

Query: 162 TIIKVVQDGYAINERVLRPALVSISK 187
           T+++ +Q GY + +RV+RPA+V +S+
Sbjct: 199 TVVEELQKGYKLKDRVIRPAMVKVSQ 224


>gi|167586230|ref|ZP_02378618.1| GrpE protein [Burkholderia ubonensis Bu]
          Length = 181

 Score =  103 bits (256), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 56/148 (37%), Positives = 86/148 (58%), Gaps = 12/148 (8%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E ++ +LR  AE EN+RRR   +   A  ++I  FA  +L V D+L  A+     DLA  
Sbjct: 46  ELQESFLRAKAETENVRRRAQDDVAKAHKFAIESFAEHLLPVLDSLEAAVGDTSGDLAKV 105

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
                       EG+E+T R++ S LE+  V  I+   +KF+P++HQA+   P +  P N
Sbjct: 106 R-----------EGVELTLRQLTSALEKGRVVAINPVGEKFDPHLHQAISMVPAEQEP-N 153

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGK 189
           T++ V+Q GY I +RVLRPALV++++ K
Sbjct: 154 TVVAVLQKGYTIADRVLRPALVTVAQPK 181


>gi|302509176|ref|XP_003016548.1| hypothetical protein ARB_04837 [Arthroderma benhamiae CBS 112371]
 gi|291180118|gb|EFE35903.1| hypothetical protein ARB_04837 [Arthroderma benhamiae CBS 112371]
          Length = 279

 Score =  103 bits (256), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 95/155 (61%), Gaps = 11/155 (7%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAP---LDL 98
           + +DKYLR +A+  NL+ RT R+ + A++++I KFA D++   DNL RAL + P   +D 
Sbjct: 125 DLKDKYLRSVADFRNLQERTRRDIEAARTFAIQKFAADLIESIDNLERALAAVPPEKVDA 184

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKK------IDAKDQKFNPNMHQAMFE 152
           AN+++  +  +  L  G++MT   +M+TL+++GV +      +D + QKF+P+ H+A+F 
Sbjct: 185 ANAKENKD--VYELFSGLKMTEGVLMNTLKKHGVVRFDPSELVDGQPQKFDPSRHEALFM 242

Query: 153 EPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            P +      I+ V   G+ +N R+LR A V + K
Sbjct: 243 SPVEGKQDGDIMHVQNKGFTLNGRILRAAKVGVVK 277


>gi|238026299|ref|YP_002910530.1| heat shock protein GrpE [Burkholderia glumae BGR1]
 gi|237875493|gb|ACR27826.1| GrpE protein [Burkholderia glumae BGR1]
          Length = 187

 Score =  103 bits (256), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 59/148 (39%), Positives = 87/148 (58%), Gaps = 12/148 (8%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E ++ +LR  AE EN+RRR   +   A  ++I  FA  +L V D+L  A+          
Sbjct: 52  ELQESFLRAKAETENVRRRGQEDVAKAHKFAIESFAEHLLPVIDSLEAAVGD-------- 103

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
             KSE + K + EG+E+T R++ S LE+  V  ID    KF+P+ HQA+   P +  P N
Sbjct: 104 --KSEDIAK-VREGVELTLRQLQSALEKGRVSVIDPAGAKFDPHQHQAISMVPAEQEP-N 159

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGK 189
           T++ V+Q GY I +RVLRPALV++S+ K
Sbjct: 160 TVVTVLQKGYMIADRVLRPALVTVSQPK 187


>gi|255093447|ref|ZP_05322925.1| heat shock protein [Clostridium difficile CIP 107932]
          Length = 137

 Score =  102 bits (255), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 52/146 (35%), Positives = 92/146 (63%), Gaps = 11/146 (7%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           +E  DKY R+ AE  N RRRT +EK+    ++  K   +++ V D++ RALD+       
Sbjct: 2   DELNDKYQRLQAEYANYRRRTQQEKETIGVFANEKIITELIPVIDSMERALDAC------ 55

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
            E K +++ K    GI +  ++++ TL ++GV++I+A+ ++F+PN+H A+ +E  D V A
Sbjct: 56  -EDKEDTMYK----GISLVHKQLIDTLVKFGVEEIEAESKEFDPNLHLAVMQESVDGVEA 110

Query: 161 NTIIKVVQDGYAINERVLRPALVSIS 186
           N I+ V+Q GY +  +V+RP++V +S
Sbjct: 111 NQIVMVLQKGYKLGTKVVRPSMVKVS 136


>gi|240275805|gb|EER39318.1| conserved hypothetical protein [Ajellomyces capsulatus H143]
 gi|325093173|gb|EGC46483.1| mitochondrial co-chaperone GrpE [Ajellomyces capsulatus H88]
          Length = 252

 Score =  102 bits (255), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 53/153 (34%), Positives = 89/153 (58%), Gaps = 7/153 (4%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD-LAN 100
           + +DKYLR +A+  NL+ RT RE + A+S++I +FA D+L   DNL RAL + P++ ++ 
Sbjct: 98  DLKDKYLRSVADFRNLQERTRREIETARSFAIQRFATDLLDSIDNLDRALAAVPVEKISG 157

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKK------IDAKDQKFNPNMHQAMFEEP 154
             ++    L  L+ G+ MT R + STL ++G+++      +D K QKF+P +H+A F   
Sbjct: 158 PGEQENKELAELVSGLRMTERVLFSTLNKHGLERFDPSELVDGKPQKFDPKLHEATFMAA 217

Query: 155 HDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            +      ++     G+ +N R LR A V + K
Sbjct: 218 AEGKEDGDVLHAQTKGFILNGRTLRAAKVGVVK 250


>gi|157165150|ref|YP_001467124.1| co-chaperone GrpE [Campylobacter concisus 13826]
 gi|254799584|sp|A7ZEB6|GRPE_CAMC1 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|112801403|gb|EAT98747.1| co-chaperone GrpE [Campylobacter concisus 13826]
          Length = 180

 Score =  102 bits (255), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 84/145 (57%), Gaps = 9/145 (6%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E  DKY R  AE EN+++R ++EK D  SY+  KFARD+L V D L  A        AN 
Sbjct: 44  EITDKYYRANAEFENIKKRYEKEKADVASYANEKFARDLLPVIDALEIA--------ANF 95

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
           + + +   K + EGI +T  +     E++GV +I A D  F+PN+H A+     +   + 
Sbjct: 96  DPEDDEFAKKIKEGILITINQFKKCFEKHGVSEI-ATDADFDPNVHNAVLRVDSEEKQSG 154

Query: 162 TIIKVVQDGYAINERVLRPALVSIS 186
            I++ +Q GY IN RVLRPA+VS++
Sbjct: 155 QIVQALQKGYMINGRVLRPAMVSVA 179


>gi|89895877|ref|YP_519364.1| hypothetical protein DSY3131 [Desulfitobacterium hafniense Y51]
 gi|89335325|dbj|BAE84920.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 212

 Score =  102 bits (255), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 90/150 (60%), Gaps = 9/150 (6%)

Query: 38  NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD 97
           NQ+EE+     R+ AE +N R+RT +EK+D   Y+  +    +L V DN  RA++++   
Sbjct: 72  NQAEEYYTHLQRLQAEFDNYRKRTQKEKEDFAKYASERVVEGLLPVLDNFERAVEAS--- 128

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
                 K+   +KS  +G+EM  +++   L + G+  I+A  Q F+PN+H+A+ +   + 
Sbjct: 129 ------KTTQDMKSFSQGVEMIFKQLQGILAKEGLAAIEAVGQPFDPNLHEAVLQVDSED 182

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISK 187
            P +T+++ +Q GY + E+V+RP++V +S+
Sbjct: 183 YPESTVVEELQKGYYLKEKVIRPSMVKVSR 212


>gi|332313386|sp|P0CW11|GRPE_METMA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|332313387|sp|P0CW10|GRPE_METMZ RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|531109|emb|CAA52395.1| GrpE protein homologue [Methanosarcina mazei]
          Length = 209

 Score =  102 bits (255), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 108/184 (58%), Gaps = 15/184 (8%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEE-FRDKYLRVIAEMENLRRRTDRE 64
           +EK  + + +P N  SS   EK+    PEE+  +  E  +D+  R+ A+ +N R+RT R+
Sbjct: 32  AEKAGETKVSPENEPSSPEAEKN----PEEACREENEILKDQLFRLAADFDNFRKRTARQ 87

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
            ++ +   + +   D + V+DN  RA+ SA         ++   +  ++ GIE   ++  
Sbjct: 88  MEENRKSVLEQVLLDFVEVTDNFDRAIKSA---------RTAEDMGPIVSGIEQLSKQFF 138

Query: 125 STLERYGVKKIDA-KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
           S LE+YG++++   K  +F+P+ H+A+       VP NTI+++ ++GYA+NE+V+RPALV
Sbjct: 139 SILEKYGLERVKCEKAGEFDPHRHEAIHHIETSEVPDNTIVEIYKEGYALNEKVVRPALV 198

Query: 184 SISK 187
           S+++
Sbjct: 199 SVAR 202


>gi|210623844|ref|ZP_03294093.1| hypothetical protein CLOHIR_02044 [Clostridium hiranonis DSM 13275]
 gi|210153339|gb|EEA84345.1| hypothetical protein CLOHIR_02044 [Clostridium hiranonis DSM 13275]
          Length = 193

 Score =  102 bits (255), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 110/189 (58%), Gaps = 16/189 (8%)

Query: 2   ETFMSEKNIDKEKNPSNAN-SSTAEEKSEIN--IPEESL-NQSEEFRDKYLRVIAEMENL 57
           +T  +EK  ++E N SN      AE  ++IN  + E+ L ++  +  DKY R+ AE  N 
Sbjct: 16  DTKTAEKAQNEEVNVSNEEIEGEAENVTDINAKLEEKKLKDEIADLNDKYQRLQAEYANY 75

Query: 58  RRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIE 117
           RRRT+ EK++   ++  K   +++ V DN+ RALDSA    A            + +G+E
Sbjct: 76  RRRTNEEKENIGIFANEKIMAELIPVIDNMERALDSADKGTA------------VYQGVE 123

Query: 118 MTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERV 177
           +  ++++ TL ++G+K+I A+D+ F+PN HQA+ ++    V    ++ V+Q GY +NE+V
Sbjct: 124 LVLKQLLDTLGKFGLKEIPAEDEPFDPNFHQAVMQDHICGVEPGKVVDVLQKGYKLNEKV 183

Query: 178 LRPALVSIS 186
           +R  +V +S
Sbjct: 184 VRATMVKVS 192


>gi|78777840|ref|YP_394155.1| GrpE protein [Sulfurimonas denitrificans DSM 1251]
 gi|123768597|sp|Q30Q11|GRPE_SULDN RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|78498380|gb|ABB44920.1| GrpE protein [Sulfurimonas denitrificans DSM 1251]
          Length = 185

 Score =  102 bits (255), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 65/187 (34%), Positives = 107/187 (57%), Gaps = 11/187 (5%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEK--SEINIPEESLNQSEEFRDKYLRVIAEMENLRR 59
           E   SE  + KE+ P    ++   E   +E ++ +E LN     +DKY RV A+ EN+++
Sbjct: 7   EELQSEAQVTKEETPQANEAAAEAEAIVNEFDLLQEELNS---LKDKYARVHADFENIKK 63

Query: 60  RTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMT 119
           R +REK  A  Y+  KFA+DM+ V D L  AL S+   + ++E      L+ L EGIE+T
Sbjct: 64  RLEREKYSAVEYANEKFAKDMIPVMDALHMALSSSSSIIDSAEH-----LEKLKEGIELT 118

Query: 120 RREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
            +++ + LE++G+  + + D  F+PN+H A+     DTV +  I++  Q GY   +R LR
Sbjct: 119 LKQLSTALEKHGITMV-SHDAPFDPNIHNAIQSVDSDTVESGQIVQTFQTGYKYKDRPLR 177

Query: 180 PALVSIS 186
            A+V ++
Sbjct: 178 EAMVVVA 184


>gi|323490051|ref|ZP_08095272.1| protein grpE (HSP-70 cofactor) [Planococcus donghaensis MPA1U2]
 gi|323396347|gb|EGA89172.1| protein grpE (HSP-70 cofactor) [Planococcus donghaensis MPA1U2]
          Length = 199

 Score =  102 bits (255), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 54/161 (33%), Positives = 96/161 (59%), Gaps = 9/161 (5%)

Query: 25  EEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVS 84
           EE   ++  EE   Q E  ++KYLR++A+ +N +RRT ++K+ A  +       D+L V 
Sbjct: 46  EEAETVDEVEELRKQLEAEQNKYLRLLADYDNFKRRTQKDKELANKFRSQSLLADLLPVL 105

Query: 85  DNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNP 144
           DN  RA+ +       + K  ES   SL++GIEM ++ ++  + R G+++I +  ++F+P
Sbjct: 106 DNFERAMSA-------TTKSEESA--SLLKGIEMVQKSLLEAVNREGLEEIKSVGEQFDP 156

Query: 145 NMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
           N HQA+ +E  D+     +++ +Q GY + +RVLRPA+V +
Sbjct: 157 NFHQAVMQEKDDSAEPGVVLQELQKGYILKDRVLRPAMVKV 197


>gi|196019823|ref|XP_002119048.1| hypothetical protein TRIADDRAFT_35104 [Trichoplax adhaerens]
 gi|190577169|gb|EDV18466.1| hypothetical protein TRIADDRAFT_35104 [Trichoplax adhaerens]
          Length = 169

 Score =  102 bits (255), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 100/156 (64%), Gaps = 7/156 (4%)

Query: 34  EESLN-QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALD 92
           EE+L  Q +  +D  +R  AE ENLR+R  +E +D   ++I+KF +++    +NL RA D
Sbjct: 18  EENLQEQIDNLKDLLIREKAENENLRKRFKKELEDTHKFAISKFVKNLTEQVENLFRASD 77

Query: 93  SAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFE 152
           +  +DL + E+ SE  LK+L EG+E+T++ ++     + V++I   +Q FN  +H+A+ +
Sbjct: 78  N--IDLKSCEENSE--LKTLFEGVEITKKNLLKVFHDFDVERIYPINQIFNHELHEAISQ 133

Query: 153 -EPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            E  D  P NTII VVQ GY IN R+++PA+V ++K
Sbjct: 134 VEDEDKEP-NTIINVVQAGYTINGRLIKPAVVIVTK 168


>gi|198284379|ref|YP_002220700.1| GrpE protein [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218667472|ref|YP_002427043.1| co-chaperone GrpE [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|226737096|sp|B7J7Y0|GRPE_ACIF2 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737097|sp|B5ENA4|GRPE_ACIF5 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|198248900|gb|ACH84493.1| GrpE protein [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218519685|gb|ACK80271.1| co-chaperone GrpE [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 171

 Score =  102 bits (255), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 63/181 (34%), Positives = 110/181 (60%), Gaps = 19/181 (10%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           N +KE++PS        E   +N  E    ++E +R+ YLR +A++ENLR+R +++ +DA
Sbjct: 2   NEEKEESPSTEAEGAGAEV--VNWEE----RAETYRNDYLRALADIENLRKRHEKQVEDA 55

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
           ++Y++ +FAR++L V D+L  AL S P++ A S       +  L +G+E T       L 
Sbjct: 56  RNYAVDRFARELLPVVDSLELALAS-PVEGAES-------IALLRQGLENTLTLFAKALG 107

Query: 129 RYGVKKIDAKDQKFNPNMHQ--AMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           + G+  I+  + +F+P++HQ  AM E   +   AN ++ V Q GY +++R+LRP++VS+S
Sbjct: 108 KAGIAPIEMGEGRFDPHLHQAIAMVETEGE---ANRVLAVHQKGYVMHDRLLRPSMVSVS 164

Query: 187 K 187
           K
Sbjct: 165 K 165


>gi|327303558|ref|XP_003236471.1| mitochondrial co-chaperone GrpE [Trichophyton rubrum CBS 118892]
 gi|326461813|gb|EGD87266.1| mitochondrial co-chaperone GrpE [Trichophyton rubrum CBS 118892]
          Length = 245

 Score =  102 bits (255), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 94/155 (60%), Gaps = 11/155 (7%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAP---LDL 98
           + +DKYLR +A+  NL+ RT R+   A++++I KFA D++   DNL RAL + P   +D 
Sbjct: 91  DLKDKYLRSVADFRNLQERTRRDIDAARTFAIQKFAADLIESIDNLERALAAVPPEKVDA 150

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKK------IDAKDQKFNPNMHQAMFE 152
           AN+++  +  +  L  G++MT   +M+TL+++GV +      +D + QKF+P+ H+A+F 
Sbjct: 151 ANAKENKD--VYELFSGLKMTEGVLMNTLKKHGVVRFDPSELVDGQPQKFDPSRHEALFM 208

Query: 153 EPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            P +      I+ V   G+ +N R+LR A V + K
Sbjct: 209 SPMEGKQDGDIMHVQNKGFTLNGRILRAAKVGVVK 243


>gi|21228608|ref|NP_634530.1| heat shock protein GrpE [Methanosarcina mazei Go1]
 gi|20907104|gb|AAM32202.1| GrpE protein [Methanosarcina mazei Go1]
          Length = 200

 Score =  102 bits (255), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 108/184 (58%), Gaps = 15/184 (8%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEE-FRDKYLRVIAEMENLRRRTDRE 64
           +EK  + + +P N  SS   EK+    PEE+  +  E  +D+  R+ A+ +N R+RT R+
Sbjct: 23  AEKAGETKVSPENEPSSPEAEKN----PEEACREENEILKDQLFRLAADFDNFRKRTARQ 78

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
            ++ +   + +   D + V+DN  RA+ SA         ++   +  ++ GIE   ++  
Sbjct: 79  MEENRKSVLEQVLLDFVEVTDNFDRAIKSA---------RTAEDMGPIVSGIEQLSKQFF 129

Query: 125 STLERYGVKKIDA-KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
           S LE+YG++++   K  +F+P+ H+A+       VP NTI+++ ++GYA+NE+V+RPALV
Sbjct: 130 SILEKYGLERVKCEKAGEFDPHRHEAIHHIETSEVPDNTIVEIYKEGYALNEKVVRPALV 189

Query: 184 SISK 187
           S+++
Sbjct: 190 SVAR 193


>gi|219670306|ref|YP_002460741.1| GrpE protein [Desulfitobacterium hafniense DCB-2]
 gi|219540566|gb|ACL22305.1| GrpE protein [Desulfitobacterium hafniense DCB-2]
          Length = 213

 Score =  102 bits (255), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 90/150 (60%), Gaps = 9/150 (6%)

Query: 38  NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD 97
           NQ+EE+     R+ AE +N R+RT +EK+D   Y+  +    +L V DN  RA++++   
Sbjct: 73  NQAEEYYTHLQRLQAEFDNYRKRTQKEKEDFAKYASERVVEGLLPVLDNFERAVEAS--- 129

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
                 K+   +KS  +G+EM  +++   L + G+  I+A  Q F+PN+H+A+ +   + 
Sbjct: 130 ------KTTQDMKSFSQGVEMIFKQLQGILAKEGLAAIEAVGQPFDPNLHEAVLQVDSED 183

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISK 187
            P +T+++ +Q GY + E+V+RP++V +S+
Sbjct: 184 YPESTVVEELQKGYYLKEKVIRPSMVKVSR 213


>gi|229824137|ref|ZP_04450206.1| hypothetical protein GCWU000282_01441 [Catonella morbi ATCC 51271]
 gi|229786491|gb|EEP22605.1| hypothetical protein GCWU000282_01441 [Catonella morbi ATCC 51271]
          Length = 198

 Score =  102 bits (255), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 88/148 (59%), Gaps = 10/148 (6%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           E   D+ LR+ AE++N+RR   RE++DA  Y     A  +L V+DNL RAL + P   A 
Sbjct: 60  EALSDQLLRLQAEIQNMRRINQRERQDAAKYRSQSLASHLLDVADNLERAL-ATP---AE 115

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEP-HDTVP 159
           SE       K++ +GIEM  ++     E+ G+  ID  +Q F+PN HQA+   P  +   
Sbjct: 116 SEDA-----KAIHKGIEMVYKQFQQAFEKEGISVIDPLNQAFDPNFHQAVSMMPAGEGQE 170

Query: 160 ANTIIKVVQDGYAINERVLRPALVSISK 187
           A+T+I V+Q GY + +RVLRPA+V +++
Sbjct: 171 ADTVINVLQKGYMLQDRVLRPAMVIVAQ 198


>gi|148926923|ref|ZP_01810600.1| heat shock protein grpE [Campylobacter jejuni subsp. jejuni CG8486]
 gi|205356727|ref|ZP_03223487.1| heat shock protein GrpE [Campylobacter jejuni subsp. jejuni CG8421]
 gi|145845007|gb|EDK22104.1| heat shock protein grpE [Campylobacter jejuni subsp. jejuni CG8486]
 gi|205345366|gb|EDZ32009.1| heat shock protein GrpE [Campylobacter jejuni subsp. jejuni CG8421]
          Length = 175

 Score =  102 bits (255), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 63/163 (38%), Positives = 99/163 (60%), Gaps = 15/163 (9%)

Query: 26  EKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSD 85
           EK+E N  ++ L   EE +DKY+R  AE EN+++R ++EK  A +Y+   FA+D+L V D
Sbjct: 27  EKNETNELQKEL---EELKDKYMRANAEFENIKKRIEKEKLSAMAYANESFAKDLLDVLD 83

Query: 86  NLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQK-FNP 144
            L  A+        N E + E  LK + EG++ T    +  LE++GV  I  KD+K F+P
Sbjct: 84  ALEAAV--------NVECQDEISLK-IKEGVQNTLDLFLKKLEKHGVALI--KDEKEFDP 132

Query: 145 NMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           N+H+AMF    +   +  +++V+Q GY I +RV+RP  VS++K
Sbjct: 133 NLHEAMFHVDSENHQSGEVVQVLQKGYKIADRVIRPTKVSVAK 175


>gi|221107437|ref|XP_002161945.1| PREDICTED: similar to predicted protein, partial [Hydra
           magnipapillata]
          Length = 205

 Score =  102 bits (254), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 87/133 (65%), Gaps = 4/133 (3%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           EF+DKY+R +AE EN+RRR  +   DA+ +++  F++D+L V+D L +A+ S P+D    
Sbjct: 77  EFKDKYIRSLAECENVRRRGVKMVSDAKLFAVQGFSKDLLEVADILEKAMLSVPID---- 132

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
           E +   +LK+L +G+ MT   +     ++G++K++  ++KF+PN H+A+F++      + 
Sbjct: 133 ELQKNELLKNLYDGLVMTEAHLQKVFLKHGLQKVNPINEKFDPNFHEALFQKSIPGKASG 192

Query: 162 TIIKVVQDGYAIN 174
           T+++V + GY +N
Sbjct: 193 TVVEVNKPGYLLN 205


>gi|57237603|ref|YP_178851.1| co-chaperone protein GrpE [Campylobacter jejuni RM1221]
 gi|86152129|ref|ZP_01070341.1| co-chaperone protein GrpE [Campylobacter jejuni subsp. jejuni
           260.94]
 gi|315124279|ref|YP_004066283.1| co-chaperone protein GrpE [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
 gi|81675601|sp|Q5HV34|GRPE_CAMJR RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|57166407|gb|AAW35186.1| co-chaperone protein GrpE [Campylobacter jejuni RM1221]
 gi|85840914|gb|EAQ58164.1| co-chaperone protein GrpE [Campylobacter jejuni subsp. jejuni
           260.94]
 gi|315018001|gb|ADT66094.1| co-chaperone protein GrpE [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
 gi|315058212|gb|ADT72541.1| Heat shock protein GrpE [Campylobacter jejuni subsp. jejuni S3]
          Length = 175

 Score =  102 bits (254), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 63/163 (38%), Positives = 99/163 (60%), Gaps = 15/163 (9%)

Query: 26  EKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSD 85
           EK+E N  ++ L   EE +DKY+R  AE EN+++R ++EK  A +Y+   FA+D+L V D
Sbjct: 27  EKNETNELQKEL---EELKDKYMRANAEFENIKKRMEKEKLSAMAYANESFAKDLLDVLD 83

Query: 86  NLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQK-FNP 144
            L  A+        N E + E  LK + EG++ T    +  LE++GV  I  KD+K F+P
Sbjct: 84  ALEAAV--------NVECQDEISLK-IKEGVQNTLDLFLKKLEKHGVALI--KDEKEFDP 132

Query: 145 NMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           N+H+AMF    +   +  +++V+Q GY I +RV+RP  VS++K
Sbjct: 133 NLHEAMFHVDSENHQSGEVVQVLQKGYKIADRVIRPTKVSVAK 175


>gi|326387913|ref|ZP_08209519.1| GrpE protein [Novosphingobium nitrogenifigens DSM 19370]
 gi|326207959|gb|EGD58770.1| GrpE protein [Novosphingobium nitrogenifigens DSM 19370]
          Length = 190

 Score =  102 bits (254), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 92/144 (63%), Gaps = 5/144 (3%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           R   L   AE +N+RRR +++  DA++Y+   FARD+LSV+DNL+RAL+S P +L   +K
Sbjct: 49  RQDILYAKAETQNVRRRLEKDIADARAYAATAFARDILSVADNLARALESIPAELRGDDK 108

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
                 K+L+ G+E T RE+      +G+ +I AK    +P+ HQAM E P + V   T+
Sbjct: 109 -----FKALVSGLEATGRELDKVFSSHGISRIAAKGLPLDPHQHQAMMEFPTNDVEPGTV 163

Query: 164 IKVVQDGYAINERVLRPALVSISK 187
           ++ +Q GY I +R+LR A+V+++K
Sbjct: 164 VQELQAGYMIKDRLLRAAMVAVAK 187


>gi|154174607|ref|YP_001408034.1| co-chaperone GrpE [Campylobacter curvus 525.92]
 gi|166215257|sp|A7GXU2|GRPE_CAMC5 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|112802906|gb|EAU00250.1| co-chaperone GrpE [Campylobacter curvus 525.92]
          Length = 179

 Score =  102 bits (254), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 63/186 (33%), Positives = 102/186 (54%), Gaps = 16/186 (8%)

Query: 5   MSEKNIDKEKN----PSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           + E+N+   +N    P + N     + +++   E  LN   E  DKY R  AE EN+++R
Sbjct: 5   IKEQNVQDAQNENLAPDSVNFDGLSDAAKVAELENKLN---ELTDKYYRANAEFENIKKR 61

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
            ++EK D  SY+  KFARD+L V D L  A        AN +   +   K++ EG+ +T 
Sbjct: 62  FEKEKTDIASYANEKFARDLLPVIDALEIA--------ANFDPDDDEFAKNVKEGVLITI 113

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
            +     E++G+ +ID   + F+PN+H A+     +   +  I++V+Q GY IN RVLRP
Sbjct: 114 NQFKKCFEKHGMSEIDTSGE-FDPNVHNAVLRVDSEDHTSGQIVQVMQKGYIINGRVLRP 172

Query: 181 ALVSIS 186
           A+VS++
Sbjct: 173 AMVSVA 178


>gi|297584657|ref|YP_003700437.1| GrpE protein [Bacillus selenitireducens MLS10]
 gi|297143114|gb|ADH99871.1| GrpE protein [Bacillus selenitireducens MLS10]
          Length = 196

 Score =  102 bits (254), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 52/146 (35%), Positives = 89/146 (60%), Gaps = 9/146 (6%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           EE ++K LRV A+ +N RRRT  E++ A  Y   + A ++L   DN  RA+  +P     
Sbjct: 59  EEMKNKMLRVQADFDNFRRRTKIEQETAAKYRSQRLAEELLPAMDNFERAMQVSP----- 113

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
              +S+   KSL++G+EM   ++   LE+ G+  I+A  Q F+PN+HQA+ +   D   +
Sbjct: 114 ---ESDDA-KSLLKGVEMVYNQIGQALEKEGITPIEAVGQPFDPNLHQAIMQVEDDQFDS 169

Query: 161 NTIIKVVQDGYAINERVLRPALVSIS 186
           NT+++ +Q GY + +RV+RP++V ++
Sbjct: 170 NTVVEEMQRGYQLKDRVIRPSMVKVN 195


>gi|317402180|gb|EFV82771.1| GrpE chaperone [Achromobacter xylosoxidans C54]
          Length = 185

 Score =  102 bits (254), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 56/166 (33%), Positives = 100/166 (60%), Gaps = 16/166 (9%)

Query: 25  EEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVS 84
           E +++++  + ++N+ +   D+ LRV AE EN+RRR   E   A+ + I  FA  ++ V 
Sbjct: 34  ELRAQLDAAQATVNEQQ---DQLLRVRAEAENVRRRAQEEVSKARKFGIESFAESLVPVK 90

Query: 85  DNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID-AKDQKFN 143
           D+L  AL            +++  + +L EG+E+T +++ +  ER  +K+I   +  KF+
Sbjct: 91  DSLEAAL-----------AQADQTVDTLREGVEVTLKQLAAAFERNLLKEIAPVQGDKFD 139

Query: 144 PNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
           P++HQA+   P +  PANT+++++Q GY I +R LRPALV +S G+
Sbjct: 140 PHLHQAISSIPAEQ-PANTVVQLLQKGYVIADRTLRPALVVVSAGQ 184


>gi|33519991|ref|NP_878823.1| heat shock protein GrpE [Candidatus Blochmannia floridanus]
 gi|52782917|sp|Q7VRQ6|GRPE_BLOFL RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|33504337|emb|CAD83230.1| heat shock protein GrpE [Candidatus Blochmannia floridanus]
          Length = 195

 Score =  102 bits (254), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 51/147 (34%), Positives = 91/147 (61%), Gaps = 8/147 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           R+  LR+ AE+EN++RR  +E + A  +++ +F  ++L V DNL R L    +D      
Sbjct: 57  RNTILRLKAEIENIQRRNIQEIEKAHKFALDRFVSELLPVIDNLERTL--GIID------ 108

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           +S + L ++IEGI++T +  + T+ ++GVK I      FNP +HQA+     +   +N +
Sbjct: 109 RSNTTLSAIIEGIDLTLKSFLDTVYKFGVKSIHEIHIPFNPEIHQAISTMESEKYESNQV 168

Query: 164 IKVVQDGYAINERVLRPALVSISKGKT 190
           + +VQ GY++N R++RPA+V ++K K+
Sbjct: 169 LTIVQKGYSLNGRLVRPAMVIVAKSKS 195


>gi|145589950|ref|YP_001156547.1| GrpE protein [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
 gi|189041744|sp|A4SZR9|GRPE_POLSQ RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|145048356|gb|ABP34983.1| GrpE protein [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 184

 Score =  102 bits (253), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 101/175 (57%), Gaps = 17/175 (9%)

Query: 20  NSSTAEEKSEINIPEE---SLNQS-EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAK 75
           N + A E + +  PE+    LNQ   E +D +LR  AE EN+RRR   +   A  ++I  
Sbjct: 22  NEAAASEPAAVKTPEQEIADLNQQIGELQDNFLRAKAEGENIRRRAVEDIAKAHKFAIES 81

Query: 76  FARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI 135
           FA  ++ V+D+L  AL +   D  ++        K+  EG+E+T ++++S  E+  + +I
Sbjct: 82  FAEHLVPVTDSLYAALST---DAGDA--------KAFKEGLEITLKQLLSAFEKGRMTEI 130

Query: 136 D-AKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
           + A   KF+P+ HQA+   P +  P NT++ V+Q GY + +RVLRPALV++S  K
Sbjct: 131 NPAVGDKFDPHHHQAIASVPSEQDP-NTVVSVLQRGYTVADRVLRPALVTVSAPK 184


>gi|126332076|ref|XP_001372319.1| PREDICTED: similar to GrpE protein homolog 1, mitochondrial
           precursor (Mt-GrpE#1) (HMGE) [Monodelphis domestica]
          Length = 217

 Score =  102 bits (253), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 60/169 (35%), Positives = 97/169 (57%), Gaps = 9/169 (5%)

Query: 22  STAEEKSEINIPEESLNQSEEFRD---KYLRVIAEMENLRRRTDREKKDAQSYSIAKFAR 78
           STA EK+ I   EE +   E+ ++   KY R +A+ ENLR+R+ +  ++A+ Y I  F +
Sbjct: 53  STATEKTLI---EEKVKLEEQLKETLEKYKRALADTENLRQRSQKLVEEAKLYGIQGFCK 109

Query: 79  DMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
           D+L V+D L +A +S P D    E      LK+L EG+ MT  ++    +++G+ K++  
Sbjct: 110 DLLEVADILEKATESVPKDEIKEENPH---LKNLYEGLVMTEVQIQKVFKKHGLLKLNPL 166

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
             KF+P  H+A+F  P +     T+  V + GY ++ R LRPALV + K
Sbjct: 167 GDKFDPYEHEALFHTPIEGKEPGTVALVNKVGYKLHGRTLRPALVGVVK 215


>gi|256830644|ref|YP_003159372.1| GrpE protein [Desulfomicrobium baculatum DSM 4028]
 gi|256579820|gb|ACU90956.1| GrpE protein [Desulfomicrobium baculatum DSM 4028]
          Length = 181

 Score =  102 bits (253), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 58/178 (32%), Positives = 100/178 (56%), Gaps = 13/178 (7%)

Query: 14  KNPSNANSST-AEEKSEINIPE---ESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
           +NP    +   AEE  E+ + E   ++L   EE +   LRV+A+ EN ++R  REK+D  
Sbjct: 9   QNPDEVQTEMQAEEAKELTLEEKYVQALADMEELKKDNLRVLADSENFKKRLLREKEDYF 68

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
            ++ +    +++ V DNL         DLA +  K     K L+ G+EMT    + T+++
Sbjct: 69  KFATSAILEEIIPVMDNL---------DLALAHGKQTEACKDLVTGVEMTMNIFLDTMKK 119

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +G+++I A D  F+P  H+A+ +   D V  NT+ +++Q GY + +R+LRPA V +S+
Sbjct: 120 HGLEQIGAVDVPFDPARHEALGQVERDDVDENTVCQMLQKGYMLKDRLLRPAKVMVSR 177


>gi|57242088|ref|ZP_00370028.1| co-chaperone GrpE [Campylobacter upsaliensis RM3195]
 gi|57017280|gb|EAL54061.1| co-chaperone GrpE [Campylobacter upsaliensis RM3195]
          Length = 165

 Score =  102 bits (253), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 56/145 (38%), Positives = 91/145 (62%), Gaps = 10/145 (6%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            +D+YLR  AE EN+++R ++EK +A +Y+   FA+D+L V D    AL++A    AN E
Sbjct: 31  LKDQYLRANAEFENIKKRLEKEKINAMAYANEGFAKDLLEVLD----ALEAAVKVEANDE 86

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
                V   + EG++ T    +  LE++GVK+I+A  + F+PN+H+AMF    D   +  
Sbjct: 87  -----VSLKIKEGVQNTLDLFLKKLEKHGVKEIEAACE-FDPNLHEAMFHIESDEHQSGA 140

Query: 163 IIKVVQDGYAINERVLRPALVSISK 187
           +++V+Q GY + ERV+RP  VS++K
Sbjct: 141 VVQVLQKGYKLGERVIRPTKVSVAK 165


>gi|326316061|ref|YP_004233733.1| protein grpE [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323372897|gb|ADX45166.1| Protein grpE [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 189

 Score =  102 bits (253), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 59/152 (38%), Positives = 87/152 (57%), Gaps = 13/152 (8%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           +S +  D++LR  AE EN RRR D E   A+ + I  FA  +L V+D+L+ AL       
Sbjct: 50  KSADLADQFLRAKAEAENARRRADEEVSKARKFGIESFAESLLPVADSLTAAL------- 102

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID-AKDQKFNPNMHQAMFEEPHDT 157
                  ++ ++ L EG + T R++ S LER  V  I     +KF+P+ HQA+   P + 
Sbjct: 103 ----AIKDATIEQLREGTDATLRQLTSALERNKVLAIQPGAGEKFDPHQHQAISMVPAEQ 158

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISKGK 189
            P NTI+ V+Q GY I +RVLRPALV+++  K
Sbjct: 159 EP-NTIVSVLQKGYVIADRVLRPALVTVAAPK 189


>gi|192361899|ref|YP_001983802.1| heat shock protein GrpE [Cellvibrio japonicus Ueda107]
 gi|190688064|gb|ACE85742.1| co-chaperone GrpE [Cellvibrio japonicus Ueda107]
          Length = 191

 Score =  102 bits (253), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 86/145 (59%), Gaps = 8/145 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D+ LR  AE +N+RRR +++ + A  + + +   D+L V DNL RAL S  +D AN E 
Sbjct: 54  KDQSLRTQAEAQNIRRRAEQDVEKAHKFGLERIVSDLLPVVDNLERALAS--ID-ANDEA 110

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
                LK+  EGI++T +  +  L R+ V  +D     F+PN+HQA+   P+  V  NT+
Sbjct: 111 -----LKAAAEGIQLTHKTFVDALARHQVLVVDPVGAPFDPNLHQAVSAVPNPDVEPNTV 165

Query: 164 IKVVQDGYAINERVLRPALVSISKG 188
           +   Q GY ++ R++RPA+V +SK 
Sbjct: 166 LNCFQRGYTLHGRLVRPAMVVVSKA 190


>gi|291618458|ref|YP_003521200.1| GrpE [Pantoea ananatis LMG 20103]
 gi|291153488|gb|ADD78072.1| GrpE [Pantoea ananatis LMG 20103]
          Length = 202

 Score =  102 bits (253), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 85/137 (62%), Gaps = 8/137 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LR  AE+EN+RRRT+ + + A  +++ KFA ++L V D+L RAL+     LAN E 
Sbjct: 64  RDAQLRAQAEIENVRRRTEMDIEKAHKFALEKFANELLPVIDSLERALE-----LANKED 118

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           +  +   S++EGIE+T + ++  + ++GV+ +      FNP +HQAM     + V  N +
Sbjct: 119 EKSA---SMVEGIELTLKSLLGAVRKFGVEVVGETGVPFNPEVHQAMSMMESEDVEPNHV 175

Query: 164 IKVVQDGYAINERVLRP 180
           + V+Q GY +N R+LRP
Sbjct: 176 MMVMQRGYTLNGRLLRP 192


>gi|325115374|emb|CBZ50929.1| grpe protein homolog, related [Neospora caninum Liverpool]
          Length = 361

 Score =  102 bits (253), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 90/165 (54%), Gaps = 22/165 (13%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS-------- 93
           E +DK LR  A+MEN R R  +E    + Y+++ FA+ ML V+D ++ A +S        
Sbjct: 194 ELQDKALRAFADMENARMRHQKEMASLKEYAVSDFAKAMLDVADAMAYATNSLHEAVQSD 253

Query: 94  ----------APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFN 143
                       +DL   +++    L+ + +G+++T   +  T +R+GV++ D   +KFN
Sbjct: 254 SSLLAGQEANGAVDLVALKER----LQQIYDGVKLTENLLHKTFDRFGVEQFDPAGEKFN 309

Query: 144 PNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           P +H+A+FE  H       + +V+Q GY I +RVLR A V ++KG
Sbjct: 310 PALHEALFELEHPNKAKGEVAQVIQKGYKIKDRVLRAAKVGVAKG 354


>gi|160872418|ref|ZP_02062550.1| co-chaperone GrpE [Rickettsiella grylli]
 gi|159121217|gb|EDP46555.1| co-chaperone GrpE [Rickettsiella grylli]
          Length = 218

 Score =  102 bits (253), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 53/152 (34%), Positives = 92/152 (60%), Gaps = 10/152 (6%)

Query: 38  NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD 97
           NQ     ++ +  +AEM+N++RR  R+ ++A  +S+ KF  ++L + D+L  AL  A   
Sbjct: 73  NQLTHLEEQKIYQLAEMDNIQRRAKRDIENAHKFSLEKFINELLPIKDSLETALFHA--- 129

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
                K+ ++ L     GI++T +++   LE+ GVK I+   Q F+ + H+AM  E +D 
Sbjct: 130 ---KTKEQDAAL----SGIQLTLKQLEHLLEKNGVKSIEPAGQPFDAHFHEAMLAEENDE 182

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISKGK 189
           +  NTII+V+Q GY ++ R++RPALV ++K K
Sbjct: 183 MTPNTIIRVLQKGYLLHGRLIRPALVVVAKSK 214


>gi|319943276|ref|ZP_08017559.1| chaperone GrpE [Lautropia mirabilis ATCC 51599]
 gi|319743818|gb|EFV96222.1| chaperone GrpE [Lautropia mirabilis ATCC 51599]
          Length = 374

 Score =  102 bits (253), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 58/154 (37%), Positives = 90/154 (58%), Gaps = 11/154 (7%)

Query: 35  ESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSA 94
           E+  ++ E  + ++R  AE EN+RRR+  E   A+ ++I  FA  +L V D+L  AL   
Sbjct: 232 EAEQKAGENHEHFVRASAETENVRRRSKEELDKARKFAIEGFAESLLPVCDSLEMAL--- 288

Query: 95  PLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEP 154
                  E  S   + S+ EG++ T R++   LER  V+ +D   Q+F+PN  QA+  +P
Sbjct: 289 -----TVETPS---VDSIREGVQATLRQLQQALERNKVQVVDPLGQRFDPNTQQAISMQP 340

Query: 155 HDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           +  V AN +  V+Q GY IN+RVLRPA+V +S+G
Sbjct: 341 NPEVAANHVAAVLQKGYLINDRVLRPAMVVVSQG 374


>gi|254253169|ref|ZP_04946487.1| Molecular chaperone GrpE [Burkholderia dolosa AUO158]
 gi|124895778|gb|EAY69658.1| Molecular chaperone GrpE [Burkholderia dolosa AUO158]
          Length = 181

 Score =  102 bits (253), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 56/148 (37%), Positives = 85/148 (57%), Gaps = 12/148 (8%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E ++ YLR  AE EN+RRR   +   A  ++I  FA  +L V D+L  A+     D+A  
Sbjct: 46  ELQESYLRAKAETENVRRRAQEDVAKAHKFAIESFAEHLLPVLDSLEAAVGDTSGDIAKV 105

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
                       EG+E+T R++ S LE+  V  I+   +KF+P+ HQA+   P +  P N
Sbjct: 106 R-----------EGVELTLRQLTSALEKGRVVAINPVGEKFDPHQHQAISMVPAEQEP-N 153

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGK 189
           T++ V+Q GY I +RVLRPALV++++ K
Sbjct: 154 TVVTVLQKGYMIADRVLRPALVTVAQPK 181


>gi|325478595|gb|EGC81707.1| co-chaperone GrpE [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 180

 Score =  102 bits (253), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 85/146 (58%), Gaps = 12/146 (8%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E+++ Y R++A+  N ++R +  K D + ++ +     +L V DNL RAL  A  + A  
Sbjct: 47  EYQESYQRLLADFTNYKKREEANKADFKKFAQSALIEKLLPVIDNLDRALAKADENDA-- 104

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
                      +EG+ MTR+E+M  LE  G+++I++   +F+ N HQA+  E  D+V  N
Sbjct: 105 ----------FVEGVIMTRKELMKVLENEGLEEIESDGCEFDHNFHQAVLTEESDSVEEN 154

Query: 162 TIIKVVQDGYAINERVLRPALVSISK 187
            II+  Q GY +N RVLRPA+V +SK
Sbjct: 155 HIIETFQKGYKLNGRVLRPAMVKVSK 180


>gi|54297953|ref|YP_124322.1| heat shock protein GrpE [Legionella pneumophila str. Paris]
 gi|81679429|sp|Q5X3M6|GRPE_LEGPA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|53751738|emb|CAH13160.1| Heat-shock protein GrpE(HSP-70 cofactor) [Legionella pneumophila
           str. Paris]
          Length = 199

 Score =  102 bits (253), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 101/175 (57%), Gaps = 13/175 (7%)

Query: 12  KEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
           + + P+  + S    + ++ + E+  +++ E   K +R +AE++N+RRR +RE  +A  Y
Sbjct: 36  QHQEPALGHPSYTALEEQLTLAEQKAHENWE---KSVRALAELDNVRRRMEREVANAHKY 92

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
            + K    +L V D+L +AL  A       +K S+    S+ EG+E+T +  +  L+++ 
Sbjct: 93  GVEKLISALLPVVDSLEQALQLA-------DKNSDP---SMHEGLELTMKLFLDALQKFD 142

Query: 132 VKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           V++ID   Q F+P  H+AM  +P    P N++I V Q GY +++RV+RPA V +S
Sbjct: 143 VEQIDPLGQTFDPQQHEAMSMQPAPGAPPNSVITVFQKGYKLSDRVIRPARVIVS 197


>gi|300718000|ref|YP_003742803.1| heat shock protein [Erwinia billingiae Eb661]
 gi|299063836|emb|CAX60956.1| heat shock protein [Erwinia billingiae Eb661]
          Length = 193

 Score =  102 bits (253), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 58/149 (38%), Positives = 90/149 (60%), Gaps = 11/149 (7%)

Query: 34  EESLNQSEE-FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALD 92
           E  L QS+   R+  +R  AE+EN+RRRT+ + + A  +++ KFA ++L V D+L RAL+
Sbjct: 44  EVQLAQSQGGVREAQIRAQAEIENIRRRTELDVEKAHKFALEKFANELLPVIDSLERALE 103

Query: 93  SAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-F 151
            A         KS   L S++EGIE+T + ++  + ++GV+ I   +  FNP +HQAM  
Sbjct: 104 VA--------DKSNPELNSMVEGIELTLKSLLGAVRKFGVEVIGDINVPFNPELHQAMSM 155

Query: 152 EEPHDTVPANTIIKVVQDGYAINERVLRP 180
            E  D  P N ++ V+Q GY +N R+LRP
Sbjct: 156 MESEDVAP-NHVLMVMQRGYTLNGRLLRP 183


>gi|254517094|ref|ZP_05129152.1| co-chaperone GrpE [gamma proteobacterium NOR5-3]
 gi|219674599|gb|EED30967.1| co-chaperone GrpE [gamma proteobacterium NOR5-3]
          Length = 207

 Score =  102 bits (253), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 54/152 (35%), Positives = 94/152 (61%), Gaps = 12/152 (7%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           E+ RD+ LR  A+ +N +RR +++ + A+ +++ +F  ++L V DNL RAL++   D   
Sbjct: 64  EKARDQALRSQADAQNAQRRAEQDVEKARKFALERFCSELLPVVDNLERALEAIDGD--- 120

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQA--MFEEPHDTV 158
                +  LKS+ EG+E+T +  +  L ++ ++++D   + F+P  HQA  M E P D  
Sbjct: 121 -----DPALKSITEGVELTLKSFVDALRKFQIEQLDPVGEPFDPQHHQAMSMIENP-DAE 174

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           P NT++ V+Q GY +N R++RPA+V +SK  T
Sbjct: 175 P-NTVLAVMQKGYTLNGRLVRPAMVMVSKAPT 205


>gi|323339434|ref|ZP_08079716.1| heat shock protein GrpE [Lactobacillus ruminis ATCC 25644]
 gi|323093145|gb|EFZ35735.1| heat shock protein GrpE [Lactobacillus ruminis ATCC 25644]
          Length = 192

 Score =  102 bits (253), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 70/190 (36%), Positives = 105/190 (55%), Gaps = 17/190 (8%)

Query: 2   ETFMSEKNIDKE---KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLR 58
           E   +EK +D++   K P    SS   EK   ++      + +E  DKYLR  AEM+N+ 
Sbjct: 16  ENVTAEKTVDQDTAKKEPEEKQSSEETEKKLSDLQ----KKYDELEDKYLRAEAEMQNMT 71

Query: 59  RRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEM 118
           +R  +E++    Y      R++L V DNL+RAL    +D+   E  SE     L  GIEM
Sbjct: 72  KRFKKEQQQLLKYEGQDLIREILPVIDNLNRALQ---IDV--KENGSE----QLKRGIEM 122

Query: 119 TRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEP-HDTVPANTIIKVVQDGYAINERV 177
            +R+M   L+   V KI+A  Q F+P +HQA+   P  +   A TI++V QDGY + +RV
Sbjct: 123 VQRDMEKALKDNDVTKIEALGQTFDPTLHQAVKAVPVEEGQKAETIVEVYQDGYMLKDRV 182

Query: 178 LRPALVSISK 187
           LRPA+V +++
Sbjct: 183 LRPAMVVVAQ 192


>gi|224050149|ref|XP_002197019.1| PREDICTED: putative GrpE-like 1 mitochondrial precusor variant 2
           [Taeniopygia guttata]
 gi|197127344|gb|ACH43842.1| putative GrpE-like 1 mitochondrial precusor variant 2 [Taeniopygia
           guttata]
          Length = 222

 Score =  102 bits (253), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 60/173 (34%), Positives = 99/173 (57%), Gaps = 11/173 (6%)

Query: 16  PSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAK 75
           PS+A    AEEK+++        Q +E  +KY R +A+ EN+R+R+ +  ++A+ Y I  
Sbjct: 58  PSSAEKLLAEEKAKLE------EQLKEVTEKYKRALADAENVRQRSQKLVEEAKLYGIQS 111

Query: 76  FARDMLSVSDNLSRALDSAPLDLANSEKKSESV-LKSLIEGIEMTRREMMSTLERYGVKK 134
           F +D+L V+D L +A +S P      E K E+  LKSL EG+ MT  ++    +++G+ +
Sbjct: 112 FCKDLLEVADILEKATESVP----KEEIKDENPHLKSLYEGLVMTEMQIQKVFKKHGLLR 167

Query: 135 IDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           ++    KF+P  H+A+F    +     TI  V + GY ++ R LRPALV + K
Sbjct: 168 LNPVGAKFDPYEHEALFHTAVEGQEPGTIALVSKIGYKLHGRTLRPALVGVVK 220


>gi|312795190|ref|YP_004028112.1| GrpE protein [Burkholderia rhizoxinica HKI 454]
 gi|312166965|emb|CBW73968.1| GrpE protein [Burkholderia rhizoxinica HKI 454]
          Length = 213

 Score =  101 bits (252), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 86/148 (58%), Gaps = 12/148 (8%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E ++ +LR  AE EN+RRR   +   A  ++I  FA  +L V D+L  AL     DLA  
Sbjct: 78  ELQESFLRACAETENVRRRAQDDVAKAHKFAIESFAEHLLPVVDSLEAALADNAGDLAK- 136

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
                     + EG+E+T R++ S LE+  V +I+   +KF+P+ HQA+   P +   AN
Sbjct: 137 ----------VREGVELTLRQLSSALEKGRVVQINPIGEKFDPHRHQAISMVPAEQ-EAN 185

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGK 189
           T++ V+Q GY I +RVLRPALV+++  K
Sbjct: 186 TVVSVLQKGYVIADRVLRPALVTVAAPK 213


>gi|315638197|ref|ZP_07893379.1| co-chaperone GrpE [Campylobacter upsaliensis JV21]
 gi|315481733|gb|EFU72355.1| co-chaperone GrpE [Campylobacter upsaliensis JV21]
          Length = 165

 Score =  101 bits (252), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 56/145 (38%), Positives = 91/145 (62%), Gaps = 10/145 (6%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            +D+YLR  AE EN+++R ++EK +A +Y+   FA+D+L V D    AL++A    AN E
Sbjct: 31  LKDQYLRANAEFENIKKRLEKEKINAMAYANEGFAKDLLDVLD----ALEAAVKVEANDE 86

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
                V   + EG++ T    +  LE++GVK+I+A  + F+PN+H+AMF    D   +  
Sbjct: 87  -----VSLKIKEGVQNTLDLFLKKLEKHGVKEIEAACE-FDPNLHEAMFHIESDEHQSGA 140

Query: 163 IIKVVQDGYAINERVLRPALVSISK 187
           +++V+Q GY + ERV+RP  VS++K
Sbjct: 141 VVQVLQKGYKLGERVIRPTKVSVAK 165


>gi|37958838|gb|AAP51102.1| putative HSP24 [uncultured bacterium]
          Length = 180

 Score =  101 bits (252), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 89/149 (59%), Gaps = 9/149 (6%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E  D YLR  AE EN RRR D E   A+ +++  FA  +L V        DS    LA  
Sbjct: 40  EVSDAYLRAKAEAENTRRRADEEISKARKFAVESFADSLLPVK-------DSLEAALAAQ 92

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID-AKDQKFNPNMHQAMFEEPHDTVPA 160
             K ++ +++++EG++ T R++ + LER  V +I+ A   KF+P+ HQA+   P D   A
Sbjct: 93  LAKPDTPVETVLEGVQATLRQLGAALERNKVLEINPAAGTKFDPHQHQAISMVPADQ-EA 151

Query: 161 NTIIKVVQDGYAINERVLRPALVSISKGK 189
           NT++ V+Q GY IN+RVLRPALV+++  K
Sbjct: 152 NTVVGVLQKGYLINDRVLRPALVTVAAPK 180


>gi|94309949|ref|YP_583159.1| GrpE protein [Cupriavidus metallidurans CH34]
 gi|123081369|sp|Q1LPN6|GRPE_RALME RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|93353801|gb|ABF07890.1| heat shock/stress protein [Cupriavidus metallidurans CH34]
          Length = 180

 Score =  101 bits (252), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 87/148 (58%), Gaps = 12/148 (8%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           +++E  D +LR  AE EN+RRR+  E   A  ++I  FA +++ V D+L  AL     DL
Sbjct: 42  KAKEHYDMFLRATAEGENIRRRSQDEVAKAHKFAIESFADNLVPVMDSLQAALADGTGDL 101

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
                        L EG+E+T R++ +  ER  + +++   +KF+P+ HQA+   P +  
Sbjct: 102 GK-----------LREGVELTARQLAAAFERGRIVEVNPVGEKFDPHRHQAISMVPSEQE 150

Query: 159 PANTIIKVVQDGYAINERVLRPALVSIS 186
           P NT++ V+Q GY I +RVLRPALV++S
Sbjct: 151 P-NTVVNVLQRGYMIADRVLRPALVTVS 177


>gi|197127343|gb|ACH43841.1| putative GrpE-like 1 mitochondrial precusor variant 3 [Taeniopygia
           guttata]
          Length = 222

 Score =  101 bits (252), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 60/173 (34%), Positives = 99/173 (57%), Gaps = 11/173 (6%)

Query: 16  PSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAK 75
           PS+A    AEEK+++        Q +E  +KY R +A+ EN+R+R+ +  ++A+ Y I  
Sbjct: 58  PSSAEKLLAEEKAKLE------EQLKEVTEKYKRALADAENVRQRSQKLVEEAKLYGIQS 111

Query: 76  FARDMLSVSDNLSRALDSAPLDLANSEKKSESV-LKSLIEGIEMTRREMMSTLERYGVKK 134
           F +D+L V+D L +A +S P      E K E+  LKSL EG+ MT  ++    +++G+ +
Sbjct: 112 FCKDLLEVADILEKATESVP----REEIKDENPHLKSLYEGLVMTEMQIQKVFKKHGLLR 167

Query: 135 IDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           ++    KF+P  H+A+F    +     TI  V + GY ++ R LRPALV + K
Sbjct: 168 LNPVGAKFDPYEHEALFHTAVEGQEPGTIALVSKIGYKLHGRTLRPALVGVVK 220


>gi|20090336|ref|NP_616411.1| heat shock protein GrpE [Methanosarcina acetivorans C2A]
 gi|52782960|sp|Q8TQR3|GRPE_METAC RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|19915339|gb|AAM04891.1| heat shock protein [Methanosarcina acetivorans C2A]
          Length = 209

 Score =  101 bits (252), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 110/195 (56%), Gaps = 19/195 (9%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEF-RDKYLRVIAEMENLRRRTDRE 64
           ++K  +K   P  A + +  EKS    PE +  +  E  +D+  R+ A+ +N ++RT R+
Sbjct: 32  TKKAGEKTAEPEKATAGSGTEKS----PEAACREENELLKDQLFRLAADFDNFKKRTARQ 87

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
            ++ +   + +   D + V+DN  RAL SA         ++   + S++ GIE   ++  
Sbjct: 88  MEENRKAVLEQVLLDFVEVTDNFERALKSA---------QTAEDMGSIVSGIEQLSKQFF 138

Query: 125 STLERYGVKKIDA-KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
           S L++YG+++I   K  +F+P+ H+A+       VP NTI+ V + GY++NE+V+RPALV
Sbjct: 139 SILQKYGLERIKCEKAGEFDPHRHEAVQHIETSEVPDNTIVDVYKPGYSLNEKVIRPALV 198

Query: 184 SISKGKTQNPTEEKK 198
           S+++    NP E +K
Sbjct: 199 SVAR----NPDETEK 209


>gi|71892317|ref|YP_278051.1| heat shock protein 24 [Candidatus Blochmannia pennsylvanicus str.
           BPEN]
 gi|123734144|sp|Q492C7|GRPE_BLOPB RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|71796423|gb|AAZ41174.1| heat shock protein 24 [Candidatus Blochmannia pennsylvanicus str.
           BPEN]
          Length = 195

 Score =  101 bits (252), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 51/147 (34%), Positives = 89/147 (60%), Gaps = 10/147 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           R+  LR+ AE+EN+RRR  +E +    + + +F  ++L V DNL R +  +         
Sbjct: 58  RNTVLRLTAEIENIRRRNTQEIEKIHKFGLERFIFELLPVIDNLERTMSIS--------D 109

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
            S ++L ++IEGIE+T +  + T+ ++G+K I   +  FNP +HQA+   E  D  P N 
Sbjct: 110 NSNTLLSAIIEGIELTLKSFLDTVHKFGLKSIYEINVPFNPEIHQAISIIESEDHKP-NQ 168

Query: 163 IIKVVQDGYAINERVLRPALVSISKGK 189
           ++ ++Q GY +N R++RPA+V++S+ K
Sbjct: 169 VLTMIQKGYILNGRLIRPAMVTVSQSK 195


>gi|225684776|gb|EEH23060.1| mitochondrial co-chaperone GrpE [Paracoccidioides brasiliensis
           Pb03]
          Length = 233

 Score =  101 bits (252), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 86/153 (56%), Gaps = 7/153 (4%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           + +DKYLR +A+  NL+ RT RE + A++++I +FA D+L   DNL RAL + P +    
Sbjct: 79  DLKDKYLRSVADFRNLQERTRREVEAARNFAIQRFATDLLDSIDNLDRALSAVPTEKITG 138

Query: 102 EKKSESV-LKSLIEGIEMTRREMMSTLERYGVKKID------AKDQKFNPNMHQAMFEEP 154
           E   E+  L  L+ G+ MT R + STL ++G+++ D       K QKF+P +H+A F   
Sbjct: 139 EALKENKDLADLVSGLRMTERVLFSTLNKHGLERFDPSELVEGKPQKFDPKLHEATFMVA 198

Query: 155 HDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            +      ++     G+ +N R LR A V + K
Sbjct: 199 AEGKEDGDVLHAQSKGFTLNGRTLRAAKVGVVK 231


>gi|304316642|ref|YP_003851787.1| GrpE protein [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302778144|gb|ADL68703.1| GrpE protein [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 220

 Score =  101 bits (252), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 99/185 (53%), Gaps = 16/185 (8%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYL----RVIAEMENLRRRTD 62
           EKN++      N+N     ++ EI   +  L Q EE  ++YL    R+ AE EN RRRT+
Sbjct: 48  EKNVE----SDNSNEEKNNDEGEIEELKNRLKQKEEEANEYLEMAQRLKAEFENYRRRTE 103

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           +EK D   Y   +   D+L V DN  RAL++   D  N E  S        EGI +  R+
Sbjct: 104 KEKADLIEYGKEQVILDILPVIDNFERALETQYDD--NGENAS------FKEGINLIYRQ 155

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
               LE+ GVK+I++  Q F+P  H A+ +E  +    N II+V Q GY  N +V+RP++
Sbjct: 156 FKGILEKMGVKEIESLGQMFDPYKHHAVMQEEAEGKKENEIIEVFQKGYMFNNKVIRPSM 215

Query: 183 VSISK 187
           V ++K
Sbjct: 216 VKVAK 220


>gi|156086678|ref|XP_001610748.1| co-chaperone GrpE [Babesia bovis T2Bo]
 gi|154798001|gb|EDO07180.1| co-chaperone GrpE, putative [Babesia bovis]
          Length = 258

 Score =  101 bits (252), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 90/153 (58%), Gaps = 6/153 (3%)

Query: 35  ESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSA 94
           E  N  +E + KY   +   E + R +  + ++A+ Y+I +FA+DML V+D    A    
Sbjct: 111 ELTNTLKELQLKYRISLDNCEQIERISANKLQNAKLYAITQFAKDMLDVADAFELAFK-- 168

Query: 95  PLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEP 154
               A   + +  +    IEGI+MT  ++  T E+YG+K+ ++ +Q FNP +H+AM+E  
Sbjct: 169 ----ALGSQHNVDLDSKFIEGIKMTESQLHKTFEKYGIKRFESLNQMFNPEVHEAMYEIQ 224

Query: 155 HDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            D+V  NTI++VV +GY I +R+LR A V +S+
Sbjct: 225 DDSVEKNTILQVVFNGYTIKDRILRAAKVGVSR 257


>gi|15604476|ref|NP_220994.1| heat shock protein GrpE [Rickettsia prowazekii str. Madrid E]
 gi|6225481|sp|Q9ZCT4|GRPE_RICPR RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|3861170|emb|CAA15070.1| GRPE PROTEIN (grpE) [Rickettsia prowazekii]
 gi|292572258|gb|ADE30173.1| GrpE protein [Rickettsia prowazekii Rp22]
          Length = 178

 Score =  101 bits (252), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 94/148 (63%), Gaps = 8/148 (5%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           EE +DK +R  AE++N R+R ++ + +A+ Y+IA FA+++L+VSDNL+RAL   P   AN
Sbjct: 36  EELKDKLIRTTAEIDNTRKRLEKARDEAKDYAIATFAKELLNVSDNLARALAHKP---AN 92

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID-AKDQKFNPNMHQAMFEEPHDTVP 159
           S+ +    + ++I G++MT+ E+     ++ +++I  A    F+ N+H A+    H    
Sbjct: 93  SDVE----VTNIISGVQMTKDELDKIFHKHHIEEIKPAIGSMFDYNLHNAISHIEHPDHE 148

Query: 160 ANTIIKVVQDGYAINERVLRPALVSISK 187
            N+II ++Q GY I +R+LRPA V + K
Sbjct: 149 PNSIITLMQSGYKIRDRLLRPAAVQVVK 176


>gi|227551715|ref|ZP_03981764.1| GrpE protein [Enterococcus faecium TX1330]
 gi|257887149|ref|ZP_05666802.1| heat shock protein grpE [Enterococcus faecium 1,141,733]
 gi|257895686|ref|ZP_05675339.1| heat shock protein grpE [Enterococcus faecium Com12]
 gi|257898261|ref|ZP_05677914.1| heat shock protein grpE [Enterococcus faecium Com15]
 gi|293377704|ref|ZP_06623893.1| co-chaperone GrpE [Enterococcus faecium PC4.1]
 gi|293571901|ref|ZP_06682917.1| co-chaperone GrpE [Enterococcus faecium E980]
 gi|227179156|gb|EEI60128.1| GrpE protein [Enterococcus faecium TX1330]
 gi|257823203|gb|EEV50135.1| heat shock protein grpE [Enterococcus faecium 1,141,733]
 gi|257832251|gb|EEV58672.1| heat shock protein grpE [Enterococcus faecium Com12]
 gi|257836173|gb|EEV61247.1| heat shock protein grpE [Enterococcus faecium Com15]
 gi|291608155|gb|EFF37461.1| co-chaperone GrpE [Enterococcus faecium E980]
 gi|292643704|gb|EFF61825.1| co-chaperone GrpE [Enterococcus faecium PC4.1]
          Length = 187

 Score =  101 bits (252), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 56/148 (37%), Positives = 88/148 (59%), Gaps = 10/148 (6%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           EE  DKYLR  AE+ N+  R   E++  Q Y     A+ +L   DNL RAL         
Sbjct: 49  EEMEDKYLRARAEIANMANRGKNEREQLQKYRSQDLAKKLLPSIDNLERAL--------- 99

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPH-DTVP 159
           + + S+    SL +G+EM    + + LE  G++KI AK + F+PN+HQA+   P  +  P
Sbjct: 100 ATEVSDDQGASLKKGVEMVLESLRNALEEEGIEKIPAKGESFDPNLHQAVQTVPATEDTP 159

Query: 160 ANTIIKVVQDGYAINERVLRPALVSISK 187
           A+TI++V+Q+GY +++RVLRP +V +++
Sbjct: 160 ADTIVEVLQEGYKLHDRVLRPTMVIVAQ 187


>gi|308069967|ref|YP_003871572.1| GrpE protein (HSP-70 cofactor) [Paenibacillus polymyxa E681]
 gi|305859246|gb|ADM71034.1| GrpE protein (HSP-70 cofactor) [Paenibacillus polymyxa E681]
          Length = 190

 Score =  101 bits (252), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 53/148 (35%), Positives = 88/148 (59%), Gaps = 9/148 (6%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           Q+EE + ++LR  A+ +N RRRT +EK+D   Y+  K   +++ V DN  RAL +AP   
Sbjct: 51  QAEEHQQRFLRAQADFDNFRRRTLKEKEDLAKYASMKLVTELVPVLDNFERALATAP--- 107

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
               + +ES  +S  +G+EM  R+  S L+  GV  +++  Q FNP+ HQA+ +   +  
Sbjct: 108 ----QGAES--ESFSKGVEMIFRQFESVLQAEGVTAMNSVGQPFNPDFHQAIMQVESEEH 161

Query: 159 PANTIIKVVQDGYAINERVLRPALVSIS 186
               +++ VQ GY + ++VLRPA+V +S
Sbjct: 162 EEGIVVEEVQKGYMLKDKVLRPAMVKVS 189


>gi|308174336|ref|YP_003921041.1| nucleotide exchange factor for DnaK activity [Bacillus
           amyloliquefaciens DSM 7]
 gi|307607200|emb|CBI43571.1| nucleotide exchange factor for DnaK activity [Bacillus
           amyloliquefaciens DSM 7]
          Length = 188

 Score =  101 bits (252), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 88/143 (61%), Gaps = 9/143 (6%)

Query: 45  DKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKK 104
           +K LRV A+ EN +RR+  E + AQ Y       ++L   DN  RAL          E +
Sbjct: 55  NKLLRVQADFENYKRRSRLEMEAAQKYRSQNVVTEILPALDNFERAL--------QVEAE 106

Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTII 164
           SE   KSL++G+EM RR+++  LE+ GV+ I+A  Q+F+PN+HQA+ +   +   +N +I
Sbjct: 107 SEQT-KSLLQGMEMVRRQLIDALEKEGVEAIEAVGQEFDPNLHQAVMQVEDENFGSNIVI 165

Query: 165 KVVQDGYAINERVLRPALVSISK 187
           + +Q GY + +RV+RP++V +++
Sbjct: 166 EELQKGYKLKDRVIRPSMVKVNQ 188


>gi|58260572|ref|XP_567696.1| grpe protein [Cryptococcus neoformans var. neoformans JEC21]
 gi|57229777|gb|AAW46179.1| grpe protein, putative [Cryptococcus neoformans var. neoformans
           JEC21]
          Length = 228

 Score =  101 bits (251), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 60/168 (35%), Positives = 91/168 (54%), Gaps = 21/168 (12%)

Query: 35  ESLNQSEEFRDKYLRVIAEMENLR-------RRTDREKKDAQSYSIAKFARDMLSVSDNL 87
           ES  ++ EF +K   +  EM+ LR       RRT  EK  A  ++I+ FAR +L  +D L
Sbjct: 61  ESDKKAAEFEEKVKELTKEMQYLRADVQTAIRRTAEEKAKASEFAISSFARALLDTADVL 120

Query: 88  SRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDA-KDQKFNPNM 146
           S AL   P  +    K     L+SL  G+E+T + ++ T E +GVKK+++ K ++F+PN+
Sbjct: 121 STALKHVPQPIPAENKD----LQSLHTGVELTHKALLKTFESHGVKKLESLKGEQFDPNV 176

Query: 147 HQAMFEEPHDTVP---------ANTIIKVVQDGYAINERVLRPALVSI 185
           H+A+F  P    P          N I  V ++G+ I  RVLRPA V +
Sbjct: 177 HEALFTVPQAVAPKKENGEPHGPNEIFDVSKEGWTIGSRVLRPAQVGV 224


>gi|261195244|ref|XP_002624026.1| mitochondrial co-chaperone GrpE [Ajellomyces dermatitidis SLH14081]
 gi|239587898|gb|EEQ70541.1| mitochondrial co-chaperone GrpE [Ajellomyces dermatitidis SLH14081]
 gi|327348953|gb|EGE77810.1| GRPE protein [Ajellomyces dermatitidis ATCC 18188]
          Length = 252

 Score =  101 bits (251), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 52/153 (33%), Positives = 89/153 (58%), Gaps = 7/153 (4%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD-LAN 100
           + +DKYLR +A+  NL+ RT RE + A++++I +FA D+L   DNL RAL + P + ++ 
Sbjct: 98  DLKDKYLRSVADFRNLQERTRREVESARNFAIQRFATDLLDSIDNLDRALAAVPAEKISG 157

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKK------IDAKDQKFNPNMHQAMFEEP 154
           + +K    L  L+ G+ MT R + +TL ++G+++      +D K QKF+P +H+A F   
Sbjct: 158 AGEKENRELTELVAGLRMTERVLFNTLNKHGLERFDPSELVDGKPQKFDPKLHEATFMAA 217

Query: 155 HDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            +      ++     G+ +N R LR A V + K
Sbjct: 218 AEGKEDGDVLHAQTKGFILNGRTLRAAKVGVVK 250


>gi|239610612|gb|EEQ87599.1| mitochondrial co-chaperone GrpE [Ajellomyces dermatitidis ER-3]
          Length = 252

 Score =  101 bits (251), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 52/153 (33%), Positives = 89/153 (58%), Gaps = 7/153 (4%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD-LAN 100
           + +DKYLR +A+  NL+ RT RE + A++++I +FA D+L   DNL RAL + P + ++ 
Sbjct: 98  DLKDKYLRSVADFRNLQERTRREVESARNFAIQRFATDLLDSIDNLDRALAAVPAEKISG 157

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKK------IDAKDQKFNPNMHQAMFEEP 154
           + +K    L  L+ G+ MT R + +TL ++G+++      +D K QKF+P +H+A F   
Sbjct: 158 AGEKENRELTELVAGLRMTERVLFNTLNKHGLERFDPSELVDGKPQKFDPKLHEATFMAA 217

Query: 155 HDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            +      ++     G+ +N R LR A V + K
Sbjct: 218 AEGKEDGDVLHAQTKGFILNGRTLRAAKVGVVK 250


>gi|295662873|ref|XP_002791990.1| mitochondrial co-chaperone GrpE [Paracoccidioides brasiliensis
           Pb01]
 gi|226279642|gb|EEH35208.1| mitochondrial co-chaperone GrpE [Paracoccidioides brasiliensis
           Pb01]
          Length = 253

 Score =  101 bits (251), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 86/153 (56%), Gaps = 7/153 (4%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           + +DKYLR +A+  NL+ RT RE + A++++I +FA D+L   DNL RAL + P +    
Sbjct: 99  DLKDKYLRSVADFRNLQERTRREVESARNFAIQRFATDLLDSIDNLDRALSAVPAEKITG 158

Query: 102 EKKSESV-LKSLIEGIEMTRREMMSTLERYGVKKID------AKDQKFNPNMHQAMFEEP 154
           E   E+  L  L+ G+ MT R + STL ++G+++ D       K QKF+P +H+A F   
Sbjct: 159 EALKENKDLADLVSGLRMTERVLFSTLNKHGLERFDPSELVEGKPQKFDPKLHEATFMVA 218

Query: 155 HDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            +      ++     G+ +N R LR A V + K
Sbjct: 219 AEGKEDGDVLHAQSKGFTLNGRTLRAAKVGVVK 251


>gi|328554283|gb|AEB24775.1| heat shock protein GrpE [Bacillus amyloliquefaciens TA208]
 gi|328912680|gb|AEB64276.1| nucleotide exchange factor for DnaK activity [Bacillus
           amyloliquefaciens LL3]
          Length = 188

 Score =  101 bits (251), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 88/143 (61%), Gaps = 9/143 (6%)

Query: 45  DKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKK 104
           +K LRV A+ EN +RR+  E + AQ Y       ++L   DN  RAL          E +
Sbjct: 55  NKLLRVQADFENYKRRSRLEMEAAQKYRSQNVVTEILPALDNFERAL--------QVEAE 106

Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTII 164
           SE   KSL++G+EM RR++M  L++ GV+ I+A  Q+F+PN+HQA+ +   +   +N +I
Sbjct: 107 SEQT-KSLLQGMEMVRRQLMDALKKEGVEAIEAVGQEFDPNLHQAVMQVEDENFGSNIVI 165

Query: 165 KVVQDGYAINERVLRPALVSISK 187
           + +Q GY + +RV+RP++V +++
Sbjct: 166 EELQKGYKLKDRVIRPSMVKVNQ 188


>gi|282850171|ref|ZP_06259550.1| co-chaperone GrpE [Veillonella parvula ATCC 17745]
 gi|282579664|gb|EFB85068.1| co-chaperone GrpE [Veillonella parvula ATCC 17745]
          Length = 181

 Score =  101 bits (251), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 82/144 (56%), Gaps = 10/144 (6%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           +F ++Y R+ A+ EN +RRT++EK+    Y       D+L V DN  RA+ S        
Sbjct: 46  DFDNRYKRLQADFENFKRRTNQEKEQLAGYVKGDVLTDLLPVLDNFERAVQS-------- 97

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
              +E  +K  ++G  M  + +M+ L ++G+  I+A  Q F+PN HQA+   P D   ++
Sbjct: 98  --PAEGEVKVFLDGFIMIHQNLMAMLSKHGLAVIEAVGQPFDPNFHQAIMRVPSDEYESD 155

Query: 162 TIIKVVQDGYAINERVLRPALVSI 185
           T+ +V+Q GY ++ R +RPA+V +
Sbjct: 156 TVCEVLQTGYTVDGRCIRPAMVKV 179


>gi|319763797|ref|YP_004127734.1| grpe protein [Alicycliphilus denitrificans BC]
 gi|330823939|ref|YP_004387242.1| GrpE protein [Alicycliphilus denitrificans K601]
 gi|317118358|gb|ADV00847.1| GrpE protein [Alicycliphilus denitrificans BC]
 gi|329309311|gb|AEB83726.1| GrpE protein [Alicycliphilus denitrificans K601]
          Length = 180

 Score =  101 bits (251), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 62/152 (40%), Positives = 88/152 (57%), Gaps = 13/152 (8%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           +S E  D++LR  AE EN RRR + E   A+ + I  FA  +L V D+L  AL    ++ 
Sbjct: 41  KSAELADQFLRAKAEAENARRRAEEEVSKARKFGIESFAESLLPVCDSLDAALS---IES 97

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID-AKDQKFNPNMHQAMFEEPHDT 157
           A +E+        L EG + T R+++  LER  V  I+ A   KF+P+ HQA+   P D 
Sbjct: 98  ATAEQ--------LREGSDATLRQLVGALERNKVVVINPASGAKFDPHQHQAISMVPADQ 149

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISKGK 189
             ANTI+ V+Q GY I +RVLRPALV+++  K
Sbjct: 150 -EANTIVSVLQKGYLIADRVLRPALVTVAASK 180


>gi|253574641|ref|ZP_04851981.1| GrpE protein [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251845687|gb|EES73695.1| GrpE protein [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 219

 Score =  101 bits (251), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 90/148 (60%), Gaps = 9/148 (6%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           ++EEF+ + LR  A+ +N RRRT +EK++   Y+ AK   ++L V DN  RAL++   D+
Sbjct: 80  ENEEFQQRLLRAQADFDNFRRRTVKEKEELGKYASAKLITELLPVIDNFERALNTTG-DI 138

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
           +++         S ++G+EM  R++   L+  G+  ++A+ Q FNP  HQA+ +   +  
Sbjct: 139 SDA--------ASYVKGVEMIFRQLEGVLKAEGLTPMEAEGQPFNPEFHQAIMQVESEEH 190

Query: 159 PANTIIKVVQDGYAINERVLRPALVSIS 186
               +++VVQ GY + ++VLRPA+V +S
Sbjct: 191 EEGIVVEVVQKGYMLKDKVLRPAMVKVS 218


>gi|152990866|ref|YP_001356588.1| co-chaperone protein GrpE [Nitratiruptor sp. SB155-2]
 gi|166215271|sp|A6Q422|GRPE_NITSB RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|151422727|dbj|BAF70231.1| co-chaperone protein GrpE [Nitratiruptor sp. SB155-2]
          Length = 180

 Score =  101 bits (251), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 64/185 (34%), Positives = 101/185 (54%), Gaps = 8/185 (4%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           M+EK   +E+     +     E++E    E+ L + EE   KYLRV A+ EN ++R +RE
Sbjct: 1   MAEKKRAQEQEKVQEDQKMQNEQNECEEVEKKLQECEE---KYLRVHADFENTKKRLERE 57

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
           K  A  YS+ KFA+D+L   D+L  AL +   D  N    +E  +K L +GIE+T  + +
Sbjct: 58  KIQAIEYSLEKFAQDLLPALDSLDMALAAVSHDNLN----AEEAVKELKKGIELTIDQFI 113

Query: 125 STLER-YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
               +         +  +FNP++H+A+ +       A  I++V+Q GY   ER+LRPA V
Sbjct: 114 KAFNKNGIEVIEIEEGGEFNPHLHEAILQVDDAEKKAGQIVQVIQKGYKYKERILRPAKV 173

Query: 184 SISKG 188
           S++KG
Sbjct: 174 SVAKG 178


>gi|254468375|ref|ZP_05081781.1| co-chaperone GrpE [beta proteobacterium KB13]
 gi|207087185|gb|EDZ64468.1| co-chaperone GrpE [beta proteobacterium KB13]
          Length = 184

 Score =  101 bits (251), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 111/183 (60%), Gaps = 18/183 (9%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINI-PEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
           ++N D++ +  NAN    +E  EI+   ++ L Q EE +++ L   AE EN+RRR+  E 
Sbjct: 15  DQNEDQDLSKENAN----QENQEIDAQSDDLLEQIEELKNQVLYAKAEAENIRRRSYEEA 70

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
              + ++I  F++++LSV D+L  +L+S  +D            K L++G+E+T +++ +
Sbjct: 71  DKTRKFAIEGFSQELLSVKDSLEASLESDNVDN-----------KILMDGVELTLKQLNA 119

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
             E++ + +I    +KF+PN HQAM   E  +  P NT++ V+Q GY +N+RV+RPA+VS
Sbjct: 120 VFEKFNIAEIYPIGEKFDPNEHQAMSMVESKEQEP-NTVLSVLQKGYKLNDRVIRPAMVS 178

Query: 185 ISK 187
           + K
Sbjct: 179 VVK 181


>gi|238896059|ref|YP_002920795.1| heat shock protein GrpE [Klebsiella pneumoniae NTUH-K2044]
 gi|262043859|ref|ZP_06016948.1| co-chaperone GrpE [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|238548377|dbj|BAH64728.1| Hsp 24 nucleotide exchange factor [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|259038793|gb|EEW39975.1| co-chaperone GrpE [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
          Length = 196

 Score =  101 bits (251), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 90/146 (61%), Gaps = 8/146 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           R+  LR  A+ +NLRRRT+++ + A  +++ KF  ++L V D+L RAL+ A  D AN E 
Sbjct: 59  REVMLRAKADEDNLRRRTEQDIEKAHKFALEKFVNELLPVIDSLDRALEVA--DKANPE- 115

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
                L  ++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+     + V A  +
Sbjct: 116 -----LAPMVEGIELTLKSMLDVVRKFGVEVIADTNVPLDPNVHQAIAMVESEDVAAGNV 170

Query: 164 IKVVQDGYAINERVLRPALVSISKGK 189
           + V+Q GY +N R +R A+V+++K K
Sbjct: 171 LSVMQKGYTLNGRTIRAAMVTVAKAK 196


>gi|152971463|ref|YP_001336572.1| heat shock protein GrpE [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|166215268|sp|A6TCM1|GRPE_KLEP7 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|150956312|gb|ABR78342.1| Hsp 24 nucleotide exchange factor [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
          Length = 196

 Score =  101 bits (251), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 90/146 (61%), Gaps = 8/146 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           R+  LR  A+ +NLRRRT+++ + A  +++ KF  ++L V D+L RAL+ A  D AN E 
Sbjct: 59  REVMLRAKADEDNLRRRTEQDIEKAHKFALEKFVNELLPVIDSLDRALEVA--DKANPE- 115

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
                L  ++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+     + V A  +
Sbjct: 116 -----LAPMVEGIELTLKSMLDVVRKFGVEVIADTNVPLDPNVHQAIAMVESEDVAAGNV 170

Query: 164 IKVVQDGYAINERVLRPALVSISKGK 189
           + V+Q GY +N R +R A+V+++K K
Sbjct: 171 LAVMQKGYTLNGRTIRAAMVTVAKAK 196


>gi|253999611|ref|YP_003051674.1| GrpE protein [Methylovorus sp. SIP3-4]
 gi|313201650|ref|YP_004040308.1| grpe protein [Methylovorus sp. MP688]
 gi|253986290|gb|ACT51147.1| GrpE protein [Methylovorus sp. SIP3-4]
 gi|312440966|gb|ADQ85072.1| GrpE protein [Methylovorus sp. MP688]
          Length = 174

 Score =  101 bits (251), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 89/143 (62%), Gaps = 12/143 (8%)

Query: 48  LRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSES 107
           L V AE EN+RRR   +   A+ +++ KF+ ++L+V D+L  AL               +
Sbjct: 44  LYVKAEGENIRRRAAEDIDKARKFALEKFSSELLAVKDSLDAAL-----------VVENA 92

Query: 108 VLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVV 167
            ++S   G+E+T ++++S  E++ + +I+   +KF+PN HQA+     D  P N++I V+
Sbjct: 93  TVESYKSGVELTAKQLLSVFEKFHITEINPLGEKFDPNKHQAISMLESDQEP-NSVISVL 151

Query: 168 QDGYAINERVLRPALVSISKGKT 190
           Q GYA+NERVLRPALV+++K K+
Sbjct: 152 QKGYALNERVLRPALVTVAKAKS 174


>gi|190570942|ref|YP_001975300.1| heat shock protein GrpE [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213019457|ref|ZP_03335263.1| heat shock protein GrpE [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|254799624|sp|B3CPX8|GRPE_WOLPP RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|190357214|emb|CAQ54631.1| heat shock protein GrpE [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212994879|gb|EEB55521.1| heat shock protein GrpE [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 186

 Score =  101 bits (251), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 98/182 (53%), Gaps = 23/182 (12%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
           + K K     +  T +   E+NI +E   Q E   D   R +A+ EN++R   ++  DA 
Sbjct: 16  VSKRKGDDQEDQQTGDLSEELNILKERAVQLE---DHLRRAVADNENVKRIMQKQISDAS 72

Query: 70  SYSIAKFARDMLSVSDNLSRAL----DSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
            Y++ KFARDM+   DNL +A+    D  P+                 EGI++  ++++S
Sbjct: 73  DYAVTKFARDMIDSCDNLKKAMENLKDGDPIH----------------EGIKVAHQKIVS 116

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
            L+++G+++ID     F+ N+HQA+ E   +     TI++V+Q GY I  R+LRPA+V +
Sbjct: 117 DLKKHGIEEIDPIGNSFDSNLHQAVVEREDNEKEPGTIVEVLQTGYTIKNRLLRPAMVIL 176

Query: 186 SK 187
           SK
Sbjct: 177 SK 178


>gi|222474752|ref|YP_002563167.1| GrpE protein (grpE) [Anaplasma marginale str. Florida]
 gi|254994609|ref|ZP_05276799.1| GrpE protein (grpE) [Anaplasma marginale str. Mississippi]
 gi|255002721|ref|ZP_05277685.1| GrpE protein (grpE) [Anaplasma marginale str. Puerto Rico]
 gi|255003849|ref|ZP_05278650.1| GrpE protein (grpE) [Anaplasma marginale str. Virginia]
 gi|222418888|gb|ACM48911.1| GrpE protein (grpE) [Anaplasma marginale str. Florida]
          Length = 211

 Score =  101 bits (251), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 105/182 (57%), Gaps = 18/182 (9%)

Query: 12  KEKNPSNANSSTAEEKSEINIPEESLN------QSEEFRDKYLRVIAEMENLRRRTDREK 65
           +++ P+   ++    K++  +  +SL       + E  R++    +A+ +NLRR   +E 
Sbjct: 36  RKQGPAGKFAAGVGGKAQHRVAADSLELEKLRAEVEHLRNQLRLAVADSKNLRRLVQKEV 95

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
           ++A++ SI+ F RD+++  DNL  +L     +L++ +        ++  G++MT   +MS
Sbjct: 96  EEAKTLSISDFVRDLIASCDNLEASLK----NLSDDD--------NVHTGVKMTWDGLMS 143

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
           TL  +GV ++    ++F+P  H+A+ +   D+ PA T+++VVQ GY I  +VLRPALV +
Sbjct: 144 TLSSHGVSRVSPLGEQFDPRFHKAVTQAVDDSKPAGTVLEVVQAGYIIQTKVLRPALVIV 203

Query: 186 SK 187
           SK
Sbjct: 204 SK 205


>gi|330013055|ref|ZP_08307559.1| co-chaperone GrpE [Klebsiella sp. MS 92-3]
 gi|328533603|gb|EGF60318.1| co-chaperone GrpE [Klebsiella sp. MS 92-3]
          Length = 196

 Score =  101 bits (251), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 90/146 (61%), Gaps = 8/146 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           R+  LR  A+ +NLRRRT+++ + A  +++ KF  ++L V D+L RAL+ A  D AN E 
Sbjct: 59  REVMLRAKADEDNLRRRTEQDIEKAHKFALEKFVNELLPVIDSLDRALEVA--DKANPE- 115

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
                L  ++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+     + V A  +
Sbjct: 116 -----LAPMVEGIELTLKSMLDVVRKFGVEVIADTNVPLDPNVHQAIAMVESEDVAAGNV 170

Query: 164 IKVVQDGYAINERVLRPALVSISKGK 189
           + V+Q GY +N R +R A+V+++K K
Sbjct: 171 LSVMQKGYTLNGRTIRAAMVTVAKAK 196


>gi|303229107|ref|ZP_07315909.1| co-chaperone GrpE [Veillonella atypica ACS-134-V-Col7a]
 gi|303232187|ref|ZP_07318890.1| co-chaperone GrpE [Veillonella atypica ACS-049-V-Sch6]
 gi|302513293|gb|EFL55332.1| co-chaperone GrpE [Veillonella atypica ACS-049-V-Sch6]
 gi|302516231|gb|EFL58171.1| co-chaperone GrpE [Veillonella atypica ACS-134-V-Col7a]
          Length = 183

 Score =  101 bits (251), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 55/168 (32%), Positives = 92/168 (54%), Gaps = 18/168 (10%)

Query: 26  EKSEINIPEESLNQSEE--------FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFA 77
           E+SE    EES+  + E        F ++Y R+ A+ EN +RRT++EK+    +      
Sbjct: 24  EQSEAQNAEESVVDASEVLEELKADFDNRYKRLQADFENFKRRTNQEKEQLAGFVKGDVL 83

Query: 78  RDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDA 137
           +D+L V DN  RA+  AP         +E   K  ++G  M  + +M+ L ++G+  IDA
Sbjct: 84  KDLLPVLDNFERAV-QAP---------AEGDTKVFLDGFVMIHQNLMAMLSKHGLAVIDA 133

Query: 138 KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
             + F+PN HQA+   P D   ++T+ +V+Q GY ++ R +RPA+V +
Sbjct: 134 VGKPFDPNFHQAIMRVPSDEYESDTVCEVLQTGYTVDGRCIRPAMVKV 181


>gi|242779120|ref|XP_002479378.1| mitochondrial co-chaperone GrpE, putative [Talaromyces stipitatus
           ATCC 10500]
 gi|218722997|gb|EED22415.1| mitochondrial co-chaperone GrpE, putative [Talaromyces stipitatus
           ATCC 10500]
          Length = 239

 Score =  101 bits (251), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 64/191 (33%), Positives = 107/191 (56%), Gaps = 17/191 (8%)

Query: 4   FMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEE--------FRDKYLRVIAEME 55
             S +N  K+++    N   +E+ +E   PE++L +  E         +DKYLR +A+  
Sbjct: 49  LYSTENGTKQEDAKKENGEGSEKPAES--PEDALKKELEVKDKEIVDLKDKYLRSVADFR 106

Query: 56  NLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD-LANSEKKSESVLKSLIE 114
           NL+ RT R+  +A+S++I KFA D+L   DN  RAL   P + L N + ++   L+ L +
Sbjct: 107 NLQERTRRDMDNARSFAIQKFAVDLLESIDNFDRALSVVPAEKLNNDQSETNKDLQELHQ 166

Query: 115 GIEMTRREMMSTLERYGVKKI------DAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQ 168
           G++MT   ++STL+++G+++       D K QKF+P +H+A F    +      I+ V  
Sbjct: 167 GLKMTENILLSTLKKHGLERFDPSETADGKPQKFDPKLHEATFMAKAEGRENGDIMFVQS 226

Query: 169 DGYAINERVLR 179
            GY++N RVLR
Sbjct: 227 KGYSLNGRVLR 237


>gi|107021826|ref|YP_620153.1| heat shock protein GrpE [Burkholderia cenocepacia AU 1054]
 gi|116688773|ref|YP_834396.1| GrpE protein [Burkholderia cenocepacia HI2424]
 gi|170732072|ref|YP_001764019.1| heat shock protein GrpE [Burkholderia cenocepacia MC0-3]
 gi|254246255|ref|ZP_04939576.1| Molecular chaperone GrpE [Burkholderia cenocepacia PC184]
 gi|123245259|sp|Q1BYX5|GRPE_BURCA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|166215251|sp|A0K4S6|GRPE_BURCH RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737113|sp|B1JW17|GRPE_BURCC RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|105892015|gb|ABF75180.1| GrpE protein [Burkholderia cenocepacia AU 1054]
 gi|116646862|gb|ABK07503.1| GrpE protein [Burkholderia cenocepacia HI2424]
 gi|124871031|gb|EAY62747.1| Molecular chaperone GrpE [Burkholderia cenocepacia PC184]
 gi|169815314|gb|ACA89897.1| GrpE protein [Burkholderia cenocepacia MC0-3]
          Length = 181

 Score =  101 bits (251), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 86/148 (58%), Gaps = 12/148 (8%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E ++ +LR  AE EN+RRR   +   A  ++I  FA  +L V D+L  A++    D+A  
Sbjct: 46  ELQESFLRAKAETENVRRRAQDDVSKAHKFAIESFAEHLLPVLDSLEAAVNDTSGDIAKV 105

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
                       EG+E+T R++ S LE+  V  I+   +KF+P+ HQA+   P +  P N
Sbjct: 106 R-----------EGVELTLRQLTSALEKGRVVAINPIGEKFDPHQHQAISMVPAEQEP-N 153

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGK 189
           T++ V+Q GY I +RVLRPALV++++ K
Sbjct: 154 TVVSVLQKGYTIADRVLRPALVTVAQPK 181


>gi|299530692|ref|ZP_07044107.1| heat shock protein GrpE [Comamonas testosteroni S44]
 gi|298721208|gb|EFI62150.1| heat shock protein GrpE [Comamonas testosteroni S44]
          Length = 181

 Score =  100 bits (250), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 89/156 (57%), Gaps = 13/156 (8%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           EE   +S +  D+YLR  A+ EN+RRR + E   A+ + I  FA  +L V D+L  AL  
Sbjct: 38  EELKAKSADLADQYLRAKADAENMRRRAEEEVAKARKFGIESFAESLLPVIDSLDAAL-- 95

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID-AKDQKFNPNMHQAMFE 152
                        +  + L EG + T R++ S LER  V  I+ A  +KF+P+ HQA+  
Sbjct: 96  ---------AIQNATPEQLREGSDATLRQLNSALERNKVLAINPAAGEKFDPHHHQAISM 146

Query: 153 EPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
            P D  P NT++ V+Q GY I +R+LRPALV++++G
Sbjct: 147 VPADQ-PTNTVVAVLQKGYVIADRILRPALVTVAQG 181


>gi|239827776|ref|YP_002950400.1| GrpE protein [Geobacillus sp. WCH70]
 gi|239808069|gb|ACS25134.1| GrpE protein [Geobacillus sp. WCH70]
          Length = 208

 Score =  100 bits (250), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 52/146 (35%), Positives = 86/146 (58%), Gaps = 9/146 (6%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E  ++YLR+ A+ EN RRRT  E + A+ Y       D+L   DN  RAL       A++
Sbjct: 72  EMENRYLRLYADFENFRRRTKMEMEAAEKYRAQSLVSDLLPALDNFERALKIE----ADN 127

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
           E+      KS+++G+EM  R ++  L++ GV+ I+A  + F+PN+HQA+ +        N
Sbjct: 128 EQA-----KSILQGMEMVYRSVLDALKKEGVEAIEAVGKPFDPNLHQAVMQVEDSNYEPN 182

Query: 162 TIIKVVQDGYAINERVLRPALVSISK 187
           T+++  Q GY + +RV+RPA+V +S+
Sbjct: 183 TVVEEFQKGYKLKDRVIRPAMVKVSQ 208


>gi|226286659|gb|EEH42172.1| mitochondrial co-chaperone GrpE [Paracoccidioides brasiliensis
           Pb18]
          Length = 254

 Score =  100 bits (250), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 86/153 (56%), Gaps = 7/153 (4%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           + +DKYLR +A+  NL+ RT RE + A++++I +FA D+L   DNL RAL + P +    
Sbjct: 100 DLKDKYLRSVADFRNLQERTRREVEAARNFAIQRFATDLLDSIDNLDRALSAVPTEKITG 159

Query: 102 EKKSESV-LKSLIEGIEMTRREMMSTLERYGVKKID------AKDQKFNPNMHQAMFEEP 154
           E   E+  L  L+ G+ MT R + STL ++G+++ D       K QKF+P +H+A F   
Sbjct: 160 EALKENKDLADLVSGLRMTERVLFSTLNKHGLERFDPSELVEGKPQKFDPKLHEATFMVA 219

Query: 155 HDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            +      ++     G+ +N R LR A V + K
Sbjct: 220 AEGKEDGDVLHAQSKGFTLNGRTLRAAKVGVVK 252


>gi|73540743|ref|YP_295263.1| GrpE protein [Ralstonia eutropha JMP134]
 gi|123774122|sp|Q473L4|GRPE_RALEJ RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|72118156|gb|AAZ60419.1| GrpE protein [Ralstonia eutropha JMP134]
          Length = 184

 Score =  100 bits (250), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 88/151 (58%), Gaps = 12/151 (7%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           ++ E  D Y+R +AE EN+RRR   +   A  ++I  FA ++L V D+L  AL     D+
Sbjct: 46  KAREHYDMYVRAVAEGENIRRRAQEDVSKAHKFAIENFADNLLPVMDSLQAALADGSGDI 105

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
           A            L EG+E+T R++ +  ER  + +++   +KF+P+ HQA+   P +  
Sbjct: 106 AK-----------LREGVELTARQLSAAFERGKIVELNPVGEKFDPHRHQAISMVPSEQ- 153

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISKGK 189
            +NT++ V+Q GY I +RVLRPALV++S  K
Sbjct: 154 ESNTVVTVLQRGYTIADRVLRPALVTVSAPK 184


>gi|194377212|dbj|BAG63167.1| unnamed protein product [Homo sapiens]
          Length = 196

 Score =  100 bits (250), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 58/176 (32%), Positives = 98/176 (55%), Gaps = 7/176 (3%)

Query: 15  NPSNANSSTAEEKSEINIPEESLNQSEEFRD---KYLRVIAEMENLRRRTDREKKDAQSY 71
           +P    ++T ++ S  N+ EE + QSE+ ++   KY R +A+ ENLR+R+ +  ++A+ Y
Sbjct: 23  SPRLLCTATKQKNSGQNL-EEDMGQSEQLKETVEKYKRALADTENLRQRSQKLVEEAKLY 81

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
            I  F +D+L V+D L +A    P       K     LK+L EG+ MT  ++     ++G
Sbjct: 82  GIQAFCKDLLEVADVLEKATQCVP---KEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHG 138

Query: 132 VKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           + K++    KF+P  H+A+F  P +     T+  V + GY ++ R LRPALV + K
Sbjct: 139 LLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVK 194


>gi|222151480|ref|YP_002560636.1| heat shock molecular chaperone protein GrpE [Macrococcus
           caseolyticus JCSC5402]
 gi|222120605|dbj|BAH17940.1| heat shock molecular chaperone protein GrpE [Macrococcus
           caseolyticus JCSC5402]
          Length = 199

 Score =  100 bits (250), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 89/152 (58%), Gaps = 12/152 (7%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           E  L QSEE   KYLR+ AE EN ++RT +E    ++Y      RD+L   DN+ RAL  
Sbjct: 58  EAKLEQSEE---KYLRLYAEFENYKKRTRQELDTERTYRAQSVLRDILPAIDNIERAL-- 112

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
                  +++      KSL +G+EM    ++ +L+  G++ I+A DQ F+PN+HQA+ +E
Sbjct: 113 -------AQQGESDEFKSLHKGVEMVYESLLHSLKENGLEVIEALDQPFDPNLHQAVMQE 165

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
             +   +  +++ +Q GY + ERVLRP++V +
Sbjct: 166 SDEHKDSGIVLEELQKGYKLKERVLRPSMVKV 197


>gi|186477248|ref|YP_001858718.1| heat shock protein GrpE [Burkholderia phymatum STM815]
 gi|226737116|sp|B2JGE4|GRPE_BURP8 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|184193707|gb|ACC71672.1| GrpE protein [Burkholderia phymatum STM815]
          Length = 202

 Score =  100 bits (250), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 85/148 (57%), Gaps = 12/148 (8%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E ++ +LR  AE EN+RRR   +   A  ++I  FA  +L V D+L  A+  +  DLA  
Sbjct: 67  ELQESFLRAKAETENVRRRGQEDVAKAHKFAIESFAEHLLPVMDSLEAAVAHSTDDLAK- 125

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
                     + EG+E+T R++   LE+  V  ++   +KF+P+ HQA+   P D  P N
Sbjct: 126 ----------VREGVELTLRQLTGALEKGKVVALNPVGEKFDPHRHQAISMVPADQEP-N 174

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGK 189
           T++ V+Q GY I +RVLRPALV+++  K
Sbjct: 175 TVVAVLQKGYVIADRVLRPALVTVAAPK 202


>gi|206561611|ref|YP_002232376.1| heat shock protein GrpE [Burkholderia cenocepacia J2315]
 gi|226737114|sp|B4EDZ4|GRPE_BURCJ RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|198037653|emb|CAR53596.1| putative heat shock protein [Burkholderia cenocepacia J2315]
          Length = 181

 Score =  100 bits (250), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 85/148 (57%), Gaps = 12/148 (8%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E ++ +LR  AE EN+RRR   +   A  ++I  FA  +L V D+L  A+     D+A  
Sbjct: 46  ELQESFLRAKAETENVRRRAQDDVSKAHKFAIESFAEHLLPVLDSLEAAVSDTSGDIAKV 105

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
                       EG+E+T R++ S LE+  V  I+   +KF+P+ HQA+   P +  P N
Sbjct: 106 R-----------EGVELTLRQLTSALEKGRVVAINPVGEKFDPHQHQAISMVPAEQEP-N 153

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGK 189
           T++ V+Q GY I +RVLRPALV++++ K
Sbjct: 154 TVVTVLQKGYMIADRVLRPALVTVAQSK 181


>gi|321263849|ref|XP_003196642.1| grpe protein [Cryptococcus gattii WM276]
 gi|317463119|gb|ADV24855.1| Grpe protein, putative [Cryptococcus gattii WM276]
          Length = 228

 Score =  100 bits (250), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 60/168 (35%), Positives = 90/168 (53%), Gaps = 21/168 (12%)

Query: 35  ESLNQSEEFRDKYLRVIAEMENLR-------RRTDREKKDAQSYSIAKFARDMLSVSDNL 87
           ES  ++ EF +K   +  EM+ LR       RR+  EK  A  ++I+ FAR +L  +D L
Sbjct: 61  ESDKKAAEFEEKVKELTKEMQYLRADVQTAVRRSAEEKAKASEFAISSFARALLDTADVL 120

Query: 88  SRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID-AKDQKFNPNM 146
           S AL   P  +    K     L+SL  G+E+T + ++ T E +GVKK++  K ++F+PNM
Sbjct: 121 STALKHVPQPIPAENKD----LQSLHTGVELTHKALLKTFESHGVKKLENLKGEQFDPNM 176

Query: 147 HQAMFEEPHDTVP---------ANTIIKVVQDGYAINERVLRPALVSI 185
           H+A+F  P    P          N I  V ++G+ I  RVLRPA V +
Sbjct: 177 HEALFTVPQAIAPKKDNGEPHGPNEIFDVSKEGWTIGSRVLRPAQVGV 224


>gi|126664874|ref|ZP_01735858.1| Molecular chaperone GrpE (heat shock protein) [Marinobacter sp.
           ELB17]
 gi|126631200|gb|EBA01814.1| Molecular chaperone GrpE (heat shock protein) [Marinobacter sp.
           ELB17]
          Length = 202

 Score =  100 bits (250), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 92/147 (62%), Gaps = 5/147 (3%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           +EF+++ LR  AEM+N+RRR + + + A  +++ KF +++L V D+L +A++S       
Sbjct: 50  QEFQEQVLRSQAEMQNVRRRAENDVEKAHKFAVEKFVKELLPVVDSLEKAVEST-----E 104

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
               S  ++ S+ +G+E+T    +S L+++ V++++   + F+P  H+AM   P      
Sbjct: 105 GHDSSGDLVTSIRQGVELTLDMFLSGLKKFNVERLNPVGEPFDPQYHEAMSMVPAPNAEP 164

Query: 161 NTIIKVVQDGYAINERVLRPALVSISK 187
           N+++ V+Q GY +N RV+RPA+V ++K
Sbjct: 165 NSVVAVMQKGYLLNGRVVRPAMVMVAK 191


>gi|146329795|ref|YP_001209724.1| co-chaperone GrpE [Dichelobacter nodosus VCS1703A]
 gi|166215261|sp|A5EYG2|GRPE_DICNV RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|146233265|gb|ABQ14243.1| co-chaperone GrpE [Dichelobacter nodosus VCS1703A]
          Length = 187

 Score =  100 bits (250), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 96/167 (57%), Gaps = 11/167 (6%)

Query: 25  EEKSEINIPEESLNQSE----EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDM 80
           EE+  + +P++ +NQ +    E +D+ +   AE ENLR+R  RE ++A  ++  +  +D+
Sbjct: 28  EEEPILTLPDDQINQLQQEVAELKDQLIWQKAENENLRKRQARELENAYKFASERLLKDL 87

Query: 81  LSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQ 140
           L V D+L+  L +A LD  N        +K  I G EMT      TL R+G+++I+   +
Sbjct: 88  LPVIDSLNLGLQAA-LDTENE------AVKQFITGSEMTLTMFQETLARHGIEEINPVGE 140

Query: 141 KFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           KFNP +H+A+   P +    NT+I+V Q GY +N R +R A V +SK
Sbjct: 141 KFNPELHEAVTMTPSEAHEPNTVIQVTQKGYLLNGRTVRAAQVIVSK 187


>gi|57167752|ref|ZP_00366892.1| co-chaperone GrpE [Campylobacter coli RM2228]
 gi|305432224|ref|ZP_07401388.1| co-chaperone GrpE [Campylobacter coli JV20]
 gi|57020874|gb|EAL57538.1| co-chaperone GrpE [Campylobacter coli RM2228]
 gi|304444767|gb|EFM37416.1| co-chaperone GrpE [Campylobacter coli JV20]
          Length = 176

 Score =  100 bits (249), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 91/148 (61%), Gaps = 12/148 (8%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           +E +DKY+R  AE EN+++R ++EK  A +Y+   FA+D+L V D L  A+        N
Sbjct: 40  DELKDKYMRANAEFENIKKRMEKEKLSAMAYANESFAKDLLDVLDALEAAI--------N 91

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQK-FNPNMHQAMFEEPHDTVP 159
            E + E  LK + EG++ T    +  LE++GV  I  KD+K F+PN+H+AMF    +   
Sbjct: 92  VECQDEISLK-IKEGVQNTLDLFLKKLEKHGVALI--KDEKEFDPNLHEAMFHVDSENHQ 148

Query: 160 ANTIIKVVQDGYAINERVLRPALVSISK 187
           +  +++V+Q GY I +RV+RP  VS++K
Sbjct: 149 SGEVVQVLQKGYKIADRVIRPTKVSVAK 176


>gi|330815618|ref|YP_004359323.1| GrpE protein [Burkholderia gladioli BSR3]
 gi|327368011|gb|AEA59367.1| GrpE protein [Burkholderia gladioli BSR3]
          Length = 184

 Score =  100 bits (249), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 87/148 (58%), Gaps = 12/148 (8%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E ++ +LR  AE EN+RRR   +   A  ++I  FA  +L V D+L  A+          
Sbjct: 49  ELQESFLRAKAETENVRRRAQDDVAKAHKFAIEGFAEHLLPVIDSLEAAVGD-------- 100

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
             KS+ + K + EG+E+T R++ S LE+  V  ID    KF+P+ HQA+   P +  P N
Sbjct: 101 --KSDDIAK-IREGVELTLRQLQSALEKGRVNVIDPVGAKFDPHQHQAISMVPAEQEP-N 156

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGK 189
           T++ V+Q GY I +RVLRPALV++++ K
Sbjct: 157 TVVSVLQKGYTIADRVLRPALVTVAQPK 184


>gi|134117063|ref|XP_772758.1| hypothetical protein CNBK1320 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50255376|gb|EAL18111.1| hypothetical protein CNBK1320 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 228

 Score =  100 bits (249), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 60/168 (35%), Positives = 90/168 (53%), Gaps = 21/168 (12%)

Query: 35  ESLNQSEEFRDKYLRVIAEMENLR-------RRTDREKKDAQSYSIAKFARDMLSVSDNL 87
           ES  ++ EF +K   +  EM+ LR       RRT  EK  A  ++I+ FAR +L  +D L
Sbjct: 61  ESDKKAAEFEEKVKELTKEMQYLRADVQTAIRRTAEEKAKASEFAISSFARALLDTADVL 120

Query: 88  SRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID-AKDQKFNPNM 146
           S AL   P  +    K     L+SL  G+E+T + ++ T E +GVKK++  K ++F+PN+
Sbjct: 121 STALKHVPQPIPAENKD----LQSLHTGVELTHKALLKTFESHGVKKLENLKGEQFDPNV 176

Query: 147 HQAMFEEPHDTVP---------ANTIIKVVQDGYAINERVLRPALVSI 185
           H+A+F  P    P          N I  V ++G+ I  RVLRPA V +
Sbjct: 177 HEALFTVPQAVAPKKENGEPHGPNEIFDVSKEGWTIGSRVLRPAQVGV 224


>gi|160900662|ref|YP_001566244.1| heat shock protein GrpE [Delftia acidovorans SPH-1]
 gi|226737124|sp|A9BNG4|GRPE_DELAS RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|160366246|gb|ABX37859.1| GrpE protein [Delftia acidovorans SPH-1]
          Length = 181

 Score =  100 bits (249), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 87/149 (58%), Gaps = 13/149 (8%)

Query: 40  SEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLA 99
           S E  D++LR  AE EN+RRR + E   A+ + I  FA  +L V D+L  AL    +  A
Sbjct: 43  SAELADQFLRAKAEAENVRRRAEDEVSKARKFGIESFAESLLPVCDSLDAAL---AIQQA 99

Query: 100 NSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID-AKDQKFNPNMHQAMFEEPHDTV 158
             E+        L EG + T R++ S LER  V  I+ A  +KF+PN+HQA+   P    
Sbjct: 100 TPEQ--------LREGADATLRQLTSALERNKVVTINPAAGEKFDPNLHQAISMVPAQQ- 150

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISK 187
            ANT++ V+Q GY I +R+LRPALV++++
Sbjct: 151 EANTVVSVLQKGYLIADRILRPALVTVAQ 179


>gi|73666744|ref|YP_302760.1| GrpE protein [Ehrlichia canis str. Jake]
 gi|123759469|sp|Q3YSZ3|GRPE_EHRCJ RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|72393885|gb|AAZ68162.1| GrpE protein [Ehrlichia canis str. Jake]
          Length = 199

 Score =  100 bits (249), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 86/149 (57%), Gaps = 12/149 (8%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           Q   F++++   +A+ EN++R   +   D   Y+I+ FARD+LS  DNL  +L +   D 
Sbjct: 60  QLAHFQNQFRLAVADKENVKRIMQKNIDDTSIYAISNFARDLLSSCDNLETSLKNLKED- 118

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
                       S+  G+ MT +E+++TLER+ + +ID   +KFNP  H+A+ +   +  
Sbjct: 119 -----------DSIHAGVLMTYKELLNTLERHNITRIDPIGEKFNPQFHKAVSQMTDEDK 167

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISK 187
             NTI+ VVQ GY I +++LRPA V ISK
Sbjct: 168 DENTILHVVQPGYIIKDKLLRPASVIISK 196


>gi|224417715|ref|ZP_03655721.1| heat shock protein GrpE [Helicobacter canadensis MIT 98-5491]
 gi|253827060|ref|ZP_04869945.1| heat shock protein GrpE [Helicobacter canadensis MIT 98-5491]
 gi|313141257|ref|ZP_07803450.1| protein grpE [Helicobacter canadensis MIT 98-5491]
 gi|253510466|gb|EES89125.1| heat shock protein GrpE [Helicobacter canadensis MIT 98-5491]
 gi|313130288|gb|EFR47905.1| protein grpE [Helicobacter canadensis MIT 98-5491]
          Length = 180

 Score =  100 bits (249), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 90/154 (58%), Gaps = 4/154 (2%)

Query: 35  ESL-NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           ESL N+ +E  D+YLR  A+ EN ++R  REK  A  Y+  K A+D+L   D L  AL +
Sbjct: 30  ESLQNKIKELEDQYLRTYADFENTKKRLVREKDQALEYAYEKIAKDLLPSIDTLEIALKT 89

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
                 NS++    +L  + EGI +T   ++ TL ++G++ IDA  + F+PN H A+ + 
Sbjct: 90  IKDSKENSDQA--EILGKIEEGIALTLDNLLKTLAKHGIEPIDANGE-FDPNFHDAIMQV 146

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
             D+     I+  +Q GY   ERVLRP++VSI+K
Sbjct: 147 QSDSHNVGEIVAEMQKGYKYKERVLRPSMVSIAK 180


>gi|164686295|ref|ZP_02210325.1| hypothetical protein CLOBAR_02733 [Clostridium bartlettii DSM
           16795]
 gi|164601897|gb|EDQ95362.1| hypothetical protein CLOBAR_02733 [Clostridium bartlettii DSM
           16795]
          Length = 195

 Score =  100 bits (249), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 56/172 (32%), Positives = 100/172 (58%), Gaps = 12/172 (6%)

Query: 15  NPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIA 74
           N ++ NS   E+K +  I +   ++ E   DKY R+ AE  N  RRT +EK+    ++  
Sbjct: 35  NVTDINSKLEEKKVDDQIKDLQ-SKVEASEDKYKRLQAEYSNYIRRTQQEKETIGVFANE 93

Query: 75  KFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKK 134
           K   +++ V DN+ RALD+ P        K E++ K    G+++  +++  +L ++GV++
Sbjct: 94  KIITELIPVIDNMERALDACP-------DKEEALYK----GVDLVYKQLKDSLVKFGVEE 142

Query: 135 IDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           I+A+D  F+PN+H A+ +E  D V  N ++ V+Q GY +  +V+RP +V +S
Sbjct: 143 IEAQDADFDPNVHMAVMQESIDGVEPNKVVMVLQKGYKLGTKVIRPTMVKVS 194


>gi|327394854|dbj|BAK12276.1| protein GrpE [Pantoea ananatis AJ13355]
          Length = 193

 Score =  100 bits (249), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/138 (39%), Positives = 86/138 (62%), Gaps = 10/138 (7%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           RD  LR  AE+EN+RRRT+ + + A  +++ KFA ++L V D+L RAL+     LAN E 
Sbjct: 55  RDAQLRAQAEIENVRRRTEMDIEKAHKFALEKFANELLPVIDSLERALE-----LANKED 109

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVPANT 162
           +  +   S++EGIE+T + ++  + ++GV+ +      FNP +HQAM   E  D  P N 
Sbjct: 110 EKSA---SMVEGIELTLKSLLGAVRKFGVEVVGETGVPFNPEVHQAMSMMESEDFEP-NH 165

Query: 163 IIKVVQDGYAINERVLRP 180
           ++ V+Q GY +N R+LRP
Sbjct: 166 VMMVMQRGYTLNGRLLRP 183


>gi|3114752|emb|CAA76669.1| heat shock protein GrpE [Campylobacter jejuni]
          Length = 176

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 91/148 (61%), Gaps = 12/148 (8%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           +E +DKY+R  AE EN+++R ++EK  A +Y+   FA+D+L V D L  A+        N
Sbjct: 40  DELKDKYMRANAEFENIKKRMEKEKLSAMAYANESFAKDLLDVLDALEAAV--------N 91

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQK-FNPNMHQAMFEEPHDTVP 159
            E + E  LK + EG++ T    +  LE++GV  I  KD+K F+PN+H+AMF    +   
Sbjct: 92  VECQDEISLK-IKEGVQNTLDLFLKKLEKHGVALI--KDEKEFDPNLHEAMFHVDSENHQ 148

Query: 160 ANTIIKVVQDGYAINERVLRPALVSISK 187
           +  +++V+Q GY I +RV+RP  VS++K
Sbjct: 149 SGEVVQVLQKGYKIADRVIRPTKVSVAK 176


>gi|163855865|ref|YP_001630163.1| heat shock protein GrpE [Bordetella petrii DSM 12804]
 gi|226737112|sp|A9IGC0|GRPE_BORPD RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|163259593|emb|CAP41894.1| putative GrpE chaperone [Bordetella petrii]
          Length = 185

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 88/148 (59%), Gaps = 13/148 (8%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +++ LR  A+ EN+RRR   +   A+ + I  FA  ++ V D+L  AL            
Sbjct: 50  QEQVLRARADAENVRRRAQEDVSKARKFGIESFAESLVPVKDSLEAAL-----------A 98

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKI-DAKDQKFNPNMHQAMFEEPHDTVPANT 162
           + +  L++L EG+E+T +++    ER  +K+I  A+  KF+P++HQA+   P D  PANT
Sbjct: 99  QPDQTLEALREGVEVTLKQLTGAFERNLLKEIAPAQGDKFDPHLHQAISSVPSDQ-PANT 157

Query: 163 IIKVVQDGYAINERVLRPALVSISKGKT 190
           + +++Q GYAI +R LRPALV +S G+ 
Sbjct: 158 VAQLLQKGYAIADRTLRPALVIVSAGQA 185


>gi|269797942|ref|YP_003311842.1| GrpE protein [Veillonella parvula DSM 2008]
 gi|294791823|ref|ZP_06756971.1| co-chaperone GrpE [Veillonella sp. 6_1_27]
 gi|294793684|ref|ZP_06758821.1| co-chaperone GrpE [Veillonella sp. 3_1_44]
 gi|269094571|gb|ACZ24562.1| GrpE protein [Veillonella parvula DSM 2008]
 gi|294455254|gb|EFG23626.1| co-chaperone GrpE [Veillonella sp. 3_1_44]
 gi|294457053|gb|EFG25415.1| co-chaperone GrpE [Veillonella sp. 6_1_27]
          Length = 181

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 81/144 (56%), Gaps = 10/144 (6%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           +F ++Y R+ A+ EN +RRT++EK+    Y       D+L V DN  RA+ S        
Sbjct: 46  DFDNRYKRLQADFENFKRRTNQEKEQLAGYVKGDVLTDLLPVLDNFERAVQS-------- 97

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
              +E   K  ++G  M  + +M+ L ++G+  I+A  Q F+PN HQA+   P D   ++
Sbjct: 98  --PAEGEAKVFLDGFIMIHQNLMAMLSKHGLAVIEAVGQPFDPNFHQAIMRVPSDEYESD 155

Query: 162 TIIKVVQDGYAINERVLRPALVSI 185
           T+ +V+Q GY ++ R +RPA+V +
Sbjct: 156 TVCEVLQTGYTVDGRCIRPAMVKV 179


>gi|109947964|ref|YP_665192.1| heat shock protein GrpE [Helicobacter acinonychis str. Sheeba]
 gi|122973227|sp|Q17VY3|GRPE_HELAH RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|109715185|emb|CAK00193.1| GrpE protein [Helicobacter acinonychis str. Sheeba]
          Length = 186

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 65/187 (34%), Positives = 105/187 (56%), Gaps = 16/187 (8%)

Query: 7   EKNIDKEKNPSNANSSTAEEKS------EINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           E ++ +++  S  NS T E K       E  I E+   + +E  +KYLRV A+ EN+++R
Sbjct: 8   EHDLSQKELESCENSCTCEGKKQEASEKECEIKEDFELKYQEMHEKYLRVHADFENVKKR 67

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
            +R+K  A  Y+  K A D+L V D L  A  SA  D    +K+S     +L +G+E+T 
Sbjct: 68  LERDKSMALEYAYEKIALDLLPVIDALLGAHKSASGD----DKES-----ALTKGLELTM 118

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
            ++   L R+G++ I+  ++ F+PN H A+ +   +      I++V+Q GY    RVLRP
Sbjct: 119 EKLHEVLARHGIEGIECLEE-FDPNFHNAIMQVKSEEKENGKIVQVLQQGYKYKGRVLRP 177

Query: 181 ALVSISK 187
           A+VSI+K
Sbjct: 178 AMVSIAK 184


>gi|92115210|ref|YP_575138.1| GrpE protein [Chromohalobacter salexigens DSM 3043]
 gi|123265542|sp|Q1QSW9|GRPE_CHRSD RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|91798300|gb|ABE60439.1| GrpE protein [Chromohalobacter salexigens DSM 3043]
          Length = 210

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 89/145 (61%), Gaps = 10/145 (6%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D+  R  AE +N+RRR +++ + A+ +++ KF +++L V D+L +AL+S          
Sbjct: 74  KDQTARAAAEAQNVRRRAEQDVEKARKFALEKFVKELLPVVDSLEKALES---------- 123

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
             E   +   EG+ MT +  +  L ++GV+ +D + + F+P +H+AM   P+  V  NT+
Sbjct: 124 MQEGASEVHREGVSMTLKLQLDVLAKFGVEAVDPQGEPFDPQVHEAMTMVPNPEVEPNTV 183

Query: 164 IKVVQDGYAINERVLRPALVSISKG 188
           I+V+Q GY +N R++RPA+V +S+ 
Sbjct: 184 IEVMQKGYLLNGRLVRPAMVVVSQA 208


>gi|257882923|ref|ZP_05662576.1| heat shock protein grpE [Enterococcus faecium 1,231,502]
 gi|257884366|ref|ZP_05664019.1| heat shock protein grpE [Enterococcus faecium 1,231,501]
 gi|257889298|ref|ZP_05668951.1| heat shock protein grpE [Enterococcus faecium 1,231,410]
 gi|260560091|ref|ZP_05832269.1| heat shock protein GrpE [Enterococcus faecium C68]
 gi|261207421|ref|ZP_05922107.1| heat shock protein GrpE [Enterococcus faecium TC 6]
 gi|289566479|ref|ZP_06446904.1| co-chaperone GrpE [Enterococcus faecium D344SRF]
 gi|293552730|ref|ZP_06673394.1| co-chaperone GrpE [Enterococcus faecium E1039]
 gi|293560176|ref|ZP_06676678.1| co-chaperone GrpE [Enterococcus faecium E1162]
 gi|294621560|ref|ZP_06700726.1| co-chaperone GrpE [Enterococcus faecium U0317]
 gi|314939965|ref|ZP_07847165.1| co-chaperone GrpE [Enterococcus faecium TX0133a04]
 gi|314942574|ref|ZP_07849408.1| co-chaperone GrpE [Enterococcus faecium TX0133C]
 gi|314947473|ref|ZP_07850888.1| co-chaperone GrpE [Enterococcus faecium TX0082]
 gi|314952496|ref|ZP_07855497.1| co-chaperone GrpE [Enterococcus faecium TX0133A]
 gi|314992407|ref|ZP_07857833.1| co-chaperone GrpE [Enterococcus faecium TX0133B]
 gi|314996247|ref|ZP_07861306.1| co-chaperone GrpE [Enterococcus faecium TX0133a01]
 gi|257818581|gb|EEV45909.1| heat shock protein grpE [Enterococcus faecium 1,231,502]
 gi|257820204|gb|EEV47352.1| heat shock protein grpE [Enterococcus faecium 1,231,501]
 gi|257825658|gb|EEV52284.1| heat shock protein grpE [Enterococcus faecium 1,231,410]
 gi|260073926|gb|EEW62250.1| heat shock protein GrpE [Enterococcus faecium C68]
 gi|260078312|gb|EEW66017.1| heat shock protein GrpE [Enterococcus faecium TC 6]
 gi|289161744|gb|EFD09619.1| co-chaperone GrpE [Enterococcus faecium D344SRF]
 gi|291598865|gb|EFF29916.1| co-chaperone GrpE [Enterococcus faecium U0317]
 gi|291603110|gb|EFF33298.1| co-chaperone GrpE [Enterococcus faecium E1039]
 gi|291605848|gb|EFF35280.1| co-chaperone GrpE [Enterococcus faecium E1162]
 gi|313589569|gb|EFR68414.1| co-chaperone GrpE [Enterococcus faecium TX0133a01]
 gi|313593042|gb|EFR71887.1| co-chaperone GrpE [Enterococcus faecium TX0133B]
 gi|313595402|gb|EFR74247.1| co-chaperone GrpE [Enterococcus faecium TX0133A]
 gi|313598678|gb|EFR77523.1| co-chaperone GrpE [Enterococcus faecium TX0133C]
 gi|313640799|gb|EFS05379.1| co-chaperone GrpE [Enterococcus faecium TX0133a04]
 gi|313646023|gb|EFS10603.1| co-chaperone GrpE [Enterococcus faecium TX0082]
          Length = 187

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 87/148 (58%), Gaps = 10/148 (6%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           EE  DKYLR  AE+ N+  R   E++  Q Y     A+ +L   DNL RAL         
Sbjct: 49  EEMEDKYLRARAEIANMANRGKNEREQLQKYRSQDLAKKLLPSIDNLERAL--------- 99

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPH-DTVP 159
           + + S+     L +G+EM    + + LE  G++KI AK + F+PN+HQA+   P  +  P
Sbjct: 100 ATEVSDDQGAGLKKGVEMVLESLRNALEEEGIEKIPAKGEAFDPNLHQAVQTVPATEDTP 159

Query: 160 ANTIIKVVQDGYAINERVLRPALVSISK 187
           A+TI++V+Q+GY +++RVLRP +V +++
Sbjct: 160 ADTIVEVLQEGYKLHDRVLRPTMVIVAQ 187


>gi|158320267|ref|YP_001512774.1| GrpE protein [Alkaliphilus oremlandii OhILAs]
 gi|167008728|sp|A8MG50|GRPE_ALKOO RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|158140466|gb|ABW18778.1| GrpE protein [Alkaliphilus oremlandii OhILAs]
          Length = 187

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/149 (34%), Positives = 94/149 (63%), Gaps = 10/149 (6%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           Q E+   ++ R+ A+  N ++R ++EK D   Y+  K A D+L++ DN  RA+ S     
Sbjct: 49  QYEDIFSQFQRLQADFTNYKKRVEKEKGDIYLYANEKIALDLLNIIDNFERAIQS----- 103

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
             +EK  E+   SL++GI +  ++++ TL ++GV++I+A ++ F+ N+H A+ +E  +  
Sbjct: 104 --TEKTEEN--DSLLQGISLVYKQLLDTLTKHGVEEIEAMEKPFDMNLHYAVMQEESEG- 158

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISK 187
            +N +I V+Q GY I +R+LRPA+V +SK
Sbjct: 159 ASNYVIDVLQKGYKIKDRILRPAMVKVSK 187


>gi|86150163|ref|ZP_01068390.1| co-chaperone protein GrpE [Campylobacter jejuni subsp. jejuni
           CF93-6]
 gi|88597499|ref|ZP_01100733.1| co-chaperone protein GrpE [Campylobacter jejuni subsp. jejuni
           84-25]
 gi|218562386|ref|YP_002344165.1| heat shock protein GrpE [Campylobacter jejuni subsp. jejuni NCTC
           11168]
 gi|9297096|sp|O69297|GRPE_CAMJE RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|85839279|gb|EAQ56541.1| co-chaperone protein GrpE [Campylobacter jejuni subsp. jejuni
           CF93-6]
 gi|88190091|gb|EAQ94066.1| co-chaperone protein GrpE [Campylobacter jejuni subsp. jejuni
           84-25]
 gi|112360092|emb|CAL34886.1| heat shock protein GrpE [Campylobacter jejuni subsp. jejuni NCTC
           11168]
 gi|284926004|gb|ADC28356.1| heat shock protein GrpE [Campylobacter jejuni subsp. jejuni IA3902]
 gi|315928316|gb|EFV07632.1| grpE family protein [Campylobacter jejuni subsp. jejuni DFVF1099]
          Length = 176

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 91/148 (61%), Gaps = 12/148 (8%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           +E +DKY+R  AE EN+++R ++EK  A +Y+   FA+D+L V D L  A+        N
Sbjct: 40  DELKDKYMRANAEFENIKKRMEKEKLSAMAYANESFAKDLLDVLDALEAAV--------N 91

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQK-FNPNMHQAMFEEPHDTVP 159
            E + E  LK + EG++ T    +  LE++GV  I  KD+K F+PN+H+AMF    +   
Sbjct: 92  VECQDEISLK-IKEGVQNTLDLFLKKLEKHGVALI--KDEKEFDPNLHEAMFHVDSENHQ 148

Query: 160 ANTIIKVVQDGYAINERVLRPALVSISK 187
           +  +++V+Q GY I +RV+RP  VS++K
Sbjct: 149 SGEVVQVLQKGYKIADRVIRPTKVSVAK 176


>gi|311104373|ref|YP_003977226.1| heat shock protein GrpE [Achromobacter xylosoxidans A8]
 gi|310759062|gb|ADP14511.1| heat shock protein GrpE [Achromobacter xylosoxidans A8]
          Length = 185

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 56/166 (33%), Positives = 100/166 (60%), Gaps = 16/166 (9%)

Query: 25  EEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVS 84
           E +++++  + ++N   E +D+ LR+ AE EN+RRR   +   A+ + I  FA  ++ V 
Sbjct: 34  ELRAQLDAAQATVN---EQQDQLLRIRAEAENVRRRAQEDVSKARKFGIESFAESLVPVK 90

Query: 85  DNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI-DAKDQKFN 143
           D+L  AL            + +  +++L EG+E+T +++ +  ER  +K+I   +  KF+
Sbjct: 91  DSLEAAL-----------AQPDQTVETLREGVEVTLKQLTAGFERNLLKEIAPVQGDKFD 139

Query: 144 PNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
           P+ HQA+   P +  PANT+++++Q GYAI +R LRPALV +S G+
Sbjct: 140 PHQHQAISSIPAEQ-PANTVVQLLQKGYAIADRTLRPALVVVSAGQ 184


>gi|294616504|ref|ZP_06696285.1| co-chaperone GrpE [Enterococcus faecium E1636]
 gi|291590652|gb|EFF22380.1| co-chaperone GrpE [Enterococcus faecium E1636]
          Length = 187

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 87/148 (58%), Gaps = 10/148 (6%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           EE  DKYLR  AE+ N+  R   E++  Q Y     A+ +L   DNL RAL         
Sbjct: 49  EEMEDKYLRARAEIANMANRGKNEREQLQKYRSQDLAKKLLPSIDNLERAL--------- 99

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPH-DTVP 159
           + + S+     L +G+EM    + + LE  G++KI AK + F+PN+HQA+   P  +  P
Sbjct: 100 ATEVSDDQGAGLKKGVEMVLESLRNALEEEGIEKIPAKGEAFDPNLHQAVQTVPATEDAP 159

Query: 160 ANTIIKVVQDGYAINERVLRPALVSISK 187
           A+TI++V+Q+GY +++RVLRP +V +++
Sbjct: 160 ADTIVEVLQEGYKLHDRVLRPTMVIVAQ 187


>gi|238496875|ref|XP_002379673.1| mitochondrial co-chaperone GrpE, putative [Aspergillus flavus
           NRRL3357]
 gi|83769610|dbj|BAE59745.1| unnamed protein product [Aspergillus oryzae]
 gi|220694553|gb|EED50897.1| mitochondrial co-chaperone GrpE, putative [Aspergillus flavus
           NRRL3357]
          Length = 247

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/153 (33%), Positives = 89/153 (58%), Gaps = 7/153 (4%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           + +DKY+R +A+  NL+ RT R+  +A++++I +FA D+L   DN  RAL + P    NS
Sbjct: 93  DLKDKYVRSVADFLNLQERTKRDMDNARNFAIQRFAVDLLESIDNFDRALLAVPEAKLNS 152

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI-------DAKDQKFNPNMHQAMFEEP 154
            +     ++ L+ G++MT+  +M+ L+++G+++        D K QKF+PNMH+A F   
Sbjct: 153 NEPEHKDIRDLVSGLKMTQNVLMNALKKHGLERFDPSEPAEDGKTQKFDPNMHEATFMAK 212

Query: 155 HDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            +      I+     G+ +N RVLR A V + K
Sbjct: 213 AEGKENGDIMYTQSKGFRLNGRVLRAAKVGVVK 245


>gi|88812329|ref|ZP_01127579.1| GrpE protein [Nitrococcus mobilis Nb-231]
 gi|88790336|gb|EAR21453.1| GrpE protein [Nitrococcus mobilis Nb-231]
          Length = 206

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 51/161 (31%), Positives = 94/161 (58%), Gaps = 8/161 (4%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           E +  ++EE  +++LR  AE+EN  RR+ R+ + A  Y++ K A ++L V D+L   +  
Sbjct: 46  ESARTRAEENWNQFLRARAELENQHRRSQRDVEQAHRYALEKLANELLGVRDSLEMGVSV 105

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
           A        +++   +  L EG+E+T + +   +E++ + +++ + ++F+P  H+AM  +
Sbjct: 106 A--------QEAHGDVSKLREGVELTLKMLNQVMEKFDIHEVNPQGERFDPEKHEAMAAQ 157

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPT 194
                  NT+I VVQ GY +N+R+LRPALV +SK     P+
Sbjct: 158 ESAEHDPNTVIHVVQKGYLLNDRLLRPALVIVSKPDNHRPS 198


>gi|241764686|ref|ZP_04762698.1| GrpE protein [Acidovorax delafieldii 2AN]
 gi|241365856|gb|EER60505.1| GrpE protein [Acidovorax delafieldii 2AN]
          Length = 213

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 86/152 (56%), Gaps = 13/152 (8%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           +S +  D++LR  AE EN RRR + E   A+ + I  FA  +L V+D+L  AL       
Sbjct: 74  KSADLADQFLRAKAEAENARRRAEDEVSKARKFGIESFAESLLPVADSLDAAL------- 126

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID-AKDQKFNPNMHQAMFEEPHDT 157
                  E+  + L EG + T R+++S LER  V  I  A   KF+P+ HQA+   P D 
Sbjct: 127 ----AIKEASPQQLREGADATLRQLISALERNKVLAIQPAAGDKFDPHQHQAISVVPADQ 182

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISKGK 189
             ANT++ V+Q GY I +RVLRPALV++S  K
Sbjct: 183 -EANTVVAVLQKGYVIADRVLRPALVTVSAPK 213


>gi|303247468|ref|ZP_07333740.1| GrpE protein [Desulfovibrio fructosovorans JJ]
 gi|302491164|gb|EFL51056.1| GrpE protein [Desulfovibrio fructosovorans JJ]
          Length = 178

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 58/183 (31%), Positives = 99/183 (54%), Gaps = 20/183 (10%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFR-------DKYLRVIAEMENLRRRTDREKK 66
           KNP +A  +T EE    ++  E+  + E+ R       D+ LR +AE ENL++R  +EK+
Sbjct: 6   KNPEDA--ATPEETGATDLSPEA--EIEQLRAELAAEADRRLRTLAETENLKKRLLKEKE 61

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
           + Q Y+      ++L V D+L         DLA +  +     K  + G++MTR+  +  
Sbjct: 62  EFQKYATESLVSELLPVLDHL---------DLALAHGRGNEACKDFVVGVDMTRKAFVDI 112

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           L R+GV +  A+ + FNP  H+A+       +P + + +VVQ GY++  R+LRPA V ++
Sbjct: 113 LARHGVAEFGAEGEAFNPETHEALGMAARPDLPDDAVAQVVQKGYSLRGRLLRPAKVMVN 172

Query: 187 KGK 189
           K +
Sbjct: 173 KAQ 175


>gi|171915642|ref|ZP_02931112.1| GrpE protein [Verrucomicrobium spinosum DSM 4136]
          Length = 190

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 85/146 (58%), Gaps = 9/146 (6%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
           ++D  LR  AE++N R+R  RE +++++Y+ A   RD+  + DN    LD+A        
Sbjct: 50  WKDSALRTAAELDNYRKRVARETQESRAYANADLLRDLFPILDNFEMGLDAA-------- 101

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
            K+ES    +  G+ M RR++   L   GV+++  +  KF+PN+H+A+  E     P  T
Sbjct: 102 -KAESEKSMIYIGLSMVRRQLADFLRDAGVEEVPGQGAKFDPNVHEAVSHEASADQPEGT 160

Query: 163 IIKVVQDGYAINERVLRPALVSISKG 188
           I+KV++ G+ + +R+LR A VS+S G
Sbjct: 161 ILKVMRRGFKLKDRLLRAATVSVSSG 186


>gi|328952821|ref|YP_004370155.1| Protein grpE [Desulfobacca acetoxidans DSM 11109]
 gi|328453145|gb|AEB08974.1| Protein grpE [Desulfobacca acetoxidans DSM 11109]
          Length = 190

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 47/149 (31%), Positives = 89/149 (59%), Gaps = 9/149 (6%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           +++E  D++LR+ AEMEN +RR ++E+ D + ++     +++L + DNL         +L
Sbjct: 47  EAQEIHDRWLRLAAEMENFKRRQEKERADLRQFANESLIKELLPIVDNL---------EL 97

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
           A +  + +    +L EG+E   +  ++ L ++GV  I A   KF+P  H A+ ++  D+V
Sbjct: 98  AINHGRQQEPGSALQEGVENVLKGFLAALTKFGVTPIQALGDKFDPTFHNAVMQQEDDSV 157

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISK 187
              TII+ +Q GY ++ R+LRPA+V +++
Sbjct: 158 EDQTIIQELQKGYLLHNRLLRPAMVVVAR 186


>gi|2495085|sp|Q59240|GRPE_BACST RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|1568473|emb|CAA62238.1| grpE [Geobacillus stearothermophilus]
          Length = 221

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 85/143 (59%), Gaps = 9/143 (6%)

Query: 45  DKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKK 104
           ++YLR+ A+ EN RRRT +E + A+ Y       D+L   DN  RAL    ++  N +  
Sbjct: 88  NRYLRLYADFENFRRRTRQEMEAAEKYRAQSLVSDLLPALDNFERALK---IETENEQ-- 142

Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTII 164
                KS+++G+EM  R ++  L++ GV+ I+A  + F+P++HQA+ +        NT++
Sbjct: 143 ----AKSILQGMEMVYRSVLDALKKEGVEAIEAVGKPFDPHLHQAVMQVEDSNYEPNTVV 198

Query: 165 KVVQDGYAINERVLRPALVSISK 187
           +  Q GY + +RV+RPA+V +S+
Sbjct: 199 EEFQKGYKLKDRVIRPAMVKVSQ 221


>gi|310818501|ref|YP_003950859.1| Molecular chaperone GrpE [Stigmatella aurantiaca DW4/3-1]
 gi|309391573|gb|ADO69032.1| Molecular chaperone GrpE (heat shock protein) [Stigmatella
           aurantiaca DW4/3-1]
          Length = 291

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/138 (37%), Positives = 80/138 (57%), Gaps = 9/138 (6%)

Query: 45  DKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKK 104
           ++ LR  A++EN ++R  +EK++ Q +   K  +D+L V DNL RA+D+A         K
Sbjct: 105 ERSLRAAADLENYKKRAQKEKEEVQKFGSEKLLKDILPVMDNLDRAMDAA--------AK 156

Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTII 164
           S     S  +G+ MTR+    TL R+GVK   A+ Q F+P +H+AM +     VPA  + 
Sbjct: 157 SPD-FTSFQKGVAMTRKSFEDTLSRHGVKAFSAQGQAFDPRLHEAMSQAETADVPAGHVA 215

Query: 165 KVVQDGYAINERVLRPAL 182
             V  GY +NER++RPA+
Sbjct: 216 YEVLRGYHLNERLIRPAM 233


>gi|300175194|emb|CBK20505.2| Nucleotide exchange factor Mge1 [Blastocystis hominis]
          Length = 233

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/149 (33%), Positives = 87/149 (58%), Gaps = 2/149 (1%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           E S  + ++ +DK +R++AEM+N+R    R+  + ++Y++  F +++L V D LS A+ S
Sbjct: 73  ESSEKELKDLKDKNMRLLAEMQNVRTIAKRDVLNERTYALQSFGKNLLCVCDYLSMAITS 132

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
            P D    E  ++  L SL +G+ MT++E+   L   G+ K       FNPN+H+AMF+ 
Sbjct: 133 VPKDKVEGE-AADKTLVSLYQGVVMTQKELDKVLNAQGITKYGVVGDDFNPNIHEAMFQM 191

Query: 154 P-HDTVPANTIIKVVQDGYAINERVLRPA 181
           P  +    N++ +++  GY   +RVLRP 
Sbjct: 192 PLTEGAKPNSLGQIITAGYMFKQRVLRPC 220


>gi|238019345|ref|ZP_04599771.1| hypothetical protein VEIDISOL_01209 [Veillonella dispar ATCC 17748]
 gi|237864044|gb|EEP65334.1| hypothetical protein VEIDISOL_01209 [Veillonella dispar ATCC 17748]
          Length = 181

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 81/144 (56%), Gaps = 10/144 (6%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           +F ++Y R+ A+ EN +RRT++EK+    Y       D+L V DN  RA+ S        
Sbjct: 46  DFDNRYKRLQADFENFKRRTNQEKEQLAGYVKGDVLTDLLPVLDNFERAVQS-------- 97

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
              +E   K  ++G  M  + +M+ L ++G+  IDA  + F+PN HQA+   P D   ++
Sbjct: 98  --PAEGDAKVFLDGFIMIHQNLMAMLSKHGLAVIDAVGKPFDPNFHQAIMRVPSDEYESD 155

Query: 162 TIIKVVQDGYAINERVLRPALVSI 185
           T+ +V+Q GY ++ R +RPA+V +
Sbjct: 156 TVCEVLQTGYTVDGRCIRPAMVKV 179


>gi|91773289|ref|YP_565981.1| GrpE protein [Methanococcoides burtonii DSM 6242]
 gi|91712304|gb|ABE52231.1| GrpE protein [Methanococcoides burtonii DSM 6242]
          Length = 191

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 94/159 (59%), Gaps = 13/159 (8%)

Query: 38  NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD 97
           +Q  E  ++ +R  AE EN R R+ REK++ + +++ +   ++L V DN  RAL+SA   
Sbjct: 46  SQIAELNEQIMRQRAEFENFRNRSLREKEEFRKFALEEIMVELLEVRDNFDRALESA--- 102

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
                KK++ V  S+IEG+EM  ++  S LE+ G+K ID + ++F+P+ H+AM       
Sbjct: 103 -----KKADDV-NSIIEGVEMVFKQFTSILEKEGLKMIDCEGKEFDPHFHEAMMHVQTTE 156

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEE 196
                I+ V + GY +N +V+R A+V+++    QNP EE
Sbjct: 157 HADQHIVDVCKAGYELNSKVIRHAMVTVA----QNPDEE 191


>gi|212533907|ref|XP_002147110.1| mitochondrial co-chaperone GrpE, putative [Penicillium marneffei
           ATCC 18224]
 gi|210072474|gb|EEA26563.1| mitochondrial co-chaperone GrpE, putative [Penicillium marneffei
           ATCC 18224]
          Length = 247

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 54/152 (35%), Positives = 86/152 (56%), Gaps = 6/152 (3%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E +DKY+R +A+  NL+ RT R+  +A+S++I KFA D+L   DN  RAL   P D    
Sbjct: 94  ELKDKYIRSVADFRNLQERTKRDMDNARSFAIQKFAVDLLESIDNFDRALSVVPADKLTD 153

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI------DAKDQKFNPNMHQAMFEEPH 155
              +   L  L +G++MT   +++TL+++G+++       D K  KF+P +H+A F    
Sbjct: 154 GADANKDLLELHQGLKMTESILLNTLKKHGLERFDPSDATDGKTSKFDPKIHEATFMAKV 213

Query: 156 DTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +      I+ V   GY++N RVLR A V + K
Sbjct: 214 EGKENGDIMFVQSKGYSLNGRVLRAAKVGVVK 245


>gi|313893370|ref|ZP_07826942.1| co-chaperone GrpE [Veillonella sp. oral taxon 158 str. F0412]
 gi|313442011|gb|EFR60431.1| co-chaperone GrpE [Veillonella sp. oral taxon 158 str. F0412]
          Length = 177

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 81/144 (56%), Gaps = 10/144 (6%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           +F ++Y R+ A+ EN +RRT++EK+    Y       D+L V DN  RA+ S        
Sbjct: 42  DFDNRYKRLQADFENFKRRTNQEKEQLAGYVKGDVLTDLLPVLDNFERAVQS-------- 93

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
              +E   K  ++G  M  + +M+ L ++G+  I+A  Q F+PN HQA+   P D   ++
Sbjct: 94  --PAEGEAKLFLDGFIMIHQNLMAMLSKHGLAVIEAVGQPFDPNFHQAIMRVPSDEFESD 151

Query: 162 TIIKVVQDGYAINERVLRPALVSI 185
           T+ +V+Q GY ++ R +RPA+V +
Sbjct: 152 TVCEVLQTGYTVDGRCIRPAMVKV 175


>gi|153951449|ref|YP_001398315.1| co-chaperone protein GrpE [Campylobacter jejuni subsp. doylei
           269.97]
 gi|166215259|sp|A7H485|GRPE_CAMJD RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|152938895|gb|ABS43636.1| co-chaperone protein GrpE [Campylobacter jejuni subsp. doylei
           269.97]
          Length = 176

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 89/147 (60%), Gaps = 10/147 (6%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           +E +DKY+R  AE EN+++R ++EK  A +Y+   FA+D+L V D L  A+        N
Sbjct: 40  DELKDKYMRANAEFENIKKRMEKEKLSAMAYANESFAKDLLDVLDALEAAI--------N 91

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
            E   E  LK + EG++ T    +  LE+YGV  I  ++++F+PN+H+AMF    +   +
Sbjct: 92  VECHDEISLK-IKEGVQNTLDLFLKKLEKYGVTLI-KEEKEFDPNLHEAMFHVDGENHQS 149

Query: 161 NTIIKVVQDGYAINERVLRPALVSISK 187
             ++ V+Q GY I +RV+RP  VS++K
Sbjct: 150 GEVVTVLQKGYKIADRVIRPTKVSVAK 176


>gi|296123167|ref|YP_003630945.1| GrpE protein [Planctomyces limnophilus DSM 3776]
 gi|296015507|gb|ADG68746.1| GrpE protein [Planctomyces limnophilus DSM 3776]
          Length = 173

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 53/172 (30%), Positives = 97/172 (56%), Gaps = 9/172 (5%)

Query: 15  NPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIA 74
           NP N  ++T E  + +N+ +    + ++F++K+ R +A++EN RRR  +E ++ + Y  A
Sbjct: 5   NPENTENTT-ESSTSVNMVQALAEERDQFKEKWARSVADLENYRRRVQKEAEEERKYGAA 63

Query: 75  KFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKK 134
            F R +L   DNL RA+ +A        K   + L+ L++G+EM  ++  +     G   
Sbjct: 64  TFLRTVLPGFDNLQRAILAA--------KSPAAKLEDLVKGVEMVSQQFETLFAGMGAVV 115

Query: 135 IDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           I    + F+PN H+A+ + P    P  T+I+ V+ G+ +++RV+RPA V +S
Sbjct: 116 IKTVGEPFDPNRHEAITQVPSADYPPMTVIQEVERGFTLHDRVIRPAKVIVS 167


>gi|206578715|ref|YP_002237048.1| co-chaperone GrpE [Klebsiella pneumoniae 342]
 gi|288934011|ref|YP_003438070.1| GrpE protein [Klebsiella variicola At-22]
 gi|290510929|ref|ZP_06550298.1| co-chaperone GrpE [Klebsiella sp. 1_1_55]
 gi|226737145|sp|B5XVJ9|GRPE_KLEP3 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|206567773|gb|ACI09549.1| co-chaperone GrpE [Klebsiella pneumoniae 342]
 gi|288888740|gb|ADC57058.1| GrpE protein [Klebsiella variicola At-22]
 gi|289775922|gb|EFD83921.1| co-chaperone GrpE [Klebsiella sp. 1_1_55]
          Length = 196

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/146 (35%), Positives = 90/146 (61%), Gaps = 8/146 (5%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           R+  LR  A+ +NLRRRT+++ + A  +++ KF  ++L V D+L RAL+ A  D AN + 
Sbjct: 59  REVMLRAKADEDNLRRRTEQDIEKAHKFALEKFVNELLPVIDSLDRALEVA--DKANPD- 115

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
                L  ++EGIE+T + M+  + ++GV+ I   +   +PN+HQA+     + V A  +
Sbjct: 116 -----LAPMVEGIELTLKSMLDVVRKFGVEVIADTNVPLDPNVHQAIAMVESEDVAAGNV 170

Query: 164 IKVVQDGYAINERVLRPALVSISKGK 189
           + V+Q GY +N R +R A+V+++K K
Sbjct: 171 LAVMQKGYTLNGRTIRAAMVTVAKAK 196


>gi|332637920|ref|ZP_08416783.1| HSP-70 Cofactor HSP20 [Weissella cibaria KACC 11862]
          Length = 180

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 56/145 (38%), Positives = 84/145 (57%), Gaps = 10/145 (6%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E  DKYLR  AEM+N++ R  +E+  A  Y+  K A+ +L   DNL RAL     D A  
Sbjct: 43  EAEDKYLRAHAEMQNMQTRFAKEQAQAVKYASQKLAKSVLPALDNLERALQVEADDDAAK 102

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHD-TVPA 160
           + K+         G+EM  + + S LE   +K + A+ + F+PN HQA+   P D   PA
Sbjct: 103 QIKT---------GVEMVYKTLASALEDNDIKAVGAEGEPFDPNFHQAIQSVPADEDHPA 153

Query: 161 NTIIKVVQDGYAINERVLRPALVSI 185
           +TI +V+Q GY + +RV+RPA+V++
Sbjct: 154 DTIAQVLQKGYVLADRVIRPAMVAV 178


>gi|108764063|ref|YP_634789.1| co-chaperone GrpE [Myxococcus xanthus DK 1622]
 gi|115311599|sp|P95333|GRPE_MYXXD RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|108467943|gb|ABF93128.1| co-chaperone GrpE [Myxococcus xanthus DK 1622]
          Length = 255

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 91/153 (59%), Gaps = 9/153 (5%)

Query: 35  ESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSA 94
           E+  +++E +++ +R  A++EN R+R  +EK++ Q +   K  +D+L V DNL RA+D+A
Sbjct: 71  EAHERAKEAQERTVRHAADLENYRKRAQKEKEEVQRFGSEKLLKDLLPVMDNLDRAIDAA 130

Query: 95  PLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEP 154
                    KS   L S  +G+ MTR+     L R+GVK   AK Q F+P +H+A+ +  
Sbjct: 131 --------AKSPD-LDSFEKGVAMTRKSFEDALGRHGVKGFSAKGQVFDPRVHEAIQQVE 181

Query: 155 HDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
              VPA  +   V  G+ +NER++RPA+V +++
Sbjct: 182 TADVPAGHVAYEVVRGFYLNERLVRPAMVVVAR 214


>gi|171321092|ref|ZP_02910071.1| GrpE protein [Burkholderia ambifaria MEX-5]
 gi|171093631|gb|EDT38789.1| GrpE protein [Burkholderia ambifaria MEX-5]
          Length = 181

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 84/148 (56%), Gaps = 12/148 (8%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E ++ YLR  AE EN+RRR   +   A  ++I  FA  +L V D+L  A+     D+   
Sbjct: 46  ELQESYLRAKAETENVRRRAQDDVSKAHKFAIESFAEHLLPVLDSLEAAVGDTSGDITKV 105

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
                       EG+E+T R++ S LE+  V  I+   +KF+P+ HQA+   P +  P N
Sbjct: 106 R-----------EGVELTLRQLTSALEKGRVVAINPVGEKFDPHQHQAISMVPAEQEP-N 153

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGK 189
           T++ V+Q GY I +RVLRPALV++++ K
Sbjct: 154 TVVTVLQKGYMIADRVLRPALVTVAQPK 181


>gi|124514674|gb|EAY56186.1| putative GrpE protein [Leptospirillum rubarum]
          Length = 189

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 93/158 (58%), Gaps = 7/158 (4%)

Query: 34  EESLNQSEE--FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRAL 91
           EE+  + EE  +R+KY+R++A+ +N R+R  RE+++++ ++     +  L + DNL RAL
Sbjct: 31  EEAAKEGEENPWREKYIRLLADFDNYRKRVAREQEESRKFANESLLKAFLPILDNLERAL 90

Query: 92  DSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMF 151
                        S   LK+L +G+++T ++ +  LE+  V ++ A+   F+PN+H+AM 
Sbjct: 91  ----FHFGKVSSPSPE-LKALADGVKLTEKQFLELLEKNHVTRVPAQGSVFDPNVHEAMG 145

Query: 152 EEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
             P +      I+ V Q GY +  R+LRPALV++++ K
Sbjct: 146 FSPSEGFEEGAIVDVYQQGYMMQGRLLRPALVTVAQKK 183


>gi|258565469|ref|XP_002583479.1| GRPE protein [Uncinocarpus reesii 1704]
 gi|237907180|gb|EEP81581.1| GRPE protein [Uncinocarpus reesii 1704]
          Length = 244

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 55/145 (37%), Positives = 85/145 (58%), Gaps = 10/145 (6%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD-LAN 100
           E +DKYLR +A+  NL+ RT R+   A+S++I KF  D++   DN  RAL++ P D L N
Sbjct: 102 ELKDKYLRSVADFRNLQERTRRDVDSARSFAIQKFGADLIESIDNFERALEAVPSDKLRN 161

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKK------IDAKDQKFNPNMHQAMFEEP 154
            E K    L  L +G++MT + +M+TL+ + +++      +D K QKF+PN H+A F  P
Sbjct: 162 GENKD---LAELYDGLKMTEKVIMNTLKTHRLERFDPSELVDGKPQKFDPNRHEATFMAP 218

Query: 155 HDTVPANTIIKVVQDGYAINERVLR 179
                   I+ V   G+ +N R+LR
Sbjct: 219 APGKEDGEILHVQTKGFILNGRILR 243


>gi|170691351|ref|ZP_02882516.1| GrpE protein [Burkholderia graminis C4D1M]
 gi|170143556|gb|EDT11719.1| GrpE protein [Burkholderia graminis C4D1M]
          Length = 195

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 85/148 (57%), Gaps = 12/148 (8%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E ++ +LR  AE EN+RRR   +   A  ++I  FA  +L V D+L  A+  +  DLA  
Sbjct: 60  ELQESFLRAKAETENVRRRAQEDVAKAHKFAIESFAEHLLPVIDSLEAAVAHSSDDLAK- 118

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
                     + EG+E+T R++   LE+  V  ++   +KF+P+ HQA+   P D  P N
Sbjct: 119 ----------VREGVELTLRQLTGALEKGRVVALNPVGEKFDPHRHQAISMVPADQEP-N 167

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGK 189
           T++ V+Q G+ I +RVLRPALV+++  K
Sbjct: 168 TVVAVLQKGFVIADRVLRPALVTVAAPK 195


>gi|310643078|ref|YP_003947836.1| grpe protein [Paenibacillus polymyxa SC2]
 gi|309248028|gb|ADO57595.1| GrpE protein [Paenibacillus polymyxa SC2]
          Length = 190

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 89/151 (58%), Gaps = 15/151 (9%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           ++EE + ++LR  A+ +N RRRT +EK+D   Y+  K   +++ V DN  RAL       
Sbjct: 51  EAEEHQQRFLRAQADFDNFRRRTLKEKEDLAKYASMKLVTELVPVLDNFERAL------- 103

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFE---EPH 155
           A + + +ES  +S  +G+EM  R+  S L+  GV  ++A  Q FNP+ HQA+ +   E H
Sbjct: 104 ATASQGAES--ESFTKGVEMIFRQFESVLQAEGVTAMNAVGQPFNPDFHQAIMQVESEEH 161

Query: 156 DTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           D      +++ VQ GY + ++VLRPA+V +S
Sbjct: 162 DE---GIVVEEVQKGYMLKDKVLRPAMVKVS 189


>gi|115350698|ref|YP_772537.1| heat shock protein GrpE [Burkholderia ambifaria AMMD]
 gi|170700492|ref|ZP_02891497.1| GrpE protein [Burkholderia ambifaria IOP40-10]
 gi|172059727|ref|YP_001807379.1| heat shock protein GrpE [Burkholderia ambifaria MC40-6]
 gi|115280686|gb|ABI86203.1| GrpE protein [Burkholderia ambifaria AMMD]
 gi|170134616|gb|EDT02939.1| GrpE protein [Burkholderia ambifaria IOP40-10]
 gi|171992244|gb|ACB63163.1| GrpE protein [Burkholderia ambifaria MC40-6]
          Length = 181

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 84/148 (56%), Gaps = 12/148 (8%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E ++ YLR  AE EN+RRR   +   A  ++I  FA  +L V D+L  A+     D+   
Sbjct: 46  ELQESYLRAKAETENVRRRAQDDVSKAHKFAIESFAEHLLPVLDSLEAAVGDTSGDITKV 105

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
                       EG+E+T R++ S LE+  V  I+   +KF+P+ HQA+   P +  P N
Sbjct: 106 R-----------EGVELTLRQLTSALEKGRVVAINPVGEKFDPHQHQAISMVPAEQEP-N 153

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGK 189
           T++ V+Q GY I +RVLRPALV++++ K
Sbjct: 154 TVVTVLQKGYMIADRVLRPALVTVAQPK 181


>gi|71906563|ref|YP_284150.1| GrpE protein [Dechloromonas aromatica RCB]
 gi|123733335|sp|Q47HK1|GRPE_DECAR RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|71846184|gb|AAZ45680.1| GrpE protein [Dechloromonas aromatica RCB]
          Length = 184

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 53/153 (34%), Positives = 89/153 (58%), Gaps = 16/153 (10%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           ++ E  D +LR  AE EN+RRR   +   A  +++ KFA ++L+V D+L  AL       
Sbjct: 46  KAAEHYDAWLRAKAEGENIRRRAQDDISKAHKFAVEKFAGELLAVKDSLEAAL------- 98

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQA--MFEEPHD 156
                  E  + S   G+E+T ++++S  ++  + +++   +KF+P+ HQA  M +   +
Sbjct: 99  ----AVQEQTVDSFKSGVELTLKQLVSAFDKNALNEVNPAGEKFDPHKHQAIGMVDSEQE 154

Query: 157 TVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
              ANT++ V+Q GY I +RVLRPALV ++KGK
Sbjct: 155 ---ANTVVTVLQKGYMIADRVLRPALVMVAKGK 184


>gi|58584790|ref|YP_198363.1| molecular chaperone GrpE (heat shock protein) [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
 gi|75507962|sp|Q5GSA3|GRPE_WOLTR RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|58419106|gb|AAW71121.1| Molecular chaperone GrpE (heat shock protein) [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 182

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 58/171 (33%), Positives = 97/171 (56%), Gaps = 21/171 (12%)

Query: 20  NSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARD 79
           NS  A++  E+   +E   Q E   D   R +A+ EN++R   ++  DA  Y++ KFARD
Sbjct: 27  NSKQADDLDELKTLKERAVQLE---DHLRRAVADNENVKRIMQKQISDANDYAVTKFARD 83

Query: 80  MLSVSDNLSRALDSAPLDLANSEKKSESVLKS---LIEGIEMTRREMMSTLERYGVKKID 136
           M+   DNL R ++               +LK    + EGI++  +++M+ L+++G+++ID
Sbjct: 84  MIDSCDNLKRVME---------------ILKDDDPVHEGIKVAYKKIMNDLKKHGIEEID 128

Query: 137 AKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
              + F+ N+HQA+ E   +     TI++V+Q GY I  R+LRPA+V ISK
Sbjct: 129 PIGELFDSNLHQAVVEREDNEKKTGTIVEVLQTGYTIKNRLLRPAMVIISK 179


>gi|317146906|ref|XP_001821747.2| hypothetical protein AOR_1_500014 [Aspergillus oryzae RIB40]
          Length = 317

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/153 (33%), Positives = 89/153 (58%), Gaps = 7/153 (4%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           + +DKY+R +A+  NL+ RT R+  +A++++I +FA D+L   DN  RAL + P    NS
Sbjct: 163 DLKDKYVRSVADFLNLQERTKRDMDNARNFAIQRFAVDLLESIDNFDRALLAVPEAKLNS 222

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI-------DAKDQKFNPNMHQAMFEEP 154
            +     ++ L+ G++MT+  +M+ L+++G+++        D K QKF+PNMH+A F   
Sbjct: 223 NEPEHKDIRDLVSGLKMTQNVLMNALKKHGLERFDPSEPAEDGKTQKFDPNMHEATFMAK 282

Query: 155 HDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            +      I+     G+ +N RVLR A V + K
Sbjct: 283 AEGKENGDIMYTQSKGFRLNGRVLRAAKVGVVK 315


>gi|307546750|ref|YP_003899229.1| molecular chaperone GrpE [Halomonas elongata DSM 2581]
 gi|307218774|emb|CBV44044.1| K03687 molecular chaperone GrpE [Halomonas elongata DSM 2581]
          Length = 259

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 102/174 (58%), Gaps = 19/174 (10%)

Query: 23  TAEEKSEINIPE--------ESLNQS-EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
           T EE+   + PE        E L QS  + +D+ LR  AE +N+RRR ++E + A+ +++
Sbjct: 93  TQEERESTDNPEAEVLAAKVEELEQSLADAKDQSLRAAAEAQNVRRRAEQEAEKARKFAL 152

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
            KF +++L V D+L +ALD      A  E  SE+      EG+ MT +  +  L ++GV+
Sbjct: 153 EKFVKELLPVVDSLEKALD------AMQEGASETHR----EGVSMTLKLQLDVLGKFGVE 202

Query: 134 KIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            +D   + F+P  H+A+   P+  +  N++++V+Q GY +N R++RPA+V +S+
Sbjct: 203 VVDPTGEPFDPQYHEAVTMVPNAELEPNSVMEVIQKGYLLNGRLVRPAMVVVSQ 256


>gi|212697101|ref|ZP_03305229.1| hypothetical protein ANHYDRO_01666 [Anaerococcus hydrogenalis DSM
           7454]
 gi|212675876|gb|EEB35483.1| hypothetical protein ANHYDRO_01666 [Anaerococcus hydrogenalis DSM
           7454]
          Length = 181

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 90/157 (57%), Gaps = 12/157 (7%)

Query: 31  NIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRA 90
           N+ E+  N   E+++KY R++A+  N ++R ++ + D + ++ +    ++L V DN  RA
Sbjct: 37  NVEEDLSNDDNEYKEKYQRLLADFTNFKKREEKARNDFKKFASSNLIEELLPVLDNFDRA 96

Query: 91  LDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM 150
           L            K +    S ++GI MTR  +   LE+ G+++I++   +F+PN H A 
Sbjct: 97  L------------KDQDKEDSFVQGIIMTRDSLWKVLEKEGLEEIESDGVEFDPNFHHAF 144

Query: 151 FEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
             E ++   +N II+  Q GY +N+RV+RP++V ++K
Sbjct: 145 QTEENEDFKSNYIIETYQKGYKLNDRVIRPSMVKVAK 181


>gi|56416382|ref|YP_153456.1| GRPE protein [Anaplasma marginale str. St. Maries]
 gi|56387614|gb|AAV86201.1| GRPE protein [Anaplasma marginale str. St. Maries]
          Length = 164

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 51/147 (34%), Positives = 87/147 (59%), Gaps = 12/147 (8%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           E  R++    +A+ +NLRR   +E ++A++ SI+ F RD+++  DNL  +L +   D   
Sbjct: 24  EHLRNQLRLAVADSKNLRRLVQKEVEEAKTLSISDFVRDLIASCDNLEASLKNLSDD--- 80

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
                     ++  G++MT   +MSTL  +GV ++    ++F+P  H+A+ +   D+ PA
Sbjct: 81  ---------DNVHTGVKMTWDGLMSTLSSHGVSRVSPLGEQFDPRFHKAVTQAVDDSKPA 131

Query: 161 NTIIKVVQDGYAINERVLRPALVSISK 187
            T+++VVQ GY I  +VLRPALV +SK
Sbjct: 132 GTVLEVVQAGYIIQTKVLRPALVIVSK 158


>gi|157738396|ref|YP_001491080.1| heat shock protein GrpE [Arcobacter butzleri RM4018]
 gi|315636691|ref|ZP_07891921.1| chaperone GrpE [Arcobacter butzleri JV22]
 gi|167008729|sp|A8EWT7|GRPE_ARCB4 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|157700250|gb|ABV68410.1| heat shock protein GrpE [Arcobacter butzleri RM4018]
 gi|315479006|gb|EFU69709.1| chaperone GrpE [Arcobacter butzleri JV22]
          Length = 185

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 50/140 (35%), Positives = 90/140 (64%), Gaps = 6/140 (4%)

Query: 47  YLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSE 106
           +LR  A+ EN+++R ++EK  A  Y+  KFA+D+L+  D L  AL+SA  D+  +E    
Sbjct: 51  FLRAYADFENMKKRLEKEKYQAIDYASEKFAKDLLTPLDTLEMALNSAKADVDANE---- 106

Query: 107 SVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKV 166
            +L+ L EGIE+T +  ++T E++ + K++  D +F+PN+H A+ +       +  I++ 
Sbjct: 107 -LLEKLKEGIELTLKNFITTFEKHNITKVET-DGEFDPNVHNAVMQVDSAEHNSGQIVQE 164

Query: 167 VQDGYAINERVLRPALVSIS 186
           +Q GY + +R+LRP++VSI+
Sbjct: 165 LQKGYVLKDRLLRPSMVSIA 184


>gi|134294822|ref|YP_001118557.1| heat shock protein GrpE [Burkholderia vietnamiensis G4]
 gi|226737118|sp|A4JBR9|GRPE_BURVG RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|134137979|gb|ABO53722.1| GrpE protein [Burkholderia vietnamiensis G4]
          Length = 181

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 56/148 (37%), Positives = 84/148 (56%), Gaps = 12/148 (8%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E ++ YLR  AE EN+RRR   +   A  ++I  FA  +L V D+L  A      D+A  
Sbjct: 46  ELQESYLRAKAETENVRRRAQDDVSKAHKFAIESFAEHLLPVLDSLEAAAVDTSGDIAKV 105

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
                       EG+E+T R++ S LE+  V  I+   +KF+P+ HQA+   P +  P N
Sbjct: 106 R-----------EGVELTLRQLTSALEKGRVVAINPVGEKFDPHQHQAISMVPAEQEP-N 153

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGK 189
           T++ V+Q GY I +RVLRPALV++++ K
Sbjct: 154 TVVAVLQKGYMIADRVLRPALVTVAQPK 181


>gi|307728532|ref|YP_003905756.1| GrpE protein [Burkholderia sp. CCGE1003]
 gi|307583067|gb|ADN56465.1| GrpE protein [Burkholderia sp. CCGE1003]
          Length = 194

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 84/148 (56%), Gaps = 12/148 (8%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E ++ +LR  AE EN+RRR   +   A  ++I  FA  +L V D+L  A+  +  DLA  
Sbjct: 59  ELQESFLRAKAETENVRRRAQEDVAKAHKFAIENFAEHLLPVVDSLEAAVAHSSDDLAKV 118

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
                       EG+E+T R++   LE+  V  ++   +KF+P+ HQA+   P D  P N
Sbjct: 119 R-----------EGVELTLRQLTGALEKGRVVALNPVGEKFDPHRHQAISMVPADQEP-N 166

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGK 189
           T++ V+Q G+ I +RVLRPALV+++  K
Sbjct: 167 TVVAVLQKGFVIADRVLRPALVTVAAPK 194


>gi|319792565|ref|YP_004154205.1| grpe protein [Variovorax paradoxus EPS]
 gi|315595028|gb|ADU36094.1| GrpE protein [Variovorax paradoxus EPS]
          Length = 176

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 85/152 (55%), Gaps = 18/152 (11%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRAL---DSAPLDL 98
           E  D+YLR  A+++N RRR D E   A+ +++  FA  +L V+D+L   L   D+ P   
Sbjct: 39  ELADQYLRAQADVQNARRRADDEITKARKFAVEAFAESLLPVTDSLEAGLAIKDATP--- 95

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI-DAKDQKFNPNMHQAMFEEPHDT 157
                      + + EG E T R++ S LER  V ++  A   +F+P+ HQA+   P   
Sbjct: 96  -----------EQIREGAEATLRQLKSALERNKVIEVAPAAGTRFDPHQHQAISVVPAPE 144

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISKGK 189
              NT++ V+Q GY INERVLRPALV++S  K
Sbjct: 145 QEPNTVVSVLQKGYTINERVLRPALVTVSAPK 176


>gi|225164491|ref|ZP_03726746.1| Molecular chaperone GrpE (heat shock protein)-like protein
           [Opitutaceae bacterium TAV2]
 gi|224800906|gb|EEG19247.1| Molecular chaperone GrpE (heat shock protein)-like protein
           [Opitutaceae bacterium TAV2]
          Length = 223

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 53/145 (36%), Positives = 85/145 (58%), Gaps = 9/145 (6%)

Query: 45  DKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKK 104
           D+Y+R +A++EN RRRT REK + + ++ A+   D+L V DNL   L +A L  A++E  
Sbjct: 62  DRYMRALADLENFRRRTIREKDELRQFAAARVIEDLLPVIDNLGFGLAAAKLPTASTE-- 119

Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKID-AKDQKFNPNMHQAMFEEPHDTVPANTI 163
                 S+  GI +   +  + L  +G+K+I+ A    F+PN  +A+   P   VP   +
Sbjct: 120 ------SVASGIVLVVDQFKNALGNHGLKEINPAVGDGFDPNQEEAVSHLPSPDVPEGKV 173

Query: 164 IKVVQDGYAINERVLRPALVSISKG 188
           + VV+ GY++N R+LRPA V +S G
Sbjct: 174 LNVVRIGYSLNGRLLRPATVVVSSG 198


>gi|307721529|ref|YP_003892669.1| GrpE protein [Sulfurimonas autotrophica DSM 16294]
 gi|306979622|gb|ADN09657.1| GrpE protein [Sulfurimonas autotrophica DSM 16294]
          Length = 177

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 53/145 (36%), Positives = 90/145 (62%), Gaps = 6/145 (4%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E +DKY RV A+ +N+++R +REK  A  Y+  KFA+DM+ V D+L  AL S     A+S
Sbjct: 38  ELKDKYARVHADFDNIKKRLEREKYTAVEYANEKFAKDMIPVVDSLEMALKS-----ADS 92

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
           +   + ++K L EGIE+T ++  + LE++GV  + + ++ F+PN+H A+     + V + 
Sbjct: 93  DADPQELMKKLKEGIELTLKQFTTALEKHGVTMV-SHEEPFDPNIHNAVQSVDSENVESG 151

Query: 162 TIIKVVQDGYAINERVLRPALVSIS 186
            I++  Q GY   +R LR A+V ++
Sbjct: 152 EIVQTFQRGYKYKDRPLREAMVVVA 176


>gi|222054205|ref|YP_002536567.1| GrpE protein [Geobacter sp. FRC-32]
 gi|221563494|gb|ACM19466.1| GrpE protein [Geobacter sp. FRC-32]
          Length = 196

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 83/144 (57%), Gaps = 11/144 (7%)

Query: 45  DKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKK 104
           DKYLR  A++EN R+R  +EK++   Y       ++L   DN+ RAL+ A          
Sbjct: 63  DKYLRERADLENYRKRVQKEKEELLKYGNESLILEILPAIDNMERALEHA---------- 112

Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTI 163
           SE  + ++IEGI++T   + STL+++GV  + +     F+P  HQAM +        NTI
Sbjct: 113 SEESMAAIIEGIKLTLSMLQSTLKKFGVTPVQSGPGTAFDPAFHQAMSQVESAEQEPNTI 172

Query: 164 IKVVQDGYAINERVLRPALVSISK 187
           +   Q GY +NER+LRPALVS++K
Sbjct: 173 VAEFQKGYLLNERLLRPALVSVAK 196


>gi|33593484|ref|NP_881128.1| putative GrpE chaperone [Bordetella pertussis Tohama I]
 gi|33598004|ref|NP_885647.1| putative GrpE chaperone [Bordetella parapertussis 12822]
 gi|33602910|ref|NP_890470.1| putative GrpE chaperone [Bordetella bronchiseptica RB50]
 gi|52782918|sp|Q7VVY0|GRPE_BORPE RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|52782919|sp|Q7W517|GRPE_BORPA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|52782920|sp|Q7WGI2|GRPE_BORBR RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|33568541|emb|CAE34299.1| putative GrpE chaperone [Bordetella bronchiseptica RB50]
 gi|33572840|emb|CAE42773.1| putative GrpE chaperone [Bordetella pertussis Tohama I]
 gi|33574433|emb|CAE38771.1| putative GrpE chaperone [Bordetella parapertussis]
 gi|332382892|gb|AEE67739.1| putative GrpE chaperone [Bordetella pertussis CS]
          Length = 184

 Score = 99.0 bits (245), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 87/147 (59%), Gaps = 13/147 (8%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +++ LR  AE EN+RRR   +   A+ + I  FA  ++ V D+L  AL            
Sbjct: 49  QEQVLRAAAEAENVRRRAQEDVAKARKFGIESFAESLVPVKDSLEAAL-----------A 97

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKI-DAKDQKFNPNMHQAMFEEPHDTVPANT 162
           + +   ++  EG+E+T +++ +  ER  +K+I  A+  KF+P++HQA+   P D  PANT
Sbjct: 98  QPDQAAQAWREGVEVTLKQLTAAFERNLLKEIAPAQGDKFDPHLHQAISSVPADQ-PANT 156

Query: 163 IIKVVQDGYAINERVLRPALVSISKGK 189
           +++++Q GY I +R LRPALV +S G+
Sbjct: 157 VLQLLQKGYVIADRTLRPALVVVSAGQ 183


>gi|170087268|ref|XP_001874857.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164650057|gb|EDR14298.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 242

 Score = 99.0 bits (245), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 100/193 (51%), Gaps = 20/193 (10%)

Query: 11  DKEKNPSNANSSTAEEKSEINIPE-ESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
           DK K+P     ST++ + +I   + E ++ +   R  YL+  A+  NL+R   REK+  +
Sbjct: 51  DKAKDPQGEKGSTSDLEEKIKAKDAEVVDLTGRLR--YLQ--ADFLNLQRNAAREKEQTR 106

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSE---------------KKSESVLKSLIE 114
            ++I +FA D+L   D L+ AL S P    ++                K  E+ L+ L  
Sbjct: 107 DFAITRFASDLLETVDVLAIALKSVPATALSTHESSQTSTTPPPESLPKSHEAYLRELHT 166

Query: 115 GIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAIN 174
           G+EMT R ++ TL +Y VK  D    KF+PN H+A+++ P       T+I   + GY I 
Sbjct: 167 GVEMTHRLLLQTLFKYHVKPFDPTGDKFDPNQHEALYQAPIPGKEPGTVIDCQKTGYTIK 226

Query: 175 ERVLRPALVSISK 187
           +RVLR A V +++
Sbjct: 227 DRVLRAAQVGVAQ 239


>gi|284042267|ref|YP_003392607.1| GrpE protein [Conexibacter woesei DSM 14684]
 gi|283946488|gb|ADB49232.1| GrpE protein [Conexibacter woesei DSM 14684]
          Length = 203

 Score = 99.0 bits (245), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 85/146 (58%), Gaps = 7/146 (4%)

Query: 45  DKYL----RVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           D+YL    R  A+ EN R+R  R+ K A++  I K A+++L   DNL RAL +A      
Sbjct: 60  DEYLALAQRTQADFENFRKRMARDVKAAEARGIGKLAKELLPALDNLDRALAAAE---TP 116

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
            E  S +    L  GI +   E+++ L R G+++   + ++F+PN+H+AM ++P +   +
Sbjct: 117 GEGGSGAPEHHLTAGIRLVHDELLAALGRAGIERFSPQGERFDPNLHEAMVQQPVEGAES 176

Query: 161 NTIIKVVQDGYAINERVLRPALVSIS 186
            T+++V Q GY ++  VLRPA V ++
Sbjct: 177 GTVVEVYQSGYRLDGLVLRPARVVVA 202


>gi|291614587|ref|YP_003524744.1| GrpE protein [Sideroxydans lithotrophicus ES-1]
 gi|291584699|gb|ADE12357.1| GrpE protein [Sideroxydans lithotrophicus ES-1]
          Length = 175

 Score = 99.0 bits (245), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 51/151 (33%), Positives = 94/151 (62%), Gaps = 12/151 (7%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           +++E  D ++   AE EN+RRR   +   AQ +++ +F+ +ML+V D+L           
Sbjct: 36  KAQEHYDAWMYAKAEGENIRRRAAEDVSKAQKFAVERFSNEMLAVKDSLE---------- 85

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
           A    ++E++ +S   G+E+T +++ S  +++ +K+I+   +K +P+ HQA+     D  
Sbjct: 86  AGMAVQTENI-ESFKSGMELTLKQLSSVFDKFNIKEINPVGEKLDPHKHQAIGMIDSDQ- 143

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISKGK 189
           PANT++ V+Q GY++N+RVLRPALV ++K K
Sbjct: 144 PANTVVNVMQKGYSLNDRVLRPALVMVAKAK 174


>gi|225563221|gb|EEH11500.1| mitochondrial grpe [Ajellomyces capsulatus G186AR]
          Length = 252

 Score = 99.0 bits (245), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 86/150 (57%), Gaps = 7/150 (4%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD-LAN 100
           + +DKYLR +A+  NL+ RT RE + A+S++I +FA D+L   DNL RAL + P++ ++ 
Sbjct: 98  DLKDKYLRSVADFRNLQERTRREIETARSFAIQRFATDLLDSIDNLDRALAAVPVEKISG 157

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKK------IDAKDQKFNPNMHQAMFEEP 154
             ++    L  L+ G+ MT R + STL ++G+++      +D K QKF+P +H+A F   
Sbjct: 158 PGEQENKELAELVSGLRMTERVLFSTLNKHGLERFDPSELVDGKPQKFDPKLHEATFMAA 217

Query: 155 HDTVPANTIIKVVQDGYAINERVLRPALVS 184
            +      ++     G+ +N R LR    S
Sbjct: 218 AEGKEDGDVLHAQTKGFILNGRTLRVGCYS 247


>gi|254787225|ref|YP_003074654.1| heat shock protein GrpE [Teredinibacter turnerae T7901]
 gi|259647658|sp|C5BQ34|GRPE_TERTT RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|237683570|gb|ACR10834.1| co-chaperone GrpE [Teredinibacter turnerae T7901]
          Length = 190

 Score = 99.0 bits (245), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 92/148 (62%), Gaps = 12/148 (8%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E +++ LR  AEM N+RRR +++ + A  + + KF  DML V+DNL RA          +
Sbjct: 53  EAKEQALRAAAEMHNVRRRAEQDVEKAHKFGLEKFVSDMLPVADNLGRA--------LEA 104

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM--FEEPHDTVP 159
                + + ++ EG+++T + +M +L+++GV+ ++ + + FNP +HQAM   E P D  P
Sbjct: 105 AAAEGADMTAVTEGVDLTLKSLMDSLKKHGVESVNPEGEPFNPELHQAMTAVENP-DAEP 163

Query: 160 ANTIIKVVQDGYAINERVLRPALVSISK 187
            NT+I V Q GY ++ R++RPA+V +SK
Sbjct: 164 -NTVINVYQVGYTLHGRLVRPAMVVVSK 190


>gi|257878501|ref|ZP_05658154.1| heat shock protein grpE [Enterococcus faecium 1,230,933]
 gi|257894313|ref|ZP_05673966.1| heat shock protein grpE [Enterococcus faecium 1,231,408]
 gi|293568108|ref|ZP_06679445.1| co-chaperone GrpE [Enterococcus faecium E1071]
 gi|294618182|ref|ZP_06697771.1| co-chaperone GrpE [Enterococcus faecium E1679]
 gi|257812729|gb|EEV41487.1| heat shock protein grpE [Enterococcus faecium 1,230,933]
 gi|257830692|gb|EEV57299.1| heat shock protein grpE [Enterococcus faecium 1,231,408]
 gi|291589190|gb|EFF21001.1| co-chaperone GrpE [Enterococcus faecium E1071]
 gi|291595557|gb|EFF26861.1| co-chaperone GrpE [Enterococcus faecium E1679]
          Length = 187

 Score = 99.0 bits (245), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 87/148 (58%), Gaps = 10/148 (6%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           EE  D+YLR  AE+ N+  R   E++  Q Y     A+ +L   DNL RAL         
Sbjct: 49  EEMEDRYLRARAEIANMANRGKNEREQLQKYRSQDLAKKLLPSIDNLERAL--------- 99

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPH-DTVP 159
           + + S+     L +G+EM    + + LE  G++KI AK + F+PN+HQA+   P  +  P
Sbjct: 100 ATEVSDDQGAGLKKGVEMVLESLRNALEEEGIEKIPAKGEAFDPNLHQAVQTVPATEDTP 159

Query: 160 ANTIIKVVQDGYAINERVLRPALVSISK 187
           A+TI++V+Q+GY +++RVLRP +V +++
Sbjct: 160 ADTIVEVLQEGYKLHDRVLRPTMVIVAQ 187


>gi|328957420|ref|YP_004374806.1| nucleotide exchange factor for DnaK activity [Carnobacterium sp.
           17-4]
 gi|328673744|gb|AEB29790.1| nucleotide exchange factor for DnaK activity [Carnobacterium sp.
           17-4]
          Length = 185

 Score = 99.0 bits (245), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 56/148 (37%), Positives = 90/148 (60%), Gaps = 10/148 (6%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           EE  +KYLRV AEM N+++R  +E++DA  +     A ++L V DNL RAL    +++ +
Sbjct: 47  EEMENKYLRVQAEMANIQKRNAKEREDAAKFRAQSLATELLPVIDNLERAL---AIEVTD 103

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
            +       KSL +GIEM      + L+  G++ ID  ++ F+PN HQA+   P +   A
Sbjct: 104 EQG------KSLKKGIEMVMETFNAALKSEGIEVIDPLNEPFDPNFHQAIQTVPVEEGQA 157

Query: 161 N-TIIKVVQDGYAINERVLRPALVSISK 187
           + T+++V Q GY +N RVLRPA+V +++
Sbjct: 158 SETVVQVFQKGYDLNGRVLRPAMVIVAQ 185


>gi|1669597|dbj|BAA13686.1| AR192 [Arabidopsis thaliana]
          Length = 273

 Score = 99.0 bits (245), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 59/164 (35%), Positives = 99/164 (60%), Gaps = 8/164 (4%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQS--YSIAKFARDMLSV-SDNLSRALDSAPLDL 98
           + +DK LR  AEMEN+  RT R+ ++ +S  Y I + A  M  +  + L R    A   L
Sbjct: 111 QLKDKVLRTYAEMENVMDRTRRDAENTKSMPYRILQRAYWMWRIILEELLRLSKKASQSL 170

Query: 99  ANSEKKSES--VLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHD 156
            NSE  + +  +LK+L+EG+EMT +++    +++G++K D  ++ F+PN H A+F+ P  
Sbjct: 171 -NSEDSAGAAPLLKTLLEGVEMTEKQLAEVFKKFGMEKYDPINEPFDPNRHNAVFQVPDA 229

Query: 157 TVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKET 200
           + P  T+  V++ GY + +RV+RPA V +++G      EEKKE+
Sbjct: 230 SKPEGTVAHVLKSGYTLYDRVIRPAEVGVTQGGENQ--EEKKES 271


>gi|239814719|ref|YP_002943629.1| heat shock protein GrpE [Variovorax paradoxus S110]
 gi|239801296|gb|ACS18363.1| GrpE protein [Variovorax paradoxus S110]
          Length = 179

 Score = 99.0 bits (245), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 85/152 (55%), Gaps = 18/152 (11%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRAL---DSAPLDL 98
           E  D+YLR  A+++N RRR D E   A+ +++  FA  +L V+D+L   L   D+ P   
Sbjct: 42  ELSDQYLRAQADVQNARRRADDEITKARKFAVEAFAESLLPVTDSLEAGLAVKDATP--- 98

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI-DAKDQKFNPNMHQAMFEEPHDT 157
                      + + EG E T R++ S LER  V ++  A   KF+P+ HQA+   P   
Sbjct: 99  -----------EQIREGAEATLRQLKSALERNKVIEVAPAPGAKFDPHQHQAISVVPAPE 147

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISKGK 189
              NT++ V+Q GY IN+RVLRPALV++S  K
Sbjct: 148 QEPNTVVTVLQKGYTINDRVLRPALVTVSAPK 179


>gi|115372843|ref|ZP_01460148.1| co-chaperone GrpE [Stigmatella aurantiaca DW4/3-1]
 gi|115370110|gb|EAU69040.1| co-chaperone GrpE [Stigmatella aurantiaca DW4/3-1]
          Length = 227

 Score = 99.0 bits (245), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 52/138 (37%), Positives = 80/138 (57%), Gaps = 9/138 (6%)

Query: 45  DKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKK 104
           ++ LR  A++EN ++R  +EK++ Q +   K  +D+L V DNL RA+D+A         K
Sbjct: 41  ERSLRAAADLENYKKRAQKEKEEVQKFGSEKLLKDILPVMDNLDRAMDAAA--------K 92

Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTII 164
           S     S  +G+ MTR+    TL R+GVK   A+ Q F+P +H+AM +     VPA  + 
Sbjct: 93  SPD-FTSFQKGVAMTRKSFEDTLSRHGVKAFSAQGQAFDPRLHEAMSQAETADVPAGHVA 151

Query: 165 KVVQDGYAINERVLRPAL 182
             V  GY +NER++RPA+
Sbjct: 152 YEVLRGYHLNERLIRPAM 169


>gi|327398646|ref|YP_004339515.1| Protein grpE [Hippea maritima DSM 10411]
 gi|327181275|gb|AEA33456.1| Protein grpE [Hippea maritima DSM 10411]
          Length = 186

 Score = 99.0 bits (245), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 89/146 (60%), Gaps = 11/146 (7%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
            +++YLR+ AE +N R+R  +E +DA+  +      D L++ DNL +A++     +A   
Sbjct: 38  LKEEYLRLYAEFDNYRKRILKEIEDAKESAKRSVINDFLTILDNLEKAIE-----MAYQH 92

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
           K +      +IEGIE++ +     L+++GV++I  + + F+PN+H A+  +P D +P +T
Sbjct: 93  KDA------IIEGIELSIKSFKDMLKKHGVEEISPEKENFDPNLHDALMTQPSDELPKDT 146

Query: 163 IIKVVQDGYAINERVLRPALVSISKG 188
           +I+ VQ GY   ++++RPA V +S G
Sbjct: 147 VIQTVQKGYIYKDKLIRPAKVIVSAG 172


>gi|196231631|ref|ZP_03130489.1| GrpE protein [Chthoniobacter flavus Ellin428]
 gi|196224484|gb|EDY18996.1| GrpE protein [Chthoniobacter flavus Ellin428]
          Length = 175

 Score = 98.6 bits (244), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 50/148 (33%), Positives = 85/148 (57%), Gaps = 9/148 (6%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           E FRD  LR  A+ +N R+R  REK DA  Y+ A F   ++ + DN    L++A    A+
Sbjct: 33  ERFRDHALRTQADFDNFRKRAAREKDDAIKYANASFLDRLIPILDNFELGLNAARGSAAD 92

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
           S          ++ G++M  +++   L   GV+ ++A+ Q F+PN+H+A+ +E   TV  
Sbjct: 93  S---------PILAGMDMVSKQLFDFLASCGVEAVNAEGQPFDPNLHEAVAQEESATVAD 143

Query: 161 NTIIKVVQDGYAINERVLRPALVSISKG 188
             +I+ ++ GY + +R+LRP+ V +SKG
Sbjct: 144 GVVIRQLRKGYKLRDRLLRPSTVVVSKG 171


>gi|146317955|ref|YP_001197667.1| molecular chaperone GrpE (heat shock protein) [Streptococcus suis
           05ZYH33]
 gi|146320142|ref|YP_001199853.1| heat shock protein GrpE [Streptococcus suis 98HAH33]
 gi|253751179|ref|YP_003024320.1| GrpE protein (HSP-70 cofactor) [Streptococcus suis SC84]
 gi|253753080|ref|YP_003026220.1| GrpE protein (HSP-70 cofactor) [Streptococcus suis P1/7]
 gi|253754902|ref|YP_003028042.1| GrpE protein (HSP-70 cofactor) [Streptococcus suis BM407]
 gi|330832138|ref|YP_004400963.1| molecular chaperone GrpE (heat shock protein) [Streptococcus suis
           ST3]
 gi|166215287|sp|A4VZB4|GRPE_STRS2 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|166215289|sp|A4VT28|GRPE_STRSY RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|145688761|gb|ABP89267.1| Molecular chaperone GrpE (heat shock protein) [Streptococcus suis
           05ZYH33]
 gi|145690948|gb|ABP91453.1| Molecular chaperone GrpE (heat shock protein) [Streptococcus suis
           98HAH33]
 gi|251815468|emb|CAZ51046.1| GrpE protein (HSP-70 cofactor) [Streptococcus suis SC84]
 gi|251817366|emb|CAZ55102.1| GrpE protein (HSP-70 cofactor) [Streptococcus suis BM407]
 gi|251819325|emb|CAR44684.1| GrpE protein (HSP-70 cofactor) [Streptococcus suis P1/7]
 gi|292557739|gb|ADE30740.1| GrpE protein [Streptococcus suis GZ1]
 gi|319757448|gb|ADV69390.1| molecular chaperone GrpE (heat shock protein) [Streptococcus suis
           JS14]
 gi|329306361|gb|AEB80777.1| molecular chaperone GrpE (heat shock protein) [Streptococcus suis
           ST3]
          Length = 170

 Score = 98.6 bits (244), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 96/162 (59%), Gaps = 18/162 (11%)

Query: 26  EKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSD 85
           EKSE+++  E   ++EEF +KYLR  AEM+N++RR + E++  Q Y     A+ +L   D
Sbjct: 25  EKSELDLANE---RAEEFENKYLRAHAEMQNIQRRANEERQTIQRYRSQDLAKKILPSLD 81

Query: 86  NLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPN 145
           NL RAL            + E + + + +G+EM +  ++  L+  GV+++ A D  F+PN
Sbjct: 82  NLERAL------------QVEGLTEDVKKGLEMVQESLIQALKEEGVEEV-ATD-VFDPN 127

Query: 146 MHQAMFEEPH-DTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           +H A+   P  D  PA  I +V Q GY ++ER+LRPA+V +S
Sbjct: 128 LHMAIQTVPATDDCPAEHIAQVFQKGYKLHERLLRPAMVVVS 169


>gi|319956227|ref|YP_004167490.1| grpe protein [Nitratifractor salsuginis DSM 16511]
 gi|319418631|gb|ADV45741.1| GrpE protein [Nitratifractor salsuginis DSM 16511]
          Length = 188

 Score = 98.6 bits (244), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 90/147 (61%), Gaps = 7/147 (4%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           EE++D+YLR  A+ EN+++R +++K  A  Y+   FA D+LSV D    AL  A +D   
Sbjct: 49  EEYKDRYLRAHADFENMKKRLEKDKSTAVMYANEAFATDLLSVIDTFENAL--ASIDKIQ 106

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
            ++  E +     EGI +T  +++  L+++GV++I A +  F+P++HQ + +   D    
Sbjct: 107 GDEAVEKIK----EGIALTYEQLLKVLKKHGVEEI-ANEGVFDPHVHQVVQQVESDAHEQ 161

Query: 161 NTIIKVVQDGYAINERVLRPALVSISK 187
           N I+ V+Q GY + +RVLRP++VS  K
Sbjct: 162 NEIVHVLQKGYKLRDRVLRPSMVSTKK 188


>gi|288555678|ref|YP_003427613.1| heat shock protein GrpE [Bacillus pseudofirmus OF4]
 gi|288546838|gb|ADC50721.1| heat shock protein GrpE [Bacillus pseudofirmus OF4]
          Length = 188

 Score = 98.6 bits (244), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 61/176 (34%), Positives = 100/176 (56%), Gaps = 12/176 (6%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
           +D ++N ++A+  T   ++E N P E+  Q  E  ++ LRV A+ +N RRR+  EK+ A 
Sbjct: 23  VDTDQNEASASDETEVVEAEEN-PLEA--QVAELNNRMLRVQADYDNFRRRSREEKEAAA 79

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
            Y        +L V DN  RAL   P        +SE   +SL+ G+EM  R++  TL+ 
Sbjct: 80  KYRSQALIEGLLPVVDNFERALLVKP--------ESEEA-QSLLSGMEMVYRQLKDTLKN 130

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
            GV+ I+   Q F+P++HQA+ +   D   +N I++ +Q GY + +RVLRP++V +
Sbjct: 131 EGVEVIETTGQSFDPHLHQAVMQVSEDGFESNQIVEELQKGYKLKDRVLRPSMVKV 186


>gi|325521151|gb|EGD00053.1| heat shock protein GrpE [Burkholderia sp. TJI49]
          Length = 181

 Score = 98.6 bits (244), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 85/148 (57%), Gaps = 12/148 (8%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E ++ +LR  AE EN+RRR   +   A  ++I  FA  +L V D+L  A+     D+   
Sbjct: 46  ELQESFLRAKAETENVRRRAQDDVAKAHKFAIESFAEHLLPVLDSLEAAVGDTSGDITK- 104

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
                     + EG+E+T R++ S LE+  V  I+   +KF+P+ HQA+   P +  P N
Sbjct: 105 ----------VREGVELTLRQLTSALEKGRVVAINPVGEKFDPHQHQAISMVPAEQEP-N 153

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGK 189
           T++ V+Q GY I +RVLRPALV++++ K
Sbjct: 154 TVVSVLQKGYMIADRVLRPALVTVAQPK 181


>gi|225713032|gb|ACO12362.1| GrpE protein homolog, mitochondrial precursor [Lepeophtheirus
           salmonis]
          Length = 201

 Score = 98.6 bits (244), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 92/155 (59%), Gaps = 11/155 (7%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           EE   ++ +  DKY R IAE EN+R+R  ++  DA+ + I  F +D+L VSD LS+A+++
Sbjct: 56  EELRGKNVDLLDKYRRSIAENENMRQRLTKQINDAKIFGIQSFCKDLLDVSDVLSKAVET 115

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
            P D +          K + +GI++T  +++    R+G+ K +  ++KF+PN H+A F+ 
Sbjct: 116 LPEDAS----------KDIRDGIKLTESQLLQVFTRHGLVKENPLNEKFDPNKHEAAFQI 165

Query: 154 PH-DTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           P    V  N ++ V + G+ +  R +RPA+V +SK
Sbjct: 166 PAPKGVEDNIVLDVQKVGFILQGRTIRPAVVGVSK 200


>gi|225713010|gb|ACO12351.1| GrpE protein homolog, mitochondrial precursor [Lepeophtheirus
           salmonis]
 gi|290562709|gb|ADD38750.1| GrpE protein homolog, mitochondrial [Lepeophtheirus salmonis]
          Length = 201

 Score = 98.6 bits (244), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 92/155 (59%), Gaps = 11/155 (7%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           EE   ++ +  DKY R IAE EN+R+R  ++  DA+ + I  F +D+L VSD LS+A+++
Sbjct: 56  EELRGKNVDLLDKYRRSIAENENMRQRLTKQINDAKIFGIQSFCKDLLDVSDVLSKAVET 115

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
            P D +          K + +GI++T  +++    R+G+ K +  ++KF+PN H+A F+ 
Sbjct: 116 LPEDAS----------KDIRDGIKLTESQLLQVFTRHGLVKENPLNEKFDPNKHEAAFQI 165

Query: 154 PH-DTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           P    V  N ++ V + G+ +  R +RPA+V +SK
Sbjct: 166 PAPKGVEDNIVLDVQKVGFILQGRTIRPAVVGVSK 200


>gi|206602524|gb|EDZ39005.1| Putative GrpE protein [Leptospirillum sp. Group II '5-way CG']
          Length = 189

 Score = 98.6 bits (244), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 93/158 (58%), Gaps = 7/158 (4%)

Query: 34  EESLNQSEE--FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRAL 91
           EE+  + EE  +R+KY+R++A+ +N R+R  RE+++++ ++     +  L + DNL RAL
Sbjct: 31  EEAGKEGEENPWREKYIRLLADFDNYRKRMAREQEESRKFANESLLKAFLPILDNLERAL 90

Query: 92  DSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMF 151
                        S   LK+L +G+++T ++ +  LE+  V ++ A+   F+PN+H+AM 
Sbjct: 91  ----FHFGKVSSPSPE-LKALADGVKLTEKQFLELLEKNHVTRVPAQGSVFDPNVHEAMG 145

Query: 152 EEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
             P +      I+ V Q GY +  R+LRPALV++++ K
Sbjct: 146 FSPSEGFEEGAIVDVYQQGYMMQGRLLRPALVTVAQKK 183


>gi|256545385|ref|ZP_05472748.1| heat shock protein GrpE [Anaerococcus vaginalis ATCC 51170]
 gi|256398946|gb|EEU12560.1| heat shock protein GrpE [Anaerococcus vaginalis ATCC 51170]
          Length = 181

 Score = 98.6 bits (244), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 90/157 (57%), Gaps = 12/157 (7%)

Query: 31  NIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRA 90
           N+ ++S     EF++KY R++A+  N ++R ++ + D + ++ +    ++L V DN  RA
Sbjct: 37  NVEKDSSEDENEFKEKYQRLLADFTNFKKREEKARADFKKFASSNLIEELLPVLDNFDRA 96

Query: 91  LDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM 150
           L            K +    S ++GI MTR  +   LE+ G+++I++   +F+PN H A 
Sbjct: 97  L------------KDQDSEDSFVKGIMMTRDSLWKVLEKEGLEEIESDGVEFDPNFHHAF 144

Query: 151 FEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
             E ++   +N II+  Q GY +N+RV+RP++V ++K
Sbjct: 145 QTEENEDFKSNYIIETYQKGYKLNDRVIRPSMVKVAK 181


>gi|241896334|ref|ZP_04783630.1| chaperone GrpE protein [Weissella paramesenteroides ATCC 33313]
 gi|241870314|gb|EER74065.1| chaperone GrpE protein [Weissella paramesenteroides ATCC 33313]
          Length = 188

 Score = 98.6 bits (244), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 55/145 (37%), Positives = 82/145 (56%), Gaps = 10/145 (6%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E  DKYLR  AEM+N++ R  +E+  A  ++  K A  +L   DNL RAL     D A  
Sbjct: 51  EAEDKYLRAEAEMQNMQSRYAKEQVQAVKFANQKLAASILPAVDNLERALQVDAEDGAAK 110

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEP-HDTVPA 160
           + K+         G+EM  + ++S LE + VK +    + F+PN HQA+   P  D  PA
Sbjct: 111 QIKT---------GVEMVYKTLISALEEHDVKAVGETGETFDPNFHQAIQSVPADDDHPA 161

Query: 161 NTIIKVVQDGYAINERVLRPALVSI 185
           +TI  V+Q GY + +RV+RPA+V++
Sbjct: 162 DTIATVLQKGYVLADRVIRPAMVAV 186


>gi|296136245|ref|YP_003643487.1| GrpE protein [Thiomonas intermedia K12]
 gi|295796367|gb|ADG31157.1| GrpE protein [Thiomonas intermedia K12]
          Length = 176

 Score = 98.6 bits (244), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 64/183 (34%), Positives = 105/183 (57%), Gaps = 21/183 (11%)

Query: 14  KNPSNANSSTAEEKSEINIPE----ESLNQSEE----FRDKYLRVIAEMENLRRRTDREK 65
           + P + +  TA+   +  IPE    + L Q++E      D+ LR  AE+EN+RRR + E 
Sbjct: 6   QTPPSDDPQTADGAHQELIPEPVLSDELAQAQEEITKLNDQLLRARAEVENIRRRAEDEA 65

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
             A+ +++  FA  +L V D+L  A       LA++  K + VLK   +G+E+T  ++ S
Sbjct: 66  AKARKFAVEGFAESLLPVKDSLEAA-------LADTSGKPD-VLK---QGVELTLSQLKS 114

Query: 126 TLERYGVKKI-DAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
             ER  + +I  A   KF+P +HQA+  +P +  P+ T++ V+Q GY I ER LRPALV+
Sbjct: 115 AFERNRLLEIAPAAGDKFDPTLHQAISVQPAEQ-PSGTVVSVLQKGYRIAERTLRPALVT 173

Query: 185 ISK 187
           +++
Sbjct: 174 VAQ 176


>gi|331214714|ref|XP_003320038.1| protein grpE [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
 gi|309299028|gb|EFP75619.1| protein grpE [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
          Length = 253

 Score = 98.6 bits (244), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 90/166 (54%), Gaps = 19/166 (11%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           Q  E++D Y+R  A+ ENL++ T REK  A+ Y+I  FARD++S  D L  AL+S P  L
Sbjct: 87  QLNEYKDLYIRARADFENLQKITSREKAQAKEYAIQGFARDLVSNIDVLQLALNSVPEPL 146

Query: 99  ANSEK-------------KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPN 145
              ++             +S   L  L  G++ T+  +  TL  YGV   +   Q+F+PN
Sbjct: 147 RTVQEDATTTTSTTEGAPESRKHLADLWAGVQSTKSLLEKTLALYGVTPFNPVGQQFDPN 206

Query: 146 MHQAMFEEPHDTVPA---NTIIKVVQDGYAINERVLRPALVSISKG 188
            H+AM++     VP    N+++   + G+ + +RVLRPA V + +G
Sbjct: 207 RHEAMYQA---QVPGKEPNSVLNCSKVGWMLRDRVLRPAQVGVVQG 249


>gi|227486725|ref|ZP_03917041.1| chaperone GrpE [Anaerococcus lactolyticus ATCC 51172]
 gi|227235313|gb|EEI85328.1| chaperone GrpE [Anaerococcus lactolyticus ATCC 51172]
          Length = 186

 Score = 98.2 bits (243), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 86/147 (58%), Gaps = 14/147 (9%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRAL-DSAPLDLAN 100
           E+ +KY R++A+  N ++R ++ K D + ++ +     +L V DN  RAL D  P D   
Sbjct: 53  EYIEKYQRLMADFANYKQREEKAKADFKKFASSSLVEKLLPVLDNFDRALKDKDPED--- 109

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
                       ++G+ MTR E++ TL+  G+++I +  +KF+ N+H A+  E +DTV  
Sbjct: 110 ----------PFVKGVIMTRDELLKTLKNEGLEEIASDGEKFDHNLHHAVMTEANDTVEE 159

Query: 161 NTIIKVVQDGYAINERVLRPALVSISK 187
           + II+  Q GY +N RVLRPA+V +SK
Sbjct: 160 DYIIETFQKGYTLNGRVLRPAMVKVSK 186


>gi|119481469|ref|XP_001260763.1| mitochondrial co-chaperone GrpE, putative [Neosartorya fischeri
           NRRL 181]
 gi|119408917|gb|EAW18866.1| mitochondrial co-chaperone GrpE, putative [Neosartorya fischeri
           NRRL 181]
          Length = 250

 Score = 98.2 bits (243), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 91/154 (59%), Gaps = 8/154 (5%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           + +DKY+R +A+  NL+ RT RE ++A++++I +FA D+L   DN  RAL + P +   +
Sbjct: 95  DLKDKYMRSVADFLNLQERTKREMENARNFAIQRFAVDLLESIDNFDRALLAVPAEKLKA 154

Query: 102 E-KKSESVLKSLIEGIEMTRREMMSTLERYGVKKI-------DAKDQKFNPNMHQAMFEE 153
           E  +S   L  L+ G+ MT+  +++TL+++G+++        D K QKF+PN+H+A F  
Sbjct: 155 EVTESNKELMDLVSGLRMTQNILLNTLKKHGLERFDPSEPAEDGKPQKFDPNVHEATFMT 214

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
             +      II     G+ +N RVLR A V + K
Sbjct: 215 KVEGREDGEIIHTQTTGFKLNGRVLRAAKVGVVK 248


>gi|34497097|ref|NP_901312.1| heat shock protein GrpE [Chromobacterium violaceum ATCC 12472]
 gi|52782907|sp|Q7NXI4|GRPE_CHRVO RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|34102954|gb|AAQ59318.1| heat shock protein GrpE [Chromobacterium violaceum ATCC 12472]
          Length = 188

 Score = 98.2 bits (243), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 86/150 (57%), Gaps = 13/150 (8%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E  D  LR  AE+EN RRR   E   A  Y+I KFA ++++V D L  AL    LD +  
Sbjct: 51  ELNDTLLRARAELENQRRRAQDEVAAAHKYAIGKFAAELVTVKDYLEMAL----LDQSGQ 106

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPA 160
                  + +L  G++MT ++++S  ++  +K I  K   K +P+ HQAM  E  D  P 
Sbjct: 107 -------IDALKMGVDMTLKQLVSAFDKAQIKDIAPKLGDKLDPHQHQAMSAEESDAEP- 158

Query: 161 NTIIKVVQDGYAINERVLRPALVSISKGKT 190
           NT+++V+Q GY + +RVLRPA+V ++K K 
Sbjct: 159 NTVVRVMQKGYLLADRVLRPAMVVVAKAKA 188


>gi|315586109|gb|ADU40490.1| co-chaperone GrpE [Helicobacter pylori 35A]
          Length = 191

 Score = 98.2 bits (243), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 104/188 (55%), Gaps = 15/188 (7%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEIN-----IPEESLNQSEEFRDKYLRVIAEMENLRR 59
           +S+K  +  K     N    EE  E++     I E+   + +E R+KYLRV A+ EN+++
Sbjct: 12  LSQKEPEFCKKACACNEQQGEEMQEVSEKECEIKEDFELKYQEMREKYLRVHADFENVKK 71

Query: 60  RTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMT 119
           R +R+K  A  Y+  K A D+L V D L  A  SA       +K+S     +L +G+E+T
Sbjct: 72  RLERDKSMALEYAYEKIALDLLPVIDALLGAHRSA----IEVDKES-----ALTKGLELT 122

Query: 120 RREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
             ++   L R+G++ I+  ++ F+PN H A+ +   +      I++V+Q GY    RVLR
Sbjct: 123 MEKLHEVLARHGIEGIECLEE-FDPNFHNAIMQVKSEEKENGKIVQVLQQGYKYKGRVLR 181

Query: 180 PALVSISK 187
           PA+VSI+K
Sbjct: 182 PAMVSIAK 189


>gi|207721691|ref|YP_002252130.1| HSP70 cofactor [Ralstonia solanacearum MolK2]
 gi|206586853|emb|CAQ17438.1| protein grpe (hsp-70 cofactor) [Ralstonia solanacearum MolK2]
          Length = 214

 Score = 98.2 bits (243), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 94/167 (56%), Gaps = 15/167 (8%)

Query: 23  TAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLS 82
           TAE + +++  EE   Q+ E    + R +AE EN+RRR   +   A  ++I  FA  +L 
Sbjct: 63  TAELRRQLDAAEEKARQNYE---NWARAVAEGENIRRRAQDDVARAHKFAIEGFAEYLLP 119

Query: 83  VSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKF 142
           V D+L  AL     D A            L EG+E+T +++ +  E+  V +++   +KF
Sbjct: 120 VMDSLQAALTDTSGDTAK-----------LREGVELTLKQLYAAFEKGRVTELNPVGEKF 168

Query: 143 NPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
           +P+ HQA+   P D   ANT++ V+Q GYA+ +RVLRPALV+++  K
Sbjct: 169 DPHRHQAISMVPADQ-EANTVVNVLQRGYALADRVLRPALVTVAAPK 214


>gi|83747223|ref|ZP_00944265.1| probable heat shock protein 24 (HSP-70 cofactor) [Ralstonia
           solanacearum UW551]
 gi|207744208|ref|YP_002260600.1| protein grpe (hsp-70 cofactor) [Ralstonia solanacearum IPO1609]
 gi|83726047|gb|EAP73183.1| probable heat shock protein 24 (HSP-70 cofactor) [Ralstonia
           solanacearum UW551]
 gi|206595613|emb|CAQ62540.1| protein grpe (hsp-70 cofactor) [Ralstonia solanacearum IPO1609]
          Length = 214

 Score = 98.2 bits (243), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 94/167 (56%), Gaps = 15/167 (8%)

Query: 23  TAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLS 82
           TAE + +++  EE   Q+ E    + R +AE EN+RRR   +   A  ++I  FA  +L 
Sbjct: 63  TAELRRQLDAAEEKARQNYE---NWARAVAEGENIRRRAQDDVARAHKFAIEGFAEYLLP 119

Query: 83  VSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKF 142
           V D+L  AL     D A            L EG+E+T +++ +  E+  V +++   +KF
Sbjct: 120 VMDSLQAALTDTSGDTAK-----------LREGVELTLKQLYAAFEKGRVAELNPVGEKF 168

Query: 143 NPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
           +P+ HQA+   P D   ANT++ V+Q GYA+ +RVLRPALV+++  K
Sbjct: 169 DPHRHQAISMVPADQ-EANTVVNVLQRGYALADRVLRPALVTVAAPK 214


>gi|294508387|ref|YP_003572445.1| Molecular chaperone GrpE (heat shock protein) [Salinibacter ruber
           M8]
 gi|294344715|emb|CBH25493.1| Molecular chaperone GrpE (heat shock protein) [Salinibacter ruber
           M8]
          Length = 223

 Score = 98.2 bits (243), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 84/146 (57%), Gaps = 2/146 (1%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           EE  ++ LR  AE+EN+RRR DREKK             ML V D+  R+LD+A  DL  
Sbjct: 67  EELNERLLRKAAELENVRRRMDREKKRRHVAGKETVLESMLEVLDDFERSLDAAQ-DLDV 125

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
           SE   ES  ++L  G+EM  R+    L+  GV+ I+A+ Q F+  +H+AM  +P D V  
Sbjct: 126 SEDP-ESAYETLKGGVEMVYRKFQDQLQSLGVEPIEAEGQPFDEQLHEAMMRQPSDDVEP 184

Query: 161 NTIIKVVQDGYAINERVLRPALVSIS 186
             +++ VQ GY + +RVLR + V ++
Sbjct: 185 GNVLQEVQKGYTMGDRVLRHSRVVVA 210


>gi|308061402|gb|ADO03290.1| heat shock protein GrpE [Helicobacter pylori Cuz20]
          Length = 191

 Score = 98.2 bits (243), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 59/161 (36%), Positives = 94/161 (58%), Gaps = 10/161 (6%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
           K E  I E+   + +E  +KYLRV A+ EN+++R +R+K  A  Y+  K A D+L V D 
Sbjct: 39  KKECEIKEDFELKYQEMHEKYLRVHADFENVKKRLERDKSMALEYAYEKIALDLLPVIDA 98

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNM 146
           L  A  SA    A  +K+S     +L +G+E+T  ++   L R+G++ I+  ++ F+PN 
Sbjct: 99  LLGAHRSA----AEVDKES-----ALTKGLELTMEKLHEVLARHGIEGIECLEE-FDPNF 148

Query: 147 HQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           H A+ +   +      I++V+Q GY    RVLRPA+VSI+K
Sbjct: 149 HNAIMQVKSEGKENGKIVQVLQQGYKYKGRVLRPAMVSIAK 189


>gi|169334975|ref|ZP_02862168.1| hypothetical protein ANASTE_01381 [Anaerofustis stercorihominis DSM
           17244]
 gi|169257713|gb|EDS71679.1| hypothetical protein ANASTE_01381 [Anaerofustis stercorihominis DSM
           17244]
          Length = 208

 Score = 98.2 bits (243), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 52/149 (34%), Positives = 87/149 (58%), Gaps = 11/149 (7%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           ++  D Y+R++A+ +N ++R  ++K+    YS +KFA  +  + DN  RALDS       
Sbjct: 71  DKLNDSYMRLLADFDNYKKRASKDKEAMIIYSTSKFAEGLFPIIDNFKRALDSE------ 124

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
           ++KKS        EG+ M   ++   L+  G++ I+A D+KF+PN H A+  E  D    
Sbjct: 125 ADKKS-----GFYEGVNMIFTQLTELLKNEGIETIEALDEKFDPNKHYAVAVEKLDDKED 179

Query: 161 NTIIKVVQDGYAINERVLRPALVSISKGK 189
           + I++V QDGY   E+VLRP++V ++K K
Sbjct: 180 DIILEVFQDGYIYKEKVLRPSMVKVNKLK 208


>gi|83815828|ref|YP_446452.1| co-chaperone GrpE [Salinibacter ruber DSM 13855]
 gi|83757222|gb|ABC45335.1| co-chaperone GrpE [Salinibacter ruber DSM 13855]
          Length = 223

 Score = 98.2 bits (243), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 84/146 (57%), Gaps = 2/146 (1%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           EE  ++ LR  AE+EN+RRR DREKK             ML V D+  R+LD+A  DL  
Sbjct: 67  EELNERLLRKAAELENVRRRMDREKKRRHVAGKETVLESMLEVLDDFERSLDAA-QDLDV 125

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
           SE   ES  ++L  G+EM  R+    L+  GV+ I+A+ Q F+  +H+AM  +P D V  
Sbjct: 126 SEDP-ESAYETLKGGVEMVYRKFQDQLQSLGVEPIEAEGQPFDEQLHEAMMRQPSDDVEP 184

Query: 161 NTIIKVVQDGYAINERVLRPALVSIS 186
             +++ VQ GY + +RVLR + V ++
Sbjct: 185 GNVLQEVQKGYTMGDRVLRHSRVVVA 210


>gi|116495048|ref|YP_806782.1| molecular chaperone GrpE (heat shock protein) [Lactobacillus casei
           ATCC 334]
 gi|191638551|ref|YP_001987717.1| Protein grpE (HSP-70 cofactor) [Lactobacillus casei BL23]
 gi|239631357|ref|ZP_04674388.1| protein grpE [Lactobacillus paracasei subsp. paracasei 8700:2]
 gi|301066611|ref|YP_003788634.1| molecular chaperone GrpE [Lactobacillus casei str. Zhang]
 gi|116105198|gb|ABJ70340.1| Molecular chaperone GrpE (heat shock protein) [Lactobacillus casei
           ATCC 334]
 gi|190712853|emb|CAQ66859.1| Protein grpE (HSP-70 cofactor) [Lactobacillus casei BL23]
 gi|239525822|gb|EEQ64823.1| protein grpE [Lactobacillus paracasei subsp. paracasei 8700:2]
 gi|300439018|gb|ADK18784.1| Molecular chaperone GrpE [Lactobacillus casei str. Zhang]
 gi|327382590|gb|AEA54066.1| Protein grpE [Lactobacillus casei LC2W]
 gi|327385787|gb|AEA57261.1| Protein grpE [Lactobacillus casei BD-II]
          Length = 196

 Score = 98.2 bits (243), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 89/155 (57%), Gaps = 11/155 (7%)

Query: 35  ESLNQS-EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           E L Q  ++F DKYLR  AE++N+  R ++E++    Y   K A+ +L V DNL RAL  
Sbjct: 51  EQLKQERDDFEDKYLRAAAEIQNMNARFEKEQQKLLKYDGQKLAKAILPVVDNLERAL-- 108

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FE 152
                  +E K +S + SL +G++M    +   L+  G+  ID    KF+PN  QA+   
Sbjct: 109 ------ATEAKDDSAV-SLKKGVQMVYDHLERALKENGITAIDGAGDKFDPNTQQAVQTV 161

Query: 153 EPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
              D  PA+T+ +V+Q GY + +RVLRPA+V ++K
Sbjct: 162 AADDQHPADTVAQVLQKGYYLKDRVLRPAMVVVAK 196


>gi|323144902|ref|ZP_08079465.1| co-chaperone GrpE [Succinatimonas hippei YIT 12066]
 gi|322415300|gb|EFY06071.1| co-chaperone GrpE [Succinatimonas hippei YIT 12066]
          Length = 223

 Score = 98.2 bits (243), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 89/145 (61%), Gaps = 7/145 (4%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           ++K LR +AE +N R+R + + +  + Y++ KF + ++ V D+L  AL++        + 
Sbjct: 84  KEKMLRAVAEADNSRKRAEADVERERKYALEKFVKALIPVVDSLDMALEA-------GKS 136

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           K+E+   ++++G+E T R  +  L  +GV++I+   + F+PN+HQA+   P   V  N I
Sbjct: 137 KTENAEDAMVQGVEATLRLFLKELSSFGVERINPVGEPFDPNVHQAISMIPSKDVKPNCI 196

Query: 164 IKVVQDGYAINERVLRPALVSISKG 188
           + V+Q G+ +N RV+RPA+V +++ 
Sbjct: 197 VSVMQKGFILNGRVVRPAMVMVARA 221


>gi|295675592|ref|YP_003604116.1| GrpE protein [Burkholderia sp. CCGE1002]
 gi|295435435|gb|ADG14605.1| GrpE protein [Burkholderia sp. CCGE1002]
          Length = 195

 Score = 98.2 bits (243), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 85/148 (57%), Gaps = 12/148 (8%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E ++ +LR  AE EN+RRR   +   A  ++I  FA  +L V D+L  A+  +  D    
Sbjct: 60  ELQEDFLRAKAETENVRRRAQEDVAKAHKFAIENFAEHLLPVVDSLEAAVAHSSDD---- 115

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
                  L+ + EG+E+T R++   LE+  V  I+   +KF+P+ HQA+   P D  P N
Sbjct: 116 -------LQKVREGVELTLRQLSGALEKGRVVAINPVGEKFDPHRHQAISMVPADQEP-N 167

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGK 189
           T++ V+Q G+ I +RVLRPALV+++  K
Sbjct: 168 TVVAVLQKGFVIADRVLRPALVTVAAPK 195


>gi|222111741|ref|YP_002554005.1| heat shock protein grpe [Acidovorax ebreus TPSY]
 gi|254799590|sp|B9MDJ6|GRPE_DIAST RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|221731185|gb|ACM34005.1| GrpE protein [Acidovorax ebreus TPSY]
          Length = 178

 Score = 98.2 bits (243), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 90/152 (59%), Gaps = 13/152 (8%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           +S +  D++LR  AE EN RRR + E   A+ + I  FA  +L V D+L  AL    ++ 
Sbjct: 39  KSADLADQFLRAKAEAENARRRAEDEVAKARKFGIESFAESLLPVCDSLDAAL---AIEN 95

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDT 157
           A +E+        L EG + T R++MS LER  V  ++ +   KF+P+ HQA+   P D 
Sbjct: 96  ATAEQ--------LREGSDATLRQLMSALERNKVVIVNPEAGTKFDPHQHQAISMVPADQ 147

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISKGK 189
             ANT++ V+Q GY I++RVLRPALV+++  K
Sbjct: 148 -EANTVVSVLQKGYLISDRVLRPALVTVAAPK 178


>gi|298244655|ref|ZP_06968461.1| GrpE protein [Ktedonobacter racemifer DSM 44963]
 gi|297552136|gb|EFH86001.1| GrpE protein [Ktedonobacter racemifer DSM 44963]
          Length = 225

 Score = 98.2 bits (243), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 86/152 (56%), Gaps = 9/152 (5%)

Query: 35  ESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSA 94
           E+  Q+ E+     R+ A+  N +RR  +E+ + +  + A+    +L V D+L RAL + 
Sbjct: 71  EAQRQAGEYLSMTQRLQADFINYKRRVTQEQSEGRLQAQAQIIEHILPVLDDLGRALMAV 130

Query: 95  PLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEP 154
           P +LA              +GI++T R+++S L++ GV++I    + FNP  H+A+ +EP
Sbjct: 131 PPELAQ---------HPWAQGIQLTSRQLISALQQLGVRQIGNPGELFNPQWHEALMKEP 181

Query: 155 HDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
              +P  T+ +V + GY   ERV+RPA V+++
Sbjct: 182 RPDLPEGTVAQVYRPGYVFGERVIRPAQVTVA 213


>gi|194334388|ref|YP_002016248.1| GrpE protein [Prosthecochloris aestuarii DSM 271]
 gi|226737156|sp|B4S9D1|GRPE_PROA2 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|194312206|gb|ACF46601.1| GrpE protein [Prosthecochloris aestuarii DSM 271]
          Length = 206

 Score = 98.2 bits (243), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 94/154 (61%), Gaps = 5/154 (3%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           EE+  Q+E++R + +R  A+ EN R++ +RE + A + SI    R++L + D++ R ++ 
Sbjct: 58  EEAQQQAEKYRGEMMRFAADFENFRKQKERELQAAGTRSIENTIRELLPLVDDMKRVMEH 117

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEE 153
           AP DL   E+  E+  +  +EG+E+  + ++   ER GVK+I+A  QK + N H+A+ + 
Sbjct: 118 APDDL---EQSGEA--RPYLEGVELLWKNLLKWFERKGVKQIEACGQKLDVNFHEAITQV 172

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            H     +T+I+  Q GY + ++VLR A V +++
Sbjct: 173 DHPDAEPDTVIEEYQTGYVMGDKVLRHAKVIVAR 206


>gi|78065311|ref|YP_368080.1| GrpE protein [Burkholderia sp. 383]
 gi|123729051|sp|Q39JD0|GRPE_BURS3 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|77966056|gb|ABB07436.1| GrpE protein [Burkholderia sp. 383]
          Length = 181

 Score = 97.8 bits (242), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 53/148 (35%), Positives = 85/148 (57%), Gaps = 12/148 (8%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E ++ YLR  AE EN+RRR   +   A  ++I  FA  +L V D+L  A++    D+   
Sbjct: 46  ELQESYLRAKAETENVRRRAQDDVSKAHKFAIEGFAEHLLPVLDSLEAAVNDTSGDITKV 105

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
                       EG+E+T R++ + LE+  V  ++   +KF+P+ HQA+   P +  P N
Sbjct: 106 R-----------EGVELTLRQLTNALEKGRVVALNPVGEKFDPHQHQAISMVPAEQEP-N 153

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGK 189
           T++ V+Q GY I +RVLRPALV++++ K
Sbjct: 154 TVVTVLQKGYTIADRVLRPALVTVAQPK 181


>gi|197098918|ref|NP_001127196.1| grpE protein homolog 1, mitochondrial precursor [Pongo abelii]
 gi|55726032|emb|CAH89792.1| hypothetical protein [Pongo abelii]
          Length = 217

 Score = 97.8 bits (242), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 97/177 (54%), Gaps = 9/177 (5%)

Query: 11  DKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQS 70
           +++ +P     +  EEK ++   EE L ++ E   KY R +A+ ENLR+R+ +  ++A+ 
Sbjct: 48  EQKADPPATEKTLLEEKVKL---EEQLKETVE---KYKRALADTENLRQRSQKLVEEAKL 101

Query: 71  YSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERY 130
           Y I  F +D+L V+D L +A   AP       K     LK+L EG+ MT  ++     ++
Sbjct: 102 YGIQAFCKDLLEVADVLEKATQCAP---KEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKH 158

Query: 131 GVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           G+ K++    KF+P  H+A+F  P +     T+  V + GY ++ R LRPALV + K
Sbjct: 159 GLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVK 215


>gi|325290543|ref|YP_004266724.1| Protein grpE [Syntrophobotulus glycolicus DSM 8271]
 gi|324965944|gb|ADY56723.1| Protein grpE [Syntrophobotulus glycolicus DSM 8271]
          Length = 177

 Score = 97.8 bits (242), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 59/186 (31%), Positives = 105/186 (56%), Gaps = 21/186 (11%)

Query: 11  DKEKNPSNANSSTAEEKSEINIPEE-------SLNQSEEFRDKYLRVIAEMENLRRRTDR 63
           +K K+P + N+  A E+ E + PEE         ++SEE+ +   R+ AE +N R+RT +
Sbjct: 4   EKRKDPESLNNEDAAERPESDFPEEFRVELEEYKSKSEEYYEMLQRMKAEFDNFRKRTQK 63

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           EK++   Y+  +    +L V DNL RA++S+         K      +   G++M  R+ 
Sbjct: 64  EKEENAKYASEEVIVSLLPVLDNLERAIESS---------KVNRDFDTFSHGVDMILRQF 114

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEE--PHDTVPANTIIKVVQDGYAINERVLRPA 181
           +  +E +G+  I+A  + F+PN+H+A+ +E   HD    N I++ +Q GY + E+V+RP+
Sbjct: 115 VKVMEGHGLAAIEALGRDFDPNLHEALIQEESEHDE---NIILEELQKGYLLKEKVIRPS 171

Query: 182 LVSISK 187
           +V +SK
Sbjct: 172 MVKVSK 177


>gi|319940929|ref|ZP_08015267.1| grpE protein [Sutterella wadsworthensis 3_1_45B]
 gi|319805645|gb|EFW02433.1| grpE protein [Sutterella wadsworthensis 3_1_45B]
          Length = 213

 Score = 97.8 bits (242), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 53/149 (35%), Positives = 86/149 (57%), Gaps = 13/149 (8%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E  D Y+R +A++EN RRR+  E    + ++I KFA ++L V D+L +AL++   D  ++
Sbjct: 76  EHYDLYVRAMADLENARRRSSEELVKTRKFAIEKFAENLLPVVDSLEKALEATAADKDSA 135

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQA--MFEEPHDTVP 159
            +          EG+E T R++M  L+   +K ID K + F+P+ H A  M   P    P
Sbjct: 136 AR----------EGMEATYRQLMHALDVSDMKPIDPKGEAFDPHFHMAITMVPAPEGVKP 185

Query: 160 ANTIIKVVQDGYAINERVLRPALVSISKG 188
              +++V Q G+ I  RVLRPA+VS+++G
Sbjct: 186 -GMVVQVFQRGWNIAGRVLRPAMVSVAQG 213


>gi|86153319|ref|ZP_01071523.1| co-chaperone GrpE [Campylobacter jejuni subsp. jejuni HB93-13]
 gi|283957260|ref|ZP_06374721.1| heat shock protein GrpE [Campylobacter jejuni subsp. jejuni 1336]
 gi|85843045|gb|EAQ60256.1| co-chaperone GrpE [Campylobacter jejuni subsp. jejuni HB93-13]
 gi|283791272|gb|EFC30080.1| heat shock protein GrpE [Campylobacter jejuni subsp. jejuni 1336]
          Length = 176

 Score = 97.8 bits (242), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 54/147 (36%), Positives = 89/147 (60%), Gaps = 10/147 (6%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           +E +DKY+R  AE EN+++R ++EK  A +Y+   FA+D+L V D L  A+        N
Sbjct: 40  DELKDKYMRANAEFENIKKRMEKEKLSAMAYANESFAKDLLDVLDALEAAI--------N 91

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
            E   E  LK + EG++ T    +  LE++GV  I  ++++F+PN+H+AMF    +   +
Sbjct: 92  VECHDEISLK-IKEGVQNTLDLFLKKLEKHGVALI-KEEKEFDPNLHEAMFHVDSENHQS 149

Query: 161 NTIIKVVQDGYAINERVLRPALVSISK 187
             ++ V+Q GY I +RV+RP  VS++K
Sbjct: 150 GEVVTVLQKGYKIADRVIRPTKVSVAK 176


>gi|227534941|ref|ZP_03964990.1| molecular chaperone GrpE (heat shock protein) [Lactobacillus
           paracasei subsp. paracasei ATCC 25302]
 gi|227187398|gb|EEI67465.1| molecular chaperone GrpE (heat shock protein) [Lactobacillus
           paracasei subsp. paracasei ATCC 25302]
          Length = 222

 Score = 97.8 bits (242), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 86/148 (58%), Gaps = 10/148 (6%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           ++F DKYLR  AE++N+  R ++E++    Y   K A+ +L V DNL RAL         
Sbjct: 84  DDFEDKYLRAAAEIQNMNARFEKEQQKLLKYDGQKLAKAILPVVDNLERAL--------A 135

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FEEPHDTVP 159
           +E K +S + SL +G++M    +   L+  G+  ID    KF+PN  QA+      D  P
Sbjct: 136 TEAKDDSAV-SLKKGVQMVYDHLERALKENGITAIDGAGDKFDPNTQQAVQTVAADDQHP 194

Query: 160 ANTIIKVVQDGYAINERVLRPALVSISK 187
           A+T+ +V+Q GY + +RVLRPA+V ++K
Sbjct: 195 ADTVAQVLQKGYYLKDRVLRPAMVVVAK 222


>gi|210134313|ref|YP_002300752.1| heat shock protein GrpE [Helicobacter pylori P12]
 gi|226737140|sp|B6JPL1|GRPE_HELP2 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|210132281|gb|ACJ07272.1| CO-chaperone and heat shock protein 24 GrpE [Helicobacter pylori
           P12]
          Length = 191

 Score = 97.8 bits (242), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 98/174 (56%), Gaps = 11/174 (6%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
           K   N     A EK E  I E+   + +E  +KYLRV A+ EN+++R +R+K  A  Y+ 
Sbjct: 27  KEQQNEEMQEASEK-ECEIKEDFELKYKEMHEKYLRVHADFENVKKRLERDKSMALEYAY 85

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
            K A D+L V D L  A  SA    A  +K+S     +L +G+E+T  ++   L R+G++
Sbjct: 86  EKIALDLLPVIDALLGAYKSA----AEVDKES-----ALTKGLELTMEKLHEVLARHGIE 136

Query: 134 KIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            I+  ++ F+PN H A+ +   +      I++V+Q GY    RVLRPA+VSI+K
Sbjct: 137 GIECLEE-FDPNFHNAIMQVKSEEKENGKIVQVLQQGYKYKGRVLRPAMVSIAK 189


>gi|121612117|ref|YP_001000442.1| co-chaperone protein GrpE [Campylobacter jejuni subsp. jejuni
           81-176]
 gi|167005385|ref|ZP_02271143.1| co-chaperone protein GrpE [Campylobacter jejuni subsp. jejuni
           81-176]
 gi|87249352|gb|EAQ72312.1| co-chaperone protein GrpE [Campylobacter jejuni subsp. jejuni
           81-176]
 gi|107770371|gb|ABF83708.1| GrpE-like protein [Campylobacter jejuni subsp. jejuni 81-176]
          Length = 176

 Score = 97.8 bits (242), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 54/147 (36%), Positives = 89/147 (60%), Gaps = 10/147 (6%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           +E +DKY+R  AE EN+++R ++EK  A +Y+   FA+D+L V D L  A+        N
Sbjct: 40  DELKDKYMRANAEFENIKKRMEKEKLSAMAYANESFAKDLLDVLDALEAAI--------N 91

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
            E   E  LK + EG++ T    +  LE++GV  I  ++++F+PN+H+AMF    +   +
Sbjct: 92  VECHDEISLK-IKEGVQNTLDLFLKKLEKHGVALI-KEEKEFDPNLHEAMFHVDSENHQS 149

Query: 161 NTIIKVVQDGYAINERVLRPALVSISK 187
             ++ V+Q GY I +RV+RP  VS++K
Sbjct: 150 GEVVTVLQKGYKIADRVIRPTKVSVAK 176


>gi|294340480|emb|CAZ88861.1| Protein grpE (HSP-70 cofactor) [Thiomonas sp. 3As]
          Length = 176

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 64/183 (34%), Positives = 105/183 (57%), Gaps = 21/183 (11%)

Query: 14  KNPSNANSSTAEEKSEINIPE----ESLNQSEE----FRDKYLRVIAEMENLRRRTDREK 65
           + P + +  TA+   +  IPE    + L Q++E      D+ LR  AE+EN+RRR + E 
Sbjct: 6   QTPPSDDPQTADGVHQELIPEPVLSDELAQAQEEITKLNDQLLRARAEVENIRRRAEDEA 65

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
             A+ +++  FA  +L V D+L  A       LA++  K + VLK   +G+E+T  ++ S
Sbjct: 66  AKARKFAVEGFAESLLPVKDSLEAA-------LADTSGKPD-VLK---QGVELTLSQLKS 114

Query: 126 TLERYGVKKI-DAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
             ER  + +I  A   KF+P +HQA+  +P +  P+ T++ V+Q GY I ER LRPALV+
Sbjct: 115 AFERNRLLEIAPAAGDKFDPTLHQAISVQPAEQ-PSGTVVSVLQKGYRIAERTLRPALVT 173

Query: 185 ISK 187
           +++
Sbjct: 174 VAQ 176


>gi|187922742|ref|YP_001894384.1| GrpE protein [Burkholderia phytofirmans PsJN]
 gi|226737117|sp|B2SXC5|GRPE_BURPP RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|187713936|gb|ACD15160.1| GrpE protein [Burkholderia phytofirmans PsJN]
          Length = 194

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 56/166 (33%), Positives = 94/166 (56%), Gaps = 16/166 (9%)

Query: 28  SEINIPEESLNQSE----EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSV 83
           S +N  + +L ++E    E ++ +LR  AE EN+RRR   +   A  ++I  FA  +L V
Sbjct: 41  SPVNAEQSALAEAEAKIAELQESFLRAKAETENVRRRAQEDVAKAHKFAIESFAEHLLPV 100

Query: 84  SDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFN 143
            D+L  A+  +  D           L+ + EG+E+T R++   LE+  V  ++   +KF+
Sbjct: 101 IDSLEAAVAHSSDD-----------LQKVREGVELTLRQLTGALEKGRVVALNPVGEKFD 149

Query: 144 PNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
           P+ HQA+   P +  P NT++ V+Q G+ I +RVLRPALV+++  K
Sbjct: 150 PHRHQAISMVPAEQEP-NTVVAVLQKGFVIADRVLRPALVTVAAPK 194


>gi|332528802|ref|ZP_08404779.1| heat shock protein GrpE [Hylemonella gracilis ATCC 19624]
 gi|332041868|gb|EGI78217.1| heat shock protein GrpE [Hylemonella gracilis ATCC 19624]
          Length = 174

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 86/155 (55%), Gaps = 19/155 (12%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRAL---DSAP 95
           +S E  D+YLR  A+++N RRR D E   A+ ++I  FA  +L V+D+L   L   D+ P
Sbjct: 35  KSAELADQYLRAQADVQNARRRADEEISKARKFAIEAFAESLLPVADSLEAGLAIKDATP 94

Query: 96  LDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI-DAKDQKFNPNMHQAMFEEP 154
                           + EG E T R++ + LER  V  I  A   KF+P+ HQA+   P
Sbjct: 95  --------------AQIREGAEATLRQLAAALERNKVIAIAPAPGTKFDPHQHQAISMVP 140

Query: 155 HDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
            +   ANT++ V+Q GY I +RVLRPALV+++  K
Sbjct: 141 AEQ-EANTVVSVLQKGYTIADRVLRPALVTVAAPK 174


>gi|94970270|ref|YP_592318.1| GrpE protein [Candidatus Koribacter versatilis Ellin345]
 gi|94552320|gb|ABF42244.1| GrpE protein [Candidatus Koribacter versatilis Ellin345]
          Length = 181

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 97/184 (52%), Gaps = 12/184 (6%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
           +E+ +D E     A + TA   ++  I E    + +++ D+  R+ AE +N R+R  RE+
Sbjct: 10  TEEQLDVEHELPAAENETAATSADAEI-EALRKERDQYLDRLARLQAEFDNFRKRNAREQ 68

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
           +D + Y++    +  L + D+L  A  S   DL             +  GIE+  R+   
Sbjct: 69  QDYRDYAVVDALKTFLPILDSLDGAAKSDAQDL-----------DQIRSGIELIDRQFHD 117

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
            L + GV+ I A+ Q F+PN+H A+  E  D  P NT+I  +Q GY I +R+LRPA+V +
Sbjct: 118 ALAKLGVQPIPAEGQPFDPNLHMAIAMEDTDAAPDNTVIGELQRGYKIKDRLLRPAMVRV 177

Query: 186 SKGK 189
           ++ K
Sbjct: 178 ARSK 181


>gi|308182284|ref|YP_003926411.1| heat shock protein GrpE [Helicobacter pylori PeCan4]
 gi|308064469|gb|ADO06361.1| heat shock protein GrpE [Helicobacter pylori PeCan4]
          Length = 190

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 98/169 (57%), Gaps = 15/169 (8%)

Query: 24  AEEKSEIN-----IPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFAR 78
            EEK E++     I E+   + +E  +KYLRV A+ EN+++R +R+K  A  Y+  K A 
Sbjct: 30  GEEKQEVSEKEGEIKEDFELKYKEMHEKYLRVHADFENVKKRLERDKSMALEYAYEKIAL 89

Query: 79  DMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
           D+L V D L  A  SA      +E+  ES   +L +G+E+T  ++   L R+G++ I+  
Sbjct: 90  DLLPVIDALLGAYKSA------AEENKES---ALTKGLELTMEKLHEVLARHGIEGIECL 140

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           ++ F+PN H A+ +   +      I++V+Q GY    RVLRPA+VSI+K
Sbjct: 141 EE-FDPNFHNAIMQVKSEEKENGKIVQVLQQGYKYKGRVLRPAMVSIAK 188


>gi|121715940|ref|XP_001275579.1| mitochondrial co-chaperone GrpE, putative [Aspergillus clavatus
           NRRL 1]
 gi|119403736|gb|EAW14153.1| mitochondrial co-chaperone GrpE, putative [Aspergillus clavatus
           NRRL 1]
          Length = 250

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/156 (34%), Positives = 92/156 (58%), Gaps = 12/156 (7%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAP---LDL 98
           + +DKY+R +A+  NL+ RT R+ ++A++++I +FA D+L   DN  RAL + P   LD 
Sbjct: 95  DLKDKYVRSVADFLNLQERTKRDMENARNFAIQRFAIDLLESIDNFDRALLAVPREKLDA 154

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI-------DAKDQKFNPNMHQAMF 151
             +E   + +   L++G++MT+  +M+TL+++G+++        D K QKF+PN H+A F
Sbjct: 155 TLTEHNKDML--DLVDGLKMTQNILMNTLQKHGLERFDPSEPAEDGKPQKFDPNYHEATF 212

Query: 152 EEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
               +      II     G+ +N RVLR A V + K
Sbjct: 213 MTKAEGKEDGEIIHTQTKGFKLNGRVLRAAKVGVVK 248


>gi|197119868|ref|YP_002140295.1| heat shock protein GrpE [Geobacter bemidjiensis Bem]
 gi|226737137|sp|B5EC43|GRPE_GEOBB RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|197089228|gb|ACH40499.1| DnaJ adenine nucleotide exchange factor GrpE [Geobacter
           bemidjiensis Bem]
          Length = 188

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 109/196 (55%), Gaps = 32/196 (16%)

Query: 10  IDKEKNPSNAN---SSTAEEKSEINIP----------EESLN----QSEEFRDKYLRVIA 52
           +DK+K+ S+ +   +  ++EK E+  P          EE+L     +S    DKYLR  A
Sbjct: 1   MDKKKHDSHQHEKKADASQEKVEVAQPLSDADRIKELEEALAAKGLESAANWDKYLRERA 60

Query: 53  EMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSL 112
           ++EN R+R  +EK++   Y   +   ++L   DNL RA+D A     N E        ++
Sbjct: 61  DLENYRKRVQKEKEEILKYGKEEVIMEILPALDNLERAIDHA-----NEES-------AI 108

Query: 113 IEGIEMTRREMMSTLERYGVKKIDA-KDQKFNPNMHQAMFE-EPHDTVPANTIIKVVQDG 170
           +EG+ +T   ++S L+++GV  ++  +   FNP  HQAM + E  D  P NTI+ V Q G
Sbjct: 109 VEGVRLTLSMLLSALKKFGVTPVETPQGTPFNPEFHQAMGQVESADQEP-NTIVAVFQKG 167

Query: 171 YAINERVLRPALVSIS 186
           Y +NER+LRPA+V+++
Sbjct: 168 YLLNERLLRPAMVTVA 183


>gi|332285185|ref|YP_004417096.1| putative GrpE chaperone [Pusillimonas sp. T7-7]
 gi|330429138|gb|AEC20472.1| putative GrpE chaperone [Pusillimonas sp. T7-7]
          Length = 200

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 84/150 (56%), Gaps = 13/150 (8%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           ++ D+ LR  AE EN+RRR   +   A+ +    FA  ++ V D+L  AL          
Sbjct: 61  QYHDELLRARAETENIRRRAQDDVAKARKFGTESFAESLIPVKDSLEAAL---------- 110

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID-AKDQKFNPNMHQAMFEEPHDTVPA 160
              +E    +  EG+E T R++ +  ER  +K +  A+  KF+P++HQA+   P +  P 
Sbjct: 111 -ALTEQTADAWKEGVEATLRQLNTAFERNLLKDVAPAQGDKFDPHLHQAISSVPSE-FPE 168

Query: 161 NTIIKVVQDGYAINERVLRPALVSISKGKT 190
            T+++++Q GY I +RVLRPALV +S GKT
Sbjct: 169 GTVVQLLQKGYTIADRVLRPALVMVSSGKT 198


>gi|323704202|ref|ZP_08115781.1| GrpE protein [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323536268|gb|EGB26040.1| GrpE protein [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 206

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 57/155 (36%), Positives = 87/155 (56%), Gaps = 12/155 (7%)

Query: 37  LNQSEEFRDKYL----RVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALD 92
           L Q E+  ++YL    R+ AE EN R+RT++EK D   Y   +   D+L V DN  RAL+
Sbjct: 60  LKQKEDEANEYLEMAQRLKAEFENYRKRTEKEKADLIEYGKEQVILDILPVVDNFERALE 119

Query: 93  SAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFE 152
           +   D  N E      + S  EG+ +  R+    LE+ GVK+I++  Q F+P  H A+ +
Sbjct: 120 ATHSD--NEE------IASFKEGVNLIYRQFKGVLEKLGVKEIESLGQIFDPYKHHAVMQ 171

Query: 153 EPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           E  +    N II+V Q GY  N +V+RP++V ++K
Sbjct: 172 EEAEDKKENEIIEVFQKGYMFNNKVIRPSMVKVAK 206


>gi|45185804|ref|NP_983520.1| ACR118Wp [Ashbya gossypii ATCC 10895]
 gi|52782892|sp|Q75C01|GRPE_ASHGO RecName: Full=GrpE protein homolog, mitochondrial; Flags: Precursor
 gi|44981559|gb|AAS51344.1| ACR118Wp [Ashbya gossypii ATCC 10895]
          Length = 212

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 85/150 (56%), Gaps = 6/150 (4%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS-APLD 97
           ++ + +D+ LR +A+  NL+  T R+ + A+ +++ +F++D+L   DN   AL + +P  
Sbjct: 64  EAADLKDRLLRSVADFRNLQEVTRRDVQKARDFALQRFSKDLLESLDNFGHALGAVSPEA 123

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
           L  S +     +  L  G+ +TR     TL ++G+  IDA  Q F+PN+H+A FE P   
Sbjct: 124 LQRSPE-----IADLHAGVRLTRDVFEKTLLKHGIAPIDALGQPFDPNLHEATFELPQPD 178

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISK 187
               T+  V Q GY +N RV+RPA V + K
Sbjct: 179 KTPGTVFHVQQPGYTLNGRVIRPAKVGVVK 208


>gi|148262293|ref|YP_001228999.1| heat shock protein GrpE [Geobacter uraniireducens Rf4]
 gi|189041742|sp|A5GDC7|GRPE_GEOUR RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|146395793|gb|ABQ24426.1| GrpE protein [Geobacter uraniireducens Rf4]
          Length = 199

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/143 (37%), Positives = 82/143 (57%), Gaps = 11/143 (7%)

Query: 45  DKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKK 104
           DK LR  A++EN R+R  +EK++   Y       ++L   DN+ RAL+ A          
Sbjct: 61  DKVLRERADLENYRKRVQKEKEELLKYGNESLILEILPAIDNMERALEHA---------- 110

Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKIDA-KDQKFNPNMHQAMFEEPHDTVPANTI 163
            +  + +++EGI+MT   + STL+++GV  +DA K   F+P  HQAM +        NTI
Sbjct: 111 CDESMSAIVEGIKMTLCMLQSTLKKFGVAPVDAGKGTTFDPAYHQAMNQVESSEHEPNTI 170

Query: 164 IKVVQDGYAINERVLRPALVSIS 186
           +   Q GY +NER+LRPALVS++
Sbjct: 171 VSEFQKGYLLNERLLRPALVSVA 193


>gi|209520589|ref|ZP_03269344.1| GrpE protein [Burkholderia sp. H160]
 gi|209498982|gb|EDZ99082.1| GrpE protein [Burkholderia sp. H160]
          Length = 198

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 85/148 (57%), Gaps = 12/148 (8%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           E ++ +LR  AE EN+RRR   +   A  ++I  FA  +L V D+L  A+  +  D    
Sbjct: 63  ELQESFLRAKAETENVRRRAQEDVTKAHKFAIESFAEHLLPVIDSLEAAVTHSSDD---- 118

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
                  L+ + EG+E+T R++   LE+  V  I+   +KF+P+ HQA+   P D  P N
Sbjct: 119 -------LQKVREGVELTLRQLNGALEKGRVVAINPVGEKFDPHRHQAISMVPADQEP-N 170

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGK 189
           T++ V+Q G+ I +RVLRPALV+++  K
Sbjct: 171 TVVAVLQKGFVIADRVLRPALVTVAAPK 198


>gi|108562535|ref|YP_626851.1| heat shock protein GrpE [Helicobacter pylori HPAG1]
 gi|123247051|sp|Q1CV45|GRPE_HELPH RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|107836308|gb|ABF84177.1| co-chaperone and heat shock protein 24 [Helicobacter pylori HPAG1]
          Length = 191

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 93/159 (58%), Gaps = 10/159 (6%)

Query: 29  EINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLS 88
           E  I E+   + +E  +KYLRV A+ EN+++R +R+K  A  Y+  K A D+L V D L 
Sbjct: 41  ECEIKEDFELKYKEMHEKYLRVHADFENVKKRLERDKSMALEYAYEKIALDLLPVIDALL 100

Query: 89  RALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQ 148
            A  SA      +E+  ES   +L +G+E+T  ++   L R+G++ I+  ++ F+PN H 
Sbjct: 101 GAYKSA------AEENKES---ALTKGLELTMEKLHEVLARHGIEGIECLEE-FDPNFHN 150

Query: 149 AMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           A+ +   +      I++V+Q GY    RVLRPA+VSI+K
Sbjct: 151 AIMQVKSEEKENGKIVQVLQQGYKYKGRVLRPAMVSIAK 189


>gi|299144171|ref|ZP_07037251.1| co-chaperone GrpE [Peptoniphilus sp. oral taxon 386 str. F0131]
 gi|298518656|gb|EFI42395.1| co-chaperone GrpE [Peptoniphilus sp. oral taxon 386 str. F0131]
          Length = 177

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/144 (32%), Positives = 86/144 (59%), Gaps = 12/144 (8%)

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D++LR+ A+  N +RRT+ E+K+       K   +++ + DN  RA++S          
Sbjct: 46  KDQFLRLQADFANYKRRTEVERKEYIELGTKKVMLELIQIVDNFERAIES---------- 95

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
           K E    +  +G+E+  +++M  LE+ GV ++++ ++KF+PN+H A+  E  D +    +
Sbjct: 96  KGEK--DTFFDGVELIYKQLMELLEKNGVTEMNSLNEKFDPNLHHAVLIEQKDGIEEGIV 153

Query: 164 IKVVQDGYAINERVLRPALVSISK 187
           I+V+Q GY I E+VLR A+V +SK
Sbjct: 154 IEVLQKGYMIGEKVLRSAMVKVSK 177


>gi|253702165|ref|YP_003023354.1| heat shock protein GrpE [Geobacter sp. M21]
 gi|259647652|sp|C6E644|GRPE_GEOSM RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|251777015|gb|ACT19596.1| GrpE protein [Geobacter sp. M21]
          Length = 186

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 108/196 (55%), Gaps = 32/196 (16%)

Query: 10  IDKEKNPSNAN---SSTAEEKSEINIP----------EESLN----QSEEFRDKYLRVIA 52
           +DK+K+ S+ +   +  ++EK E+  P          EE+L     +S    DKYLR  A
Sbjct: 1   MDKKKHDSHQHEKKADASQEKVEVAQPVSDADRIKELEEALAAKGLESAANWDKYLRERA 60

Query: 53  EMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSL 112
           ++EN R+R  +EK++   Y   +   ++L   DNL RA+D A     N E        ++
Sbjct: 61  DLENYRKRVQKEKEEILKYGKEEIIVEILPALDNLERAIDHA-----NEES-------AI 108

Query: 113 IEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFE-EPHDTVPANTIIKVVQDG 170
           +EG+ +T   ++S L+++GV  +D      FNP  HQAM + E  D  P NT++ V Q G
Sbjct: 109 VEGVRLTLSMLLSALKKFGVTPVDTPPGTPFNPEYHQAMGQVESADQEP-NTVVAVFQKG 167

Query: 171 YAINERVLRPALVSIS 186
           Y +NER+LRPA+V+++
Sbjct: 168 YLLNERLLRPAMVTVA 183


>gi|81428848|ref|YP_395848.1| Co-chaperone protein GrpE [Lactobacillus sakei subsp. sakei 23K]
 gi|123755827|sp|Q38W92|GRPE_LACSS RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|78610490|emb|CAI55541.1| Co-chaperone protein GrpE [Lactobacillus sakei subsp. sakei 23K]
          Length = 200

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 87/144 (60%), Gaps = 10/144 (6%)

Query: 45  DKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKK 104
           D +LR  AE++N++ R  +E+ +   Y     A+D+L V DNL RAL         +E  
Sbjct: 66  DSFLRSQAEIKNIQMRNQKEQANLLKYDGQSLAKDVLPVLDNLERAL--------AAEAT 117

Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT-VPANTI 163
            ES  +SL +G++MT   M   LE +GVK+I+A+ Q F+P +HQA+     D    A+T+
Sbjct: 118 DESA-ESLKKGVQMTYDHMKHALEDHGVKEIEAQGQAFDPTIHQAVQTVAVDGDQKADTV 176

Query: 164 IKVVQDGYAINERVLRPALVSISK 187
           ++V Q GY + +RVLRPA+V +++
Sbjct: 177 VQVFQKGYYLKDRVLRPAMVVVAQ 200


>gi|77735951|ref|NP_001029673.1| grpE protein homolog 1, mitochondrial precursor [Bos taurus]
 gi|110278995|sp|Q3SZC1|GRPE1_BOVIN RecName: Full=GrpE protein homolog 1, mitochondrial; AltName:
           Full=Mt-GrpE#1; Short=mt-GrpE; Flags: Precursor
 gi|74267846|gb|AAI02965.1| GrpE-like 1, mitochondrial (E. coli) [Bos taurus]
 gi|296486263|gb|DAA28376.1| grpE protein homolog 1, mitochondrial precursor [Bos taurus]
          Length = 217

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 85/150 (56%), Gaps = 3/150 (2%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           Q +E  +KY R +A+ ENLR+R+ +  ++A+ Y I  F +D+L V+D L +A    P + 
Sbjct: 70  QLKETMEKYKRALADTENLRQRSQKLVEEAKLYGIQGFCKDLLEVADILEKATQCVPQEE 129

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
              +      LKSL EG+ MT  ++     ++G+ +++    KF+P  H+A+F  P +  
Sbjct: 130 IRDDNPH---LKSLYEGLVMTEVQIQKVFTKHGLLRLNPLGAKFDPYEHEALFHTPVEGK 186

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISKG 188
              T+  V + GY ++ R LRPALV + KG
Sbjct: 187 EPGTVALVNKVGYKLHGRTLRPALVGVVKG 216


>gi|116333936|ref|YP_795463.1| molecular chaperone GrpE (heat shock protein) [Lactobacillus brevis
           ATCC 367]
 gi|116099283|gb|ABJ64432.1| Molecular chaperone GrpE (heat shock protein) [Lactobacillus brevis
           ATCC 367]
          Length = 194

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/149 (35%), Positives = 86/149 (57%), Gaps = 10/149 (6%)

Query: 40  SEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLA 99
           + +F DKYLR  AE++N++ R  +E+     Y   + A+D+L V DNL RAL        
Sbjct: 55  AADFEDKYLRAEAEVQNMQARFQKEQATLIKYDGQQLAKDVLPVIDNLERAL-------- 106

Query: 100 NSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEP-HDTV 158
            + + S+ V   + +G++MT   +   L+R  V +I A  Q F+P +HQA+   P  D  
Sbjct: 107 -AVEASDDVAAQIKKGVQMTYDHLEDALKRNHVTEIAALGQTFDPTLHQAVQSVPAEDGQ 165

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISK 187
            A T++ V+Q GY + +RVLRPA+V +++
Sbjct: 166 TAETVVNVLQKGYQLKDRVLRPAMVVVAQ 194


>gi|19113469|ref|NP_596677.1| mitochondrial GrpE domain chaperone protein [Schizosaccharomyces
           pombe 972h-]
 gi|6225482|sp|O43047|GRPE_SCHPO RecName: Full=GrpE protein homolog, mitochondrial; Flags: Precursor
 gi|2950485|emb|CAA17799.1| mitochondrial GrpE domain chaperone protein [Schizosaccharomyces
           pombe]
          Length = 223

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 80/138 (57%), Gaps = 1/138 (0%)

Query: 51  IAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLK 110
           +A+  NL  R  R+ +  +++++ K  +D+L   DNL RAL   P +  N+ ++S   L 
Sbjct: 85  LADYRNLENRMKRDMEQTRAFAVQKLTKDLLDSVDNLERALSIVPEEKRNN-RESNKDLV 143

Query: 111 SLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDG 170
            L EG+ MT   +M TL +YG+ + D   + F+PN+H+A+F+ P +    NT+      G
Sbjct: 144 DLYEGLAMTESNLMKTLGKYGLVRYDGIGEDFDPNIHEAVFQIPVEGKKPNTVFHCESKG 203

Query: 171 YAINERVLRPALVSISKG 188
           + +N RV+RPA V + KG
Sbjct: 204 FQLNGRVIRPAKVGVVKG 221


>gi|6225478|sp|O87776|GRPE_LACSK RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|3688418|emb|CAA06940.1| heat shock protein GrpE [Lactobacillus sakei]
          Length = 197

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/144 (36%), Positives = 86/144 (59%), Gaps = 13/144 (9%)

Query: 45  DKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKK 104
           D +LR  AE++N++ R  +E+ +   Y     A+D+L V DNL RAL             
Sbjct: 66  DSFLRSQAEIKNIQMRNQKEQANLLKYDGQSLAKDVLPVLDNLERAL------------A 113

Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT-VPANTI 163
           +E+  +SL +G++MT   M   LE +GVK+I+A+ Q F+P +HQA+     D    A+T+
Sbjct: 114 AEATDESLKKGVQMTYDHMKHALEDHGVKEIEAQGQAFDPTIHQAVQTVAVDGDQKADTV 173

Query: 164 IKVVQDGYAINERVLRPALVSISK 187
           ++V Q GY + +RVLRPA+V +++
Sbjct: 174 VQVFQKGYYLKDRVLRPAMVVVAQ 197


>gi|325847859|ref|ZP_08170081.1| co-chaperone GrpE [Anaerococcus hydrogenalis ACS-025-V-Sch4]
 gi|325480877|gb|EGC83930.1| co-chaperone GrpE [Anaerococcus hydrogenalis ACS-025-V-Sch4]
          Length = 178

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 89/157 (56%), Gaps = 12/157 (7%)

Query: 31  NIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRA 90
           N+  +  N   E+++KY R++A+  N ++R ++ + D + ++ +    ++L V DN  RA
Sbjct: 34  NVEGDLSNDDNEYKEKYQRLLADFTNFKKREEKARNDFKKFASSNLIEELLPVLDNFDRA 93

Query: 91  LDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM 150
           L            K +    S ++GI MTR  +   LE+ G+++I++   +F+PN H A 
Sbjct: 94  L------------KDQDKDDSFVQGIVMTRDSLWKVLEKEGLEEIESDGVEFDPNFHHAF 141

Query: 151 FEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
             E ++   +N II+  Q GY +N+RV+RP++V ++K
Sbjct: 142 QTEENEDFKSNYIIETYQKGYKLNDRVIRPSMVKVAK 178


>gi|67540156|ref|XP_663852.1| hypothetical protein AN6248.2 [Aspergillus nidulans FGSC A4]
 gi|40739442|gb|EAA58632.1| hypothetical protein AN6248.2 [Aspergillus nidulans FGSC A4]
 gi|259479543|tpe|CBF69861.1| TPA: mitochondrial co-chaperone GrpE, putative (AFU_orthologue;
           AFUA_2G13040) [Aspergillus nidulans FGSC A4]
          Length = 252

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 108/183 (59%), Gaps = 9/183 (4%)

Query: 13  EKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYS 72
           +K+  N ++ TA+E+ +  + E+     E  +DKY+R +A+  NL+ RT R+ ++A++++
Sbjct: 69  QKDNGNESTGTADEQCQKELEEKKKEVIEL-KDKYVRSVADFLNLQERTKRDMENARNFA 127

Query: 73  IAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESV-LKSLIEGIEMTRREMMSTLERYG 131
           I +FA D+L   DN  RAL + P +  N+ K  E+  L  L++G++MT+  +++TL+++G
Sbjct: 128 IQRFAVDLLESIDNFDRALLAVPKEKLNAPKTEENKDLLDLVDGLKMTQNILLNTLQKHG 187

Query: 132 VKKI-------DAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
           +++        D K QKF+P +H+A F    +      I+     G+ +N RVLR A V 
Sbjct: 188 LERFDPGEPGEDGKPQKFDPKIHEATFMTKVEGKENGEIMYTQSKGFTLNGRVLRAAKVG 247

Query: 185 ISK 187
           + K
Sbjct: 248 VVK 250


>gi|258539777|ref|YP_003174276.1| GrpE protein [Lactobacillus rhamnosus Lc 705]
 gi|257151453|emb|CAR90425.1| GrpE protein (HSP-70 Cofactor HSP20) [Lactobacillus rhamnosus Lc
           705]
          Length = 197

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 87/155 (56%), Gaps = 11/155 (7%)

Query: 35  ESLNQSEE-FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93
           E L Q  + F DKYLR  AE++N+  R ++E++    Y   K A+ +L V DNL RAL  
Sbjct: 52  EQLKQERDAFEDKYLRAAAEIQNMNARFEKEQQKMLKYDGQKLAKAILPVVDNLERAL-- 109

Query: 94  APLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM-FE 152
                  +E K +S   SL +G++M    +   L+  G+  ID    KF+PN  QA+   
Sbjct: 110 ------ATEAKDDSA-ASLKKGVQMVYDHLERALKENGITAIDGAGDKFDPNTQQAVQTV 162

Query: 153 EPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
              D  PA+T+ +V+Q GY + +RVLRPA+V ++K
Sbjct: 163 AADDQHPADTVAQVLQKGYYLKDRVLRPAMVVVAK 197


>gi|171464078|ref|YP_001798191.1| GrpE protein [Polynucleobacter necessarius subsp. necessarius
           STIR1]
 gi|226737154|sp|B1XRU2|GRPE_POLNS RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|171193616|gb|ACB44577.1| GrpE protein [Polynucleobacter necessarius subsp. necessarius
           STIR1]
          Length = 182

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 99/172 (57%), Gaps = 17/172 (9%)

Query: 23  TAEEKSEINIPEES---LNQS-EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFAR 78
           T  E   +  PE+    LNQ   E +D +LR  AE EN+RRR   +   A  ++I  FA 
Sbjct: 23  TTAETPAVKTPEQEVAELNQKIGELQDNFLRAKAEGENIRRRAVEDIAKAHKFAIESFAE 82

Query: 79  DMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID-A 137
            ++ V+D+L  AL++   D  ++        K+  EG+E+T ++++S  E+  + +I+ A
Sbjct: 83  HLVPVTDSLYAALNT---DAGDA--------KAFKEGLEITLKQLLSAFEKGRMTEINPA 131

Query: 138 KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
              KF+P+ HQA+   P +   +NT++ V+Q GY + +RVLRPALV++S  K
Sbjct: 132 VGDKFDPHHHQAIASVPSEQ-ESNTVVSVLQRGYTVADRVLRPALVTVSAPK 182


>gi|322391401|ref|ZP_08064871.1| heat shock protein GrpE [Streptococcus peroris ATCC 700780]
 gi|321145827|gb|EFX41218.1| heat shock protein GrpE [Streptococcus peroris ATCC 700780]
          Length = 179

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 94/161 (58%), Gaps = 17/161 (10%)

Query: 26  EKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSD 85
           EKSE+++  E   ++EEF +KYLR  AEM+N++RR + E++  Q Y     A+ +L   D
Sbjct: 33  EKSELDLANE---RAEEFENKYLRAHAEMQNIQRRANEERQQLQKYRSQDLAKAILPSLD 89

Query: 86  NLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPN 145
           NL RAL              E +   + +G+EM +  ++  L+  G+++I A D +F+ N
Sbjct: 90  NLERAL------------AVEGLTDDVKKGLEMVQESLVHALKEEGIEEI-AADGEFDHN 136

Query: 146 MHQAMFEEPHDT-VPANTIIKVVQDGYAINERVLRPALVSI 185
            H A+   P D   PA+TI +V Q GY +++R+LRPA+V +
Sbjct: 137 YHMAIQTVPADDEHPADTIAQVFQKGYKLHDRILRPAMVVV 177


>gi|238898816|ref|YP_002924498.1| Hsp 24 nucleotide exchange factor [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
 gi|229466576|gb|ACQ68350.1| Hsp 24 nucleotide exchange factor [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
          Length = 221

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/145 (35%), Positives = 85/145 (58%), Gaps = 9/145 (6%)

Query: 47  YLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSE 106
            LR  A  +N+ R T R+ + A  +++ KFA D+L V DNL RAL++          KSE
Sbjct: 84  LLRHKANEQNIHRSTQRDIEKAHKFALQKFAYDLLPVIDNLERALETV--------NKSE 135

Query: 107 SVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIK 165
                +IEGIE+T + ++ T+ ++G++ ++++ +  FNP++HQA+     D    N I  
Sbjct: 136 KGANPIIEGIELTLKSLLDTVNKFGIEVVESECNLPFNPDIHQAVGVVESDMHEPNHITS 195

Query: 166 VVQDGYAINERVLRPALVSISKGKT 190
           +V  GY +N R+LRP +V +S  KT
Sbjct: 196 IVCKGYTLNGRLLRPVMVKVSSKKT 220


>gi|223933399|ref|ZP_03625386.1| GrpE protein [Streptococcus suis 89/1591]
 gi|223897966|gb|EEF64340.1| GrpE protein [Streptococcus suis 89/1591]
          Length = 170

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 59/161 (36%), Positives = 95/161 (59%), Gaps = 18/161 (11%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
           KSE+++  E   ++EEF +KYLR  AEM+N++RR + E++  Q Y     A+ +L   DN
Sbjct: 26  KSELDLANE---RAEEFENKYLRAHAEMQNIQRRANEERQTIQRYRSQDLAKKILPSLDN 82

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNM 146
           L RAL            + E + + + +G+EM +  ++  L+  GV+++ A D  F+PN+
Sbjct: 83  LERAL------------QVEGLTEDVKKGLEMVQESLIQALKEEGVEEV-ATD-VFDPNL 128

Query: 147 HQAMFEEPH-DTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           H A+   P  D  PA  I +V Q GY ++ER+LRPA+V +S
Sbjct: 129 HMAIQTVPATDDCPAEHIAQVFQKGYKLHERLLRPAMVVVS 169


>gi|119602776|gb|EAW82370.1| GrpE-like 1, mitochondrial (E. coli), isoform CRA_a [Homo sapiens]
          Length = 174

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 57/173 (32%), Positives = 93/173 (53%), Gaps = 9/173 (5%)

Query: 15  NPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIA 74
           +P     +  EEK ++   EE L ++ E   KY R +A+ ENLR+R+ +  ++A+ Y I 
Sbjct: 9   DPPATEKTLLEEKVKL---EEQLKETVE---KYKRALADTENLRQRSQKLVEEAKLYGIQ 62

Query: 75  KFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKK 134
            F +D+L V+D L +A    P       K     LK+L EG+ MT  ++     ++G+ K
Sbjct: 63  AFCKDLLEVADVLEKATQCVP---KEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLK 119

Query: 135 IDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           ++    KF+P  H+A+F  P +     T+  V + GY ++ R LRPALV + K
Sbjct: 120 LNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVK 172


>gi|71001910|ref|XP_755636.1| mitochondrial co-chaperone GrpE [Aspergillus fumigatus Af293]
 gi|66853274|gb|EAL93598.1| mitochondrial co-chaperone GrpE, putative [Aspergillus fumigatus
           Af293]
 gi|159129693|gb|EDP54807.1| mitochondrial co-chaperone GrpE, putative [Aspergillus fumigatus
           A1163]
          Length = 250

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 91/154 (59%), Gaps = 8/154 (5%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           + +DKY+R +A+  NL+ RT R+ ++A++++I +FA D+L   DN  RAL + P +   +
Sbjct: 95  DLKDKYMRSVADFLNLQERTKRDMENARNFAIQRFAVDLLESIDNFDRALLAVPAEKLKA 154

Query: 102 E-KKSESVLKSLIEGIEMTRREMMSTLERYGVKKI-------DAKDQKFNPNMHQAMFEE 153
           E  +S   L  L+ G+ MT+  +++TL+++G+++        D K QKF+PN+H+A F  
Sbjct: 155 EVTESNKELMDLVSGLRMTQNILLNTLKKHGLERFDPSEPAEDGKPQKFDPNVHEATFMT 214

Query: 154 PHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
             +      II     G+ +N RVLR A V + K
Sbjct: 215 KVEGKEDGDIIHTQTTGFKLNGRVLRAAKVGVVK 248


>gi|222153616|ref|YP_002562793.1| heat shock protein GrpE [Streptococcus uberis 0140J]
 gi|222114429|emb|CAR43231.1| GrpE protein (HSP-70 cofactor) [Streptococcus uberis 0140J]
          Length = 192

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 62/183 (33%), Positives = 106/183 (57%), Gaps = 20/183 (10%)

Query: 6   SEKNIDK--EKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDR 63
           S +N+D+  ++  +N ++S  +EKSE+ I  E   ++EEF +KYLR  AEM+N++RR + 
Sbjct: 25  SAENLDEKADEKKTNDDNSEVDEKSELEIANE---RAEEFENKYLRAHAEMQNIQRRANE 81

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           E++  Q +     A+ +L   DNL RAL              E +   + +GIEM +  +
Sbjct: 82  ERQSLQRFRSQDLAKKILPSLDNLERAL------------AVEGLTDDVKKGIEMVQESL 129

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHD-TVPANTIIKVVQDGYAINERVLRPAL 182
           +  L+  G++++    + F+ N+H A+   P D   PA+TI +V Q GY ++ER+LRPA+
Sbjct: 130 IQALKEEGIEEVPL--ETFDHNIHMAVQTLPADEEHPADTIAQVFQKGYKLHERLLRPAM 187

Query: 183 VSI 185
           V +
Sbjct: 188 VVV 190


>gi|308180800|ref|YP_003924928.1| co-chaperone GrpE [Lactobacillus plantarum subsp. plantarum ST-III]
 gi|308046291|gb|ADN98834.1| co-chaperone GrpE [Lactobacillus plantarum subsp. plantarum ST-III]
          Length = 199

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 99/179 (55%), Gaps = 17/179 (9%)

Query: 17  SNANSSTAEEKSEINIPEESLNQSEEFR-------DKYLRVIAEMENLRRRTDREKKDAQ 69
           + A +ST ++++E     +   Q  + +       D+ LR  AE+ N++ R  +E+    
Sbjct: 30  TQAATSTTDDQAEQTTAVDPTQQITDLKAQLDAKDDQLLRAQAEIVNMQNRNKKEQAALL 89

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
            Y     A+D+L V DNL RAL + P D        +   + L +G+EM    +   L++
Sbjct: 90  KYDGQALAKDVLPVLDNLERAL-ATPAD--------DEAAQQLKKGVEMVYGHLQDALKK 140

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEP-HDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +GV ++ A  +KF+PN+HQA+   P  D  PA+T+++V+Q GY + +R LRPA+V +++
Sbjct: 141 HGVTEVAAAGEKFDPNIHQAVQTVPVDDDHPADTVVQVLQRGYLLKDRTLRPAMVVVAQ 199


>gi|157415029|ref|YP_001482285.1| co-chaperone protein GrpE [Campylobacter jejuni subsp. jejuni
           81116]
 gi|172047107|sp|A8FLH1|GRPE_CAMJ8 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|157385993|gb|ABV52308.1| heat shock protein grpE [Campylobacter jejuni subsp. jejuni 81116]
 gi|307747668|gb|ADN90938.1| Protein grpE [Campylobacter jejuni subsp. jejuni M1]
 gi|315932519|gb|EFV11455.1| grpE family protein [Campylobacter jejuni subsp. jejuni 327]
          Length = 176

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 54/147 (36%), Positives = 88/147 (59%), Gaps = 10/147 (6%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           +E +DKY+R  AE EN+++R ++EK  A +Y+   FA+D+L V D L  A+        N
Sbjct: 40  DELKDKYMRANAEFENIKKRMEKEKLSAMAYANESFAKDLLDVLDALEAAI--------N 91

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
            E   E  LK + EG++ T    +  LE++GV  I  ++++F+PN+H+AMF        +
Sbjct: 92  VECHDEISLK-IKEGVQNTLDLFLKKLEKHGVALI-KEEKEFDPNLHEAMFHVDSQNHQS 149

Query: 161 NTIIKVVQDGYAINERVLRPALVSISK 187
             ++ V+Q GY I +RV+RP  VS++K
Sbjct: 150 GEVVTVLQKGYKIADRVIRPTKVSVAK 176


>gi|77456989|ref|YP_346494.1| GrpE protein [Pseudomonas fluorescens Pf0-1]
 gi|123606015|sp|Q3KIA1|GRPE_PSEPF RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|77380992|gb|ABA72505.1| protein GrpE (HSP-70 cofactor) [Pseudomonas fluorescens Pf0-1]
          Length = 189

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 65/187 (34%), Positives = 110/187 (58%), Gaps = 18/187 (9%)

Query: 7   EKNIDKEKNPSN--ANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           E+ +D +   +N    +S  +  + + + EE L  ++   D+ LRV A+++N+RRR +++
Sbjct: 4   EQTVDTQNPEANQAPEASGDDLATRVQVLEEQLAAAQ---DQSLRVAADLQNVRRRAEQD 60

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALD-SAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
            + A  +++ KFA D+L + D+L R L+ S+P D        ES+ + + EGIE+T +  
Sbjct: 61  VEKAHKFALEKFAGDLLPIVDSLERGLELSSPDD--------ESI-RPMREGIELTLKMF 111

Query: 124 MSTLERYGVKKIDAKD-QKFNPNMHQAM-FEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
             TL RY +  +  ++ + FN   HQAM  +E  D  P N+I+KV Q GY +N R+LRPA
Sbjct: 112 HDTLTRYQLVAVSPQEGEPFNAVEHQAMAMQESADLEP-NSILKVFQKGYQLNGRLLRPA 170

Query: 182 LVSISKG 188
           +V +SK 
Sbjct: 171 MVVVSKA 177


>gi|283954320|ref|ZP_06371841.1| co-chaperone protein GrpE [Campylobacter jejuni subsp. jejuni 414]
 gi|283794119|gb|EFC32867.1| co-chaperone protein GrpE [Campylobacter jejuni subsp. jejuni 414]
          Length = 176

 Score = 96.7 bits (239), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 54/146 (36%), Positives