BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|255764487|ref|YP_003065115.2| heat shock protein [Candidatus
Liberibacter asiaticus str. psy62]
         (219 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|255764487|ref|YP_003065115.2| heat shock protein [Candidatus Liberibacter asiaticus str. psy62]
 gi|254547838|gb|ACT57175.2| heat shock protein [Candidatus Liberibacter asiaticus str. psy62]
          Length = 219

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 219/219 (100%), Positives = 219/219 (100%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR
Sbjct: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR
Sbjct: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP
Sbjct: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180

Query: 181 ALVSISKGKTQNPTEEKKETIEQPSPLDIEERNKTQTKN 219
           ALVSISKGKTQNPTEEKKETIEQPSPLDIEERNKTQTKN
Sbjct: 181 ALVSISKGKTQNPTEEKKETIEQPSPLDIEERNKTQTKN 219


>gi|150395240|ref|YP_001325707.1| heat shock protein GrpE [Sinorhizobium medicae WSM419]
 gi|166215285|sp|A6U5E2|GRPE_SINMW RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|150026755|gb|ABR58872.1| Ribulose-phosphate 3-epimerase [Sinorhizobium medicae WSM419]
          Length = 208

 Score =  151 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 95/200 (47%), Positives = 132/200 (66%), Gaps = 3/200 (1%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E    E+     +  +          +  +  E +  ++ E RDKYLR+ AEM+NLRRRT
Sbjct: 11  EAAAPEEFDAAAQPETAEEPEADVSAAAPDPLELAKAENAELRDKYLRLAAEMDNLRRRT 70

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           +R+ KDA+SYS+A FARDML+VSDNL RALD+ P D   +    ++ LK+LIEG+EMT R
Sbjct: 71  ERDVKDAKSYSVAGFARDMLAVSDNLRRALDAIPADAREA---GDAGLKALIEGVEMTER 127

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
            M++ LER+GVK++D   QKF+PN HQAMFE P+  VP NT+++VVQ GY I ERVLRPA
Sbjct: 128 SMLAALERHGVKQLDPTGQKFDPNFHQAMFEVPNPEVPNNTVVQVVQAGYTIGERVLRPA 187

Query: 182 LVSISKGKTQNPTEEKKETI 201
           +V ++KG  +  + E +   
Sbjct: 188 MVGVAKGGPKAASSEGETPP 207


>gi|220921154|ref|YP_002496455.1| GrpE protein [Methylobacterium nodulans ORS 2060]
 gi|254799599|sp|B8IJD7|GRPE_METNO RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|219945760|gb|ACL56152.1| GrpE protein [Methylobacterium nodulans ORS 2060]
          Length = 226

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 78/183 (42%), Positives = 119/183 (65%), Gaps = 3/183 (1%)

Query: 36  SLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAP 95
              +  + ++K LR +A+MENLRRRT+RE  DA++Y++  FARDML+V+DN+ RALDS P
Sbjct: 43  LEAEKLDLKNKLLRALADMENLRRRTEREVADARTYAVTNFARDMLNVADNVRRALDSVP 102

Query: 96  LDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPH 155
           ++   +    +  LK+L++GIE+T R++  TLER+GV+ ++ + Q+F+PN+HQAMFE P+
Sbjct: 103 VEDRAAA---DGALKALLDGIELTGRDLAKTLERHGVRAVEPQGQRFDPNLHQAMFEVPN 159

Query: 156 DTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQPSPLDIEERNKT 215
             V   T+++VVQ GY I +RVLRPALV +SKG  +     K          +  +    
Sbjct: 160 PDVANGTVVQVVQTGYVIGDRVLRPALVGVSKGGPKAAEASKPAGEAPKPAGEAPKPAGD 219

Query: 216 QTK 218
             K
Sbjct: 220 GQK 222


>gi|218674689|ref|ZP_03524358.1| molecular chaperone heat shock protein [Rhizobium etli GR56]
          Length = 232

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 90/180 (50%), Positives = 126/180 (70%), Gaps = 3/180 (1%)

Query: 19  ANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFAR 78
            N +  EE ++ +  E    ++ E RD+YLR+ AEM+NLRRRT+RE KDA+SYS+A FAR
Sbjct: 26  ENDTVQEETAQPDPLELLKAENSELRDRYLRLAAEMDNLRRRTEREVKDAKSYSVAGFAR 85

Query: 79  DMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
           DML+VSDNL RALD+   +   +    ++ L +LIEG+EMT R M+S LER+GV+K++  
Sbjct: 86  DMLAVSDNLRRALDAISPEAKATA---DAGLTTLIEGVEMTERAMLSALERHGVRKLEPV 142

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKK 198
            QKF+PN H AMFE P+  V  NT+++VVQ G+ I ERVLRPA+V ++KG  +    E +
Sbjct: 143 GQKFDPNFHHAMFEVPNPEVANNTVVQVVQAGFTIGERVLRPAMVGVAKGGPKPAEAETQ 202


>gi|15964131|ref|NP_384484.1| heat shock protein [Sinorhizobium meliloti 1021]
 gi|307301276|ref|ZP_07581038.1| GrpE protein [Sinorhizobium meliloti BL225C]
 gi|307317947|ref|ZP_07597384.1| GrpE protein [Sinorhizobium meliloti AK83]
 gi|52782969|sp|Q92SK0|GRPE_RHIME RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|15073307|emb|CAC41815.1| Probable heat shock protein [Sinorhizobium meliloti 1021]
 gi|306896349|gb|EFN27098.1| GrpE protein [Sinorhizobium meliloti AK83]
 gi|306903732|gb|EFN34319.1| GrpE protein [Sinorhizobium meliloti BL225C]
          Length = 208

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 97/200 (48%), Positives = 132/200 (66%), Gaps = 3/200 (1%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E    E+     +  +          +  +  E +  +S E RDKYLR+ AEM+NLRRRT
Sbjct: 11  EAAAPEEFETAAEPQAAEKPEADASTTAPDPLELARAESAELRDKYLRLAAEMDNLRRRT 70

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           +R+ KDA+SYS+A FARDML+VSDNL RALD+ P D   +    ++ LK+LIEG+EMT R
Sbjct: 71  ERDVKDAKSYSVAGFARDMLAVSDNLRRALDAIPADAREA---GDAGLKALIEGVEMTER 127

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
            M++ LER+GVK++D   QKF+PN HQAMFE P+  VP NT+++VVQ GY I ERVLRPA
Sbjct: 128 SMLAALERHGVKQLDPTGQKFDPNFHQAMFEVPNTEVPNNTVVQVVQAGYTIGERVLRPA 187

Query: 182 LVSISKGKTQNPTEEKKETI 201
           +V ++KG  +  T E +   
Sbjct: 188 MVGVAKGGPKAATSESETPA 207


>gi|170740424|ref|YP_001769079.1| ribulose-phosphate 3-epimerase [Methylobacterium sp. 4-46]
 gi|168194698|gb|ACA16645.1| Ribulose-phosphate 3-epimerase [Methylobacterium sp. 4-46]
          Length = 207

 Score =  149 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 78/160 (48%), Positives = 114/160 (71%), Gaps = 3/160 (1%)

Query: 42  EFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS 101
           + +DK LR +A+MENLRRRT+RE  DA++Y++  FARDML+V+DN+ RALDS P +   +
Sbjct: 51  DLKDKLLRTLADMENLRRRTEREVADARTYAVTNFARDMLNVADNVRRALDSVPAEARAA 110

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
               E   K+L++GI++T R++  TLER+GV+ +D + Q+F+PN+HQAMFE P+  V + 
Sbjct: 111 A---EGPFKALLDGIDLTGRDLAKTLERHGVRPVDPQGQRFDPNLHQAMFEVPNPDVASG 167

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETI 201
           T+++VVQ GY I ERVLRPALV ++KG  +     K    
Sbjct: 168 TVVQVVQTGYVIGERVLRPALVGVAKGGPKAGEAGKPAEA 207


>gi|39933408|ref|NP_945684.1| heat shock protein GrpE [Rhodopseudomonas palustris CGA009]
 gi|39647254|emb|CAE25775.1| possible heat shock protein (HSP-70 COFACTOR), grpE
           [Rhodopseudomonas palustris CGA009]
          Length = 208

 Score =  149 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 86/203 (42%), Positives = 126/203 (62%), Gaps = 12/203 (5%)

Query: 4   FMSEKNIDKEKNPSNANSSTAE---------EKSEINIPEESLNQSEEFRDKYLRVIAEM 54
            M+E +  K+ N   A ++            +  E    E  + ++ + RDK LR +AEM
Sbjct: 1   MMTETDGQKDNNQDTAQAAADPVVSKPYIMPDDPEEGSNEALVREAADARDKMLRTLAEM 60

Query: 55  ENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIE 114
           ENLR+RT +E  DA++Y +  FARD+L ++DNL RALD+ P D   +    E  LK+LIE
Sbjct: 61  ENLRKRTQKEVADARTYGVTSFARDVLDIADNLQRALDAVPADARANA---EPGLKALIE 117

Query: 115 GIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAIN 174
           G+E+T R +++ LE+ GVKK D K QKF+PN  QAM+E P  +VPA T+++VVQ G+ I 
Sbjct: 118 GVELTERSLLNALEKNGVKKFDPKGQKFDPNFQQAMYEVPDPSVPAGTVVQVVQAGFTIG 177

Query: 175 ERVLRPALVSISKGKTQNPTEEK 197
           +RVLRPALV ++KG  +    + 
Sbjct: 178 DRVLRPALVGVAKGGAKAAPSDG 200


>gi|227820599|ref|YP_002824569.1| heat shock protein GrpE [Sinorhizobium fredii NGR234]
 gi|227339598|gb|ACP23816.1| GrpE protein [Sinorhizobium fredii NGR234]
          Length = 222

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 92/200 (46%), Positives = 130/200 (65%), Gaps = 3/200 (1%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E    E+ +      +          +  +  E +  +S + RDKYLR+ AEM+NLRRRT
Sbjct: 25  EAAAPEEIVKATGPEAAEKPEAGASAAGPDPLELAKAESADLRDKYLRLAAEMDNLRRRT 84

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           +R+ KDA+SYS+A FARDML+VSDNL RAL++ P +   S    ++ L +LIEG+EMT R
Sbjct: 85  ERDVKDAKSYSVAGFARDMLAVSDNLRRALEAIPAEARES---GDAGLTALIEGVEMTER 141

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
            M++ LER+GVK++D   Q+F+PN HQAMFE P+  VP NT+++VVQ GY I ERVLRPA
Sbjct: 142 SMLAALERHGVKQLDPTGQRFDPNFHQAMFEVPNPEVPNNTVVQVVQAGYTIGERVLRPA 201

Query: 182 LVSISKGKTQNPTEEKKETI 201
           +V ++KG  +    E +   
Sbjct: 202 MVGVAKGGPKIVAAESETPA 221


>gi|52782879|sp|Q6NCY6|GRPE_RHOPA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
          Length = 207

 Score =  148 bits (372), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 86/202 (42%), Positives = 126/202 (62%), Gaps = 12/202 (5%)

Query: 5   MSEKNIDKEKNPSNANSSTAE---------EKSEINIPEESLNQSEEFRDKYLRVIAEME 55
           M+E +  K+ N   A ++            +  E    E  + ++ + RDK LR +AEME
Sbjct: 1   MTETDGQKDNNQDTAQAAADPVVSKPYIMPDDPEEGSNEALVREAADARDKMLRTLAEME 60

Query: 56  NLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEG 115
           NLR+RT +E  DA++Y +  FARD+L ++DNL RALD+ P D   +    E  LK+LIEG
Sbjct: 61  NLRKRTQKEVADARTYGVTSFARDVLDIADNLQRALDAVPADARANA---EPGLKALIEG 117

Query: 116 IEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINE 175
           +E+T R +++ LE+ GVKK D K QKF+PN  QAM+E P  +VPA T+++VVQ G+ I +
Sbjct: 118 VELTERSLLNALEKNGVKKFDPKGQKFDPNFQQAMYEVPDPSVPAGTVVQVVQAGFTIGD 177

Query: 176 RVLRPALVSISKGKTQNPTEEK 197
           RVLRPALV ++KG  +    + 
Sbjct: 178 RVLRPALVGVAKGGAKAAPSDG 199


>gi|241202763|ref|YP_002973859.1| heat shock protein GrpE [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240856653|gb|ACS54320.1| GrpE protein [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 210

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 93/187 (49%), Positives = 131/187 (70%), Gaps = 3/187 (1%)

Query: 19  ANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFAR 78
            N +  EE ++ +  E    ++ E RD+YLR+ AEM+NLRRRT+RE KDA+SYS+A FAR
Sbjct: 26  ENETAQEEAAQPDALELLKAENGELRDRYLRLAAEMDNLRRRTEREVKDAKSYSVAGFAR 85

Query: 79  DMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
           DML+VSDNL RALD+ P +   +    ++ L +LIEG+EMT R M+S LER+GV+K++  
Sbjct: 86  DMLAVSDNLRRALDAIPPETRAAA---DAGLSTLIEGVEMTERAMLSALERHGVRKLEPV 142

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKK 198
            QKF+PN HQAMFE P+  VP NT+++VVQ G++I ERVLRPA+V ++KG  +    E  
Sbjct: 143 GQKFDPNFHQAMFEVPNPDVPNNTVVQVVQAGFSIGERVLRPAMVGVAKGGPKPAEAETN 202

Query: 199 ETIEQPS 205
              ++  
Sbjct: 203 SVFDEKD 209


>gi|163757819|ref|ZP_02164908.1| probable heat shock protein [Hoeflea phototrophica DFL-43]
 gi|162285321|gb|EDQ35603.1| probable heat shock protein [Hoeflea phototrophica DFL-43]
          Length = 220

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 94/207 (45%), Positives = 131/207 (63%), Gaps = 3/207 (1%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
           T   E    +   P    S  A+   EI+       + EE +D+ LR+ AEMENLRRRT 
Sbjct: 17  TMSDESQGREHDKPEADASVEADSPQEIDPIAALTAEIEELKDQRLRMAAEMENLRRRTA 76

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           R+ KDA+SY+I+ FARDML VSDNL RAL + P    ++   +++ LK+LIEG+E+T + 
Sbjct: 77  RDVKDAKSYAISGFARDMLQVSDNLERALAAVPEQADDA---TDNGLKTLIEGVELTGKA 133

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           M+S LER+GV+K++ K QKF+PN HQAMFE P+  VP NT+I+VVQ GY I +R+LRPA+
Sbjct: 134 MLSALERHGVRKLEPKGQKFDPNFHQAMFEVPNTEVPNNTVIEVVQPGYVIADRMLRPAM 193

Query: 183 VSISKGKTQNPTEEKKETIEQPSPLDI 209
           V ++KG  ++          Q    D 
Sbjct: 194 VGVAKGGPKDVPVSDAAQAYQDDGKDD 220


>gi|74099845|gb|AAZ99131.1| GrpE [Rhizobium leguminosarum]
          Length = 210

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 91/187 (48%), Positives = 129/187 (68%), Gaps = 3/187 (1%)

Query: 19  ANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFAR 78
            N +  +E ++ +  E    ++ E RD+YLR+ AEM+NLRRRT+RE KDA+SYS+A FAR
Sbjct: 26  ENETAQQEPAQPDPIELLKAENGELRDRYLRLAAEMDNLRRRTEREVKDAKSYSVAGFAR 85

Query: 79  DMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
           DML+VSDNL RALD+   +   +    ++ L +LIEG+EMT R M+S LER+GV+K++  
Sbjct: 86  DMLAVSDNLRRALDAISPETKAAA---DAGLSTLIEGVEMTERAMLSALERHGVRKLEPV 142

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKK 198
            QKF+PN HQAMFE P+  VP NT+++VVQ G+ I ERVLRPA+V ++KG  +    E  
Sbjct: 143 GQKFDPNFHQAMFEVPNPDVPNNTVVQVVQAGFTIGERVLRPAMVGVAKGGPKPAEAETN 202

Query: 199 ETIEQPS 205
              ++  
Sbjct: 203 SVFDEKD 209


>gi|116250151|ref|YP_765989.1| heat shock protein GrpE [Rhizobium leguminosarum bv. viciae 3841]
 gi|122988719|sp|Q1MMC9|GRPE_RHIL3 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|115254799|emb|CAK05873.1| putative GrpE heat shock protein [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 210

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 91/187 (48%), Positives = 129/187 (68%), Gaps = 3/187 (1%)

Query: 19  ANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFAR 78
            N +  +E ++ +  E    ++ E RD+YLR+ AEM+NLRRRT+RE KDA+SYS+A FAR
Sbjct: 26  ENETAQQEPAQPDPIELLKAENGELRDRYLRLAAEMDNLRRRTEREVKDAKSYSVAGFAR 85

Query: 79  DMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
           DML+VSDNL RALD+   +   +    ++ L +LIEG+EMT R M+S LER+GV+K++  
Sbjct: 86  DMLAVSDNLRRALDAISPETKATA---DAGLSTLIEGVEMTERAMLSALERHGVRKLEPV 142

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKK 198
            QKF+PN HQAMFE P+  VP NT+++VVQ G+ I ERVLRPA+V ++KG  +    E  
Sbjct: 143 GQKFDPNFHQAMFEVPNPDVPNNTVVQVVQAGFTIGERVLRPAMVGVAKGGPKPAEAETN 202

Query: 199 ETIEQPS 205
              ++  
Sbjct: 203 SVFDEKD 209


>gi|260460486|ref|ZP_05808737.1| Ribulose-phosphate 3-epimerase [Mesorhizobium opportunistum
           WSM2075]
 gi|259033591|gb|EEW34851.1| Ribulose-phosphate 3-epimerase [Mesorhizobium opportunistum
           WSM2075]
          Length = 210

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 92/182 (50%), Positives = 125/182 (68%), Gaps = 5/182 (2%)

Query: 31  NIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRA 90
                 L ++EE +D+ LRV AEMENLRRRT R+  DA++Y++A FARDMLSVSDNL RA
Sbjct: 33  EALVRLLKENEELKDRALRVAAEMENLRRRTARDVHDARTYAVANFARDMLSVSDNLRRA 92

Query: 91  LDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM 150
           LD+ P +   S    ++  K+LIEG+++T R M+S LER+GVKK+  + +KF+PN HQAM
Sbjct: 93  LDAIPAEAKAS---GDAGFKALIEGVDLTERAMLSALERHGVKKLTPEGEKFDPNFHQAM 149

Query: 151 FEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQPSPLDIE 210
           FE P+  VPANT+++VVQ GY+I ERVLRPA+V ++KG  +   E   E    P     E
Sbjct: 150 FEVPNPDVPANTVVQVVQPGYSIGERVLRPAMVGVAKGGPKVAAEAPVEP--GPVNEQAE 207

Query: 211 ER 212
           + 
Sbjct: 208 KD 209


>gi|316931689|ref|YP_004106671.1| GrpE protein [Rhodopseudomonas palustris DX-1]
 gi|315599403|gb|ADU41938.1| GrpE protein [Rhodopseudomonas palustris DX-1]
          Length = 207

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 88/210 (41%), Positives = 126/210 (60%), Gaps = 12/210 (5%)

Query: 5   MSEKNIDKEKNPSNANSSTAE---------EKSEINIPEESLNQSEEFRDKYLRVIAEME 55
           M+E +  K+ N   A ++            +  E    E  + ++ + RDK LR +AEME
Sbjct: 1   MTETDGQKDNNQDTAQAAADPVVSKPYIMPDDPEEGSNEALVREAADARDKMLRTLAEME 60

Query: 56  NLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEG 115
           NLRRRT +E  DA++Y +  FARD+L ++DNL RALD+ P D   +    E  LK+LIEG
Sbjct: 61  NLRRRTQKEVADARTYGVTSFARDVLDIADNLQRALDAVPADARANA---EPGLKALIEG 117

Query: 116 IEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINE 175
           +E+T R +++ LE+ GVKK D K QKF+PN  QAM+E P  +VPA T+++VVQ G+ I E
Sbjct: 118 VELTERSLLNALEKNGVKKFDPKGQKFDPNFQQAMYEVPDPSVPAGTVVQVVQAGFTIGE 177

Query: 176 RVLRPALVSISKGKTQNPTEEKKETIEQPS 205
           RVLRPALV ++KG  +    +         
Sbjct: 178 RVLRPALVGVAKGGAKAAPSDGGTEAGNAG 207


>gi|116563466|gb|ABJ99755.1| GrpE [Agrobacterium tumefaciens]
          Length = 211

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 97/195 (49%), Positives = 133/195 (68%), Gaps = 3/195 (1%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
            + ++ +E            E +E +  E    ++ + RDK+LR+ AEM+NLRRRT+R+ 
Sbjct: 10  PDADVAEEFVEPALAGEEPAEAAEPDPVELLKAENADLRDKFLRLAAEMDNLRRRTERDV 69

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
           KDA+SYS+A FARDML+VSDNL RAL++ P +L       E+ L  LIEG+EMT R M+S
Sbjct: 70  KDAKSYSLAGFARDMLAVSDNLRRALEAIPDELKT---NGEAGLNGLIEGVEMTERSMLS 126

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
           TLER+GVKKIDA+ QKF+PN HQAMFE P+  VP NT+++VVQ G+ I +RVLRPA+V +
Sbjct: 127 TLERHGVKKIDAEGQKFDPNFHQAMFEIPNPAVPNNTVLQVVQAGFTIGDRVLRPAMVGV 186

Query: 186 SKGKTQNPTEEKKET 200
           +KG  +  T    E 
Sbjct: 187 AKGGPKAETAASAEP 201


>gi|110636343|ref|YP_676551.1| GrpE protein [Mesorhizobium sp. BNC1]
 gi|123352919|sp|Q11B39|GRPE_MESSB RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|110287327|gb|ABG65386.1| GrpE protein [Chelativorans sp. BNC1]
          Length = 222

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 87/206 (42%), Positives = 127/206 (61%), Gaps = 3/206 (1%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   +E    +    +   +  A   SE ++      ++E+ +++ LR+ AEMENLR+RT
Sbjct: 18  ENGQAENMAVENGAEAAQAADRATPVSEEDVLLRLAKENEDLKERALRLTAEMENLRKRT 77

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
            R+  DA+ Y IA FARDML+VSDNL RAL +   +        +S LK+L+EG+EMT R
Sbjct: 78  QRDVADARVYGIANFARDMLTVSDNLQRALQAVSEEARAQA---DSGLKALVEGVEMTER 134

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
            M++TLER+GVK++D   +KF+P+ HQAMFE P+  VP NT+++VVQ GY I +RVLRPA
Sbjct: 135 AMLATLERHGVKRVDPNGEKFDPHFHQAMFEVPNADVPNNTVVQVVQPGYVIGDRVLRPA 194

Query: 182 LVSISKGKTQNPTEEKKETIEQPSPL 207
           +V ++KG  +  T           P 
Sbjct: 195 MVGVAKGGPKAETPAATSEQAAQGPE 220


>gi|254707140|ref|ZP_05168968.1| heat shock protein GrpE [Brucella pinnipedialis M163/99/10]
          Length = 186

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 92/179 (51%), Positives = 121/179 (67%), Gaps = 4/179 (2%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
               N        + E +D+ LRV AEMENLR+RT R+ +DA++Y+I  FARDMLSVSDN
Sbjct: 12  DETANRIAVLEADNTELKDQMLRVAAEMENLRKRTQRDVQDARAYAITNFARDMLSVSDN 71

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNM 146
           L RALD+ P D   +    +S LKSL EG+EMT R M+  LER+GVKK++ + QKF+PN 
Sbjct: 72  LRRALDAIPADALEA----DSNLKSLSEGVEMTERAMLLALERHGVKKLEPEGQKFDPNF 127

Query: 147 HQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQPS 205
           HQAMFE P+  +P NT+++VVQ GYAI +RVLRPA+V +SKG  +   E    T E  +
Sbjct: 128 HQAMFEVPNPDLPNNTVVQVVQAGYAIGDRVLRPAMVGVSKGGPKVSAENGASTSEDNA 186


>gi|170749944|ref|YP_001756204.1| ribulose-phosphate 3-epimerase [Methylobacterium radiotolerans JCM
           2831]
 gi|170656466|gb|ACB25521.1| Ribulose-phosphate 3-epimerase [Methylobacterium radiotolerans JCM
           2831]
          Length = 204

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 86/182 (47%), Positives = 122/182 (67%), Gaps = 3/182 (1%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
             ++  P+   S +A              + +E +D+ LR +AEMENLRRRT+RE  DA+
Sbjct: 17  AAQDPAPAGQGSESATVDPVAEALALLTAERDELKDRTLRTLAEMENLRRRTEREVADAR 76

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
           +Y++  FARD+L+V+DN+ RALDS P D   +    +  LK LI+GIE+T R++  TLER
Sbjct: 77  AYAVTNFARDVLNVADNIRRALDSVPADAKATA---DGALKGLIDGIELTERDLAKTLER 133

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
           +GVK ++ + QKF+PN HQAMFE P+  VPA T+++VVQ GY I ERVLRPALV ++KG 
Sbjct: 134 HGVKIVEPQGQKFDPNRHQAMFEVPNAEVPAGTVVQVVQAGYVIGERVLRPALVGVAKGG 193

Query: 190 TQ 191
            +
Sbjct: 194 PK 195


>gi|209547620|ref|YP_002279537.1| heat shock protein GrpE [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|226737162|sp|B5ZMX0|GRPE_RHILW RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|209533376|gb|ACI53311.1| Ribulose-phosphate 3-epimerase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 210

 Score =  146 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 93/187 (49%), Positives = 131/187 (70%), Gaps = 3/187 (1%)

Query: 19  ANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFAR 78
            N    EE  + +  E    ++ E RD+YLR+ AEM+NLRRRT+RE KDA+SYS+A FAR
Sbjct: 26  ENDIAQEEAPQPDALELLKAENGELRDRYLRLAAEMDNLRRRTEREVKDAKSYSVAGFAR 85

Query: 79  DMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
           DML+VSDNL RALD+ P ++ ++    ++ L +LIEG+EMT R M+S LER+GV+K++  
Sbjct: 86  DMLAVSDNLRRALDAIPAEVKDAA---DAGLSTLIEGVEMTERAMLSALERHGVRKLEPV 142

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKK 198
            QKF+PN HQAMFE P+  VP NT+++VVQ G++I ERVLRPA+V ++KG  +    E  
Sbjct: 143 GQKFDPNFHQAMFEVPNPDVPNNTVVQVVQAGFSIGERVLRPAMVGVAKGGPKAAEAETN 202

Query: 199 ETIEQPS 205
              ++  
Sbjct: 203 SVFDEKD 209


>gi|17988060|ref|NP_540694.1| heat shock protein GrpE [Brucella melitensis bv. 1 str. 16M]
 gi|261314616|ref|ZP_05953813.1| heat shock protein GrpE [Brucella pinnipedialis M163/99/10]
 gi|17983809|gb|AAL52958.1| grpe protein [Brucella melitensis bv. 1 str. 16M]
 gi|261303642|gb|EEY07139.1| heat shock protein GrpE [Brucella pinnipedialis M163/99/10]
          Length = 176

 Score =  146 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 92/179 (51%), Positives = 121/179 (67%), Gaps = 4/179 (2%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
               N        + E +D+ LRV AEMENLR+RT R+ +DA++Y+I  FARDMLSVSDN
Sbjct: 2   DETANRIAVLEADNTELKDQMLRVAAEMENLRKRTQRDVQDARAYAITNFARDMLSVSDN 61

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNM 146
           L RALD+ P D   +    +S LKSL EG+EMT R M+  LER+GVKK++ + QKF+PN 
Sbjct: 62  LRRALDAIPADALEA----DSNLKSLSEGVEMTERAMLLALERHGVKKLEPEGQKFDPNF 117

Query: 147 HQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQPS 205
           HQAMFE P+  +P NT+++VVQ GYAI +RVLRPA+V +SKG  +   E    T E  +
Sbjct: 118 HQAMFEVPNPDLPNNTVVQVVQAGYAIGDRVLRPAMVGVSKGGPKVSAENGASTSEDNA 176


>gi|13472808|ref|NP_104375.1| heat shock protein GrpE [Mesorhizobium loti MAFF303099]
 gi|52782973|sp|Q98GQ5|GRPE_RHILO RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|14023555|dbj|BAB50161.1| heat shock protein (HSP-70 cofactor); GrpE [Mesorhizobium loti
           MAFF303099]
          Length = 210

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 90/180 (50%), Positives = 124/180 (68%), Gaps = 3/180 (1%)

Query: 31  NIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRA 90
                 L ++EE +D+ LRV AEMENLRRRT R+  DA++Y++A FARDMLSVSDNL RA
Sbjct: 33  EALVRLLKENEELKDRALRVAAEMENLRRRTARDVHDARTYAVANFARDMLSVSDNLRRA 92

Query: 91  LDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM 150
           LD+ P +   S    ++  K+LIEG+++T R M+S LER+GVKK+  + +KF+PN HQAM
Sbjct: 93  LDAIPAEAKAS---GDAGFKALIEGVDLTERAMLSALERHGVKKLAPEGEKFDPNFHQAM 149

Query: 151 FEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQPSPLDIE 210
           FE P+  VPANT+++VVQ GY+I ERVLRPA+V ++KG  +   E   E        + +
Sbjct: 150 FEVPNPDVPANTVVQVVQPGYSIGERVLRPAMVGVAKGGPKIAAEAPVEPGPVNEQAEKD 209


>gi|192288765|ref|YP_001989370.1| heat shock protein GrpE [Rhodopseudomonas palustris TIE-1]
 gi|226737163|sp|B3Q970|GRPE_RHOPT RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|192282514|gb|ACE98894.1| Ribulose-phosphate 3-epimerase [Rhodopseudomonas palustris TIE-1]
          Length = 207

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 85/208 (40%), Positives = 126/208 (60%), Gaps = 12/208 (5%)

Query: 5   MSEKNIDKEKNPSNANSSTAE---------EKSEINIPEESLNQSEEFRDKYLRVIAEME 55
           M+E +  K+ N   A ++            +  E    E  + ++ + RDK LR +AEME
Sbjct: 1   MTETDGQKDNNQDTAQAAADPVVSKPYIMPDDPEEGSNEALVREAADARDKMLRTLAEME 60

Query: 56  NLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEG 115
           NLR+RT +E  DA++Y +  FARD+L ++DNL RALD+ P +   +    E  LK+LIEG
Sbjct: 61  NLRKRTQKEVADARTYGVTSFARDVLDIADNLQRALDAVPAEARANA---EPGLKALIEG 117

Query: 116 IEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINE 175
           +E+T R +++ LE+ GVKK D K QKF+PN  QAM+E P  +VPA T+++VVQ G+ I +
Sbjct: 118 VELTERSLLNALEKNGVKKFDPKGQKFDPNFQQAMYEVPDPSVPAGTVVQVVQAGFTIGD 177

Query: 176 RVLRPALVSISKGKTQNPTEEKKETIEQ 203
           RVLRPALV ++KG  +    +       
Sbjct: 178 RVLRPALVGVAKGGAKAAPSDGGSETGN 205


>gi|15887680|ref|NP_353361.1| GRPE protein [Agrobacterium tumefaciens str. C58]
 gi|52783612|sp|P63187|GRPE_AGRT5 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|52783613|sp|P63188|GRPE_AGRTU RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|3170207|gb|AAC18053.1| GrpE [Agrobacterium tumefaciens]
 gi|15155235|gb|AAK86146.1| GRPE protein [Agrobacterium tumefaciens str. C58]
          Length = 211

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 94/195 (48%), Positives = 132/195 (67%), Gaps = 3/195 (1%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
            + ++ +E            E +E +  E    ++ + RDK+LR+ AEM+NLRRRT+R+ 
Sbjct: 10  PDADVAEEFVDPAQAGEEQAETAEPDPVELLKAENADLRDKFLRLAAEMDNLRRRTERDV 69

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
           KDA++YS+A FARDML+VSDNL RAL++ P +L       E+ L  LIEG+EMT R M+S
Sbjct: 70  KDAKAYSLAGFARDMLAVSDNLRRALEAIPDELKT---NGEAGLNGLIEGVEMTERSMLS 126

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
           TLER+GVKKIDA+ QKF+PN HQAMFE P+  VP NT+++V+Q G+ I +RVLRPA+V +
Sbjct: 127 TLERHGVKKIDAEGQKFDPNFHQAMFEVPNTAVPNNTVLQVIQAGFTIGDRVLRPAMVGV 186

Query: 186 SKGKTQNPTEEKKET 200
           +KG  +       E 
Sbjct: 187 AKGGPKAEPSASAEP 201


>gi|148251806|ref|YP_001236391.1| heat shock protein GrpE [Bradyrhizobium sp. BTAi1]
 gi|146403979|gb|ABQ32485.1| protein grpE (HSP-70 cofactor) [Bradyrhizobium sp. BTAi1]
          Length = 206

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 84/198 (42%), Positives = 120/198 (60%), Gaps = 3/198 (1%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +N  +   P  +      +  E    E    ++ + RDK LR +AEMENLR+RT RE  D
Sbjct: 12  ENPAQASEPVVSKPYIMPDDPETGSAEALAKEAADARDKMLRTLAEMENLRKRTAREVAD 71

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A+ Y I  FARD+L ++DNL RALD+ P +   +    +  LK+LIEG+E+T R +++TL
Sbjct: 72  ARIYGITGFARDVLDIADNLQRALDAVPAETRANA---DPGLKALIEGVELTERSLLNTL 128

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           E+ GVKK D   QKF+PN  QAM+E P  +VP+ T+++VVQ G+ I ERVLRPALV +SK
Sbjct: 129 EKNGVKKFDPTGQKFDPNFQQAMYEVPDASVPSGTVVQVVQAGFMIGERVLRPALVGVSK 188

Query: 188 GKTQNPTEEKKETIEQPS 205
           G  +       +     +
Sbjct: 189 GGAKPAPAANNDQPNNAA 206


>gi|86747553|ref|YP_484049.1| GrpE protein [Rhodopseudomonas palustris HaA2]
 gi|123409016|sp|Q2J322|GRPE_RHOP2 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|86570581|gb|ABD05138.1| GrpE protein [Rhodopseudomonas palustris HaA2]
          Length = 206

 Score =  145 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 85/206 (41%), Positives = 126/206 (61%), Gaps = 12/206 (5%)

Query: 5   MSEKNIDKEKNPSNANSSTAE---------EKSEINIPEESLNQSEEFRDKYLRVIAEME 55
           M++ N  K+ N   A ++            +  E    E  + ++ E RDK LR +AEME
Sbjct: 1   MTDSNGPKDNNQDQAQAAADPVVSKPYIMPDDPEDGANEALIKEAAEARDKMLRTLAEME 60

Query: 56  NLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEG 115
           NLRRRT +E  DA++Y ++ FARD+L ++DNL RALD+ P +   +    ++ LK LIEG
Sbjct: 61  NLRRRTQKEVADARTYGVSAFARDVLEIADNLQRALDAVPAEARANA---DAGLKGLIEG 117

Query: 116 IEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINE 175
           +E+T R +++ LE+ GV+K D   +KF+PN  QAM+E P  +VPA T+++VVQ G+ I E
Sbjct: 118 VELTERSLINALEKNGVRKFDPSGEKFDPNFQQAMYEVPDPSVPAGTVVQVVQAGFMIGE 177

Query: 176 RVLRPALVSISKGKTQNPTEEKKETI 201
           RVLRPALV ++KG  +        T 
Sbjct: 178 RVLRPALVGVAKGGAKPAPAATNGTD 203


>gi|319781454|ref|YP_004140930.1| GrpE protein [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317167342|gb|ADV10880.1| GrpE protein [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 211

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 94/213 (44%), Positives = 136/213 (63%), Gaps = 9/213 (4%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEI------NIPEESLNQSEEFRDKYLRVIAEMENLR 58
           MS++  D+        +  A E++E             L ++EE +D+ LRV AEMENLR
Sbjct: 1   MSDQAKDERAPDEVEATEPAAERTEGSTDGDYEALVRLLKENEELKDRALRVAAEMENLR 60

Query: 59  RRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEM 118
           RRT R+  DA++Y++A FARDMLSVSDNL RALD+ P +   S    ++  K+LIEG+++
Sbjct: 61  RRTARDVHDARTYAVANFARDMLSVSDNLRRALDAIPAEAKAS---GDAGFKALIEGVDL 117

Query: 119 TRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVL 178
           T R M+S LER+GVKK+  + +KF+PN HQAMFE P+  VPANT+++VVQ GY+I +RVL
Sbjct: 118 TERAMLSALERHGVKKLAPEGEKFDPNFHQAMFEVPNPDVPANTVVQVVQPGYSIGDRVL 177

Query: 179 RPALVSISKGKTQNPTEEKKETIEQPSPLDIEE 211
           RPA+V ++KG  +    E        +    ++
Sbjct: 178 RPAMVGVAKGGPKLAAAEAPVEPGPVNEQAEKD 210


>gi|239831017|ref|ZP_04679346.1| Protein grpE [Ochrobactrum intermedium LMG 3301]
 gi|239823284|gb|EEQ94852.1| Protein grpE [Ochrobactrum intermedium LMG 3301]
          Length = 245

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 86/179 (48%), Positives = 120/179 (67%), Gaps = 4/179 (2%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
               N        + E +D+ LR  AEMENLR+RT R+ +DA++Y++  FARDMLSVSDN
Sbjct: 71  DDTANRIAMLEADNGELKDQLLRAAAEMENLRKRTQRDVQDARTYAVTNFARDMLSVSDN 130

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNM 146
           L RAL++ P +       +++ LKSL +G+EMT R M+  LER+GVKK++ + QKF+PN 
Sbjct: 131 LRRALEAIPAEA----MATDASLKSLADGVEMTERAMLHALERHGVKKLEPEGQKFDPNF 186

Query: 147 HQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQPS 205
           HQAMFE P+  +P NT+++VVQDGYAI +RVLRPA+V +SKG  +   +      E  S
Sbjct: 187 HQAMFEVPNADLPNNTVVQVVQDGYAIGDRVLRPAMVGVSKGGPKATADNGAAAPEGNS 245


>gi|218462738|ref|ZP_03502829.1| molecular chaperone heat shock protein [Rhizobium etli Kim 5]
          Length = 213

 Score =  144 bits (363), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 93/187 (49%), Positives = 128/187 (68%), Gaps = 3/187 (1%)

Query: 19  ANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFAR 78
            N    EE ++ +  E    ++ E RD+YLR+ AEMENLRRRT+RE KDA+SYS+A FAR
Sbjct: 29  ENDIVQEETAQPDPLELLKAENSELRDRYLRLAAEMENLRRRTEREVKDAKSYSVAGFAR 88

Query: 79  DMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
           DML+VSDNL RALD+   +   +    ++ L +LIEG+EMT R M+S LER+GV+K++  
Sbjct: 89  DMLAVSDNLRRALDAISPEAKATA---DAGLTTLIEGVEMTERAMLSALERHGVRKLEPV 145

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKK 198
            QKF+PN HQAMFE P+  VP NT+++VVQ G+ I ERVLRPA+V ++KG  +    E  
Sbjct: 146 GQKFDPNFHQAMFEVPNPEVPNNTVVQVVQAGFTIGERVLRPAMVGVAKGGPKPAEAETN 205

Query: 199 ETIEQPS 205
              ++  
Sbjct: 206 SVFDEKD 212


>gi|190890034|ref|YP_001976576.1| molecular chaperone heat shock protein [Rhizobium etli CIAT 652]
 gi|218517180|ref|ZP_03514020.1| molecular chaperone heat shock protein [Rhizobium etli 8C-3]
 gi|226737161|sp|B3PZA4|GRPE_RHIE6 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|190695313|gb|ACE89398.1| molecular chaperone heat shock protein [Rhizobium etli CIAT 652]
          Length = 210

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 93/187 (49%), Positives = 129/187 (68%), Gaps = 3/187 (1%)

Query: 19  ANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFAR 78
            N +  EE ++ +  E    ++ E RD+YLR+ AEM+NLRRRT+RE KDA+SYS+A FAR
Sbjct: 26  ENDTVQEETAQPDPLELLKAENSELRDRYLRLAAEMDNLRRRTEREVKDAKSYSVAGFAR 85

Query: 79  DMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
           DML+VSDNL RALD+   +   +    ++ L SLIEG+EMT R M+S LER+GV+K++  
Sbjct: 86  DMLAVSDNLRRALDAISPEAKATA---DAGLTSLIEGVEMTERAMLSALERHGVRKLEPV 142

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKK 198
            QKF+PN HQAMFE P+  VP NT+++VVQ G+ I ERVLRPA+V ++KG  +    E  
Sbjct: 143 GQKFDPNFHQAMFEVPNSEVPNNTVVQVVQAGFTIGERVLRPAMVGVAKGGPKPAEAETN 202

Query: 199 ETIEQPS 205
              ++  
Sbjct: 203 SVFDEKD 209


>gi|83644085|ref|YP_432520.1| molecular chaperone GrpE (heat shock protein) [Hahella chejuensis
           KCTC 2396]
 gi|83632128|gb|ABC28095.1| Molecular chaperone GrpE (heat shock protein) [Hahella chejuensis
           KCTC 2396]
          Length = 286

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 56/200 (28%), Positives = 105/200 (52%), Gaps = 19/200 (9%)

Query: 3   TFMSEKNIDKEKNPSNANS--------------STAEEKSEINIPEESLNQSEEFRDKYL 48
             MSE +  + +    A                ++ +      + E    +  E +++ L
Sbjct: 91  DLMSEDSKSQVEEQVAAEDQAQAAVAEQAETAQASGDSVDRDELIERLQQELGEQKEQVL 150

Query: 49  RVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESV 108
           RV AEM+N+RRR + +   A+ +++ +F +++L V D+L +A+++     +   +     
Sbjct: 151 RVHAEMQNVRRRAENDVDKARKFALERFVKELLPVVDSLEKAVEACGATESADSQ----- 205

Query: 109 LKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQ 168
           + +L +G+EMT   + S L+++ V+ +D   Q FNP  H+AM   P   V  NT+I V+Q
Sbjct: 206 VTTLKDGVEMTLSLLNSGLKKFEVEVVDPMGQPFNPEFHEAMSMAPQADVEPNTVIAVLQ 265

Query: 169 DGYAINERVLRPALVSISKG 188
            GY ++ R++RPA+V +SKG
Sbjct: 266 KGYLLSGRLIRPAMVMVSKG 285


>gi|325291763|ref|YP_004277627.1| GRPE protein [Agrobacterium sp. H13-3]
 gi|325059616|gb|ADY63307.1| GRPE protein [Agrobacterium sp. H13-3]
          Length = 211

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 98/195 (50%), Positives = 133/195 (68%), Gaps = 3/195 (1%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
            + ++ +E            E +E +  E    ++ + RDK+LR+ AEM+NLRRRT+RE 
Sbjct: 10  PDADVAEEFVEPAFTGEETAEAAEPDPIELLRAENADLRDKFLRLAAEMDNLRRRTEREV 69

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
           KDA++YS+A FARDML+VSDNL RAL++ P +L       E+ L  LIEG+EMT R M+S
Sbjct: 70  KDAKAYSLAAFARDMLAVSDNLRRALEAIPDELKT---NGEAGLNGLIEGVEMTERSMLS 126

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
           TLER+GVKKIDA+ QKF+PN HQAMFE P+  VP NT+++VVQ G+ I +RVLRPA+V +
Sbjct: 127 TLERHGVKKIDAEGQKFDPNFHQAMFEIPNTAVPNNTVLQVVQAGFTIGDRVLRPAMVGV 186

Query: 186 SKGKTQNPTEEKKET 200
           SKG  +  T    E 
Sbjct: 187 SKGGPKVETAAAPEP 201


>gi|294085183|ref|YP_003551943.1| Ribulose-phosphate 3-epimerase [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664758|gb|ADE39859.1| Ribulose-phosphate 3-epimerase [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 249

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 62/203 (30%), Positives = 113/203 (55%), Gaps = 1/203 (0%)

Query: 13  EKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYS 72
           E  P   +  + ++ + ++  ++ L + +  +D+ LR +AE EN RRR++R+   A+ Y 
Sbjct: 47  ETAPPAESDGSDDDGASLDPYDQLLAERDALKDQLLRALAESENTRRRSERDVLAAKKYG 106

Query: 73  IAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGV 132
               ARD++   DNL+RALD    D           + +++ GIE++  E++S  E++G+
Sbjct: 107 HTGLARDLVGAIDNLARALDIMKDDG-FEAGSLSEAMTNVVTGIELSWTEIISITEKHGI 165

Query: 133 KKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQN 192
           K+I+   +KF+ N+HQAMFE P    P   +++V+Q GY +++R+LRPA+V +SK     
Sbjct: 166 KQINPAGEKFDYNLHQAMFEVPTAETPPGMVVEVLQHGYVLHDRLLRPAMVGVSKAPEAA 225

Query: 193 PTEEKKETIEQPSPLDIEERNKT 215
                 +   + S  + +  NK 
Sbjct: 226 AESANSQAKVEDSAGNDDADNKG 248


>gi|90421851|ref|YP_530221.1| GrpE protein [Rhodopseudomonas palustris BisB18]
 gi|90103865|gb|ABD85902.1| GrpE protein [Rhodopseudomonas palustris BisB18]
          Length = 205

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 87/196 (44%), Positives = 124/196 (63%), Gaps = 11/196 (5%)

Query: 4   FMSEKNIDKEKNPSNANSSTA--------EEKSEINIPEESLNQSEEFRDKYLRVIAEME 55
            M++ N  K+     A ++           +  E+   E    ++ E RDK LR +AEME
Sbjct: 1   MMTDPNGPKDTPAQPAQAAEPVVSKPYIMPDDPEVGSTEALAKEAAESRDKMLRTLAEME 60

Query: 56  NLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEG 115
           NLR+RT RE  DA++Y IA FARD+L ++DNL RALD+ P D   +    E  LK+LIEG
Sbjct: 61  NLRKRTAREVADARTYGIAGFARDVLDIADNLQRALDAVPADARATA---EPGLKALIEG 117

Query: 116 IEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINE 175
           +E+T R M++ LE+ GVKK D   +KF+PN  QAM+E P  +V A T+++VVQ G+ + +
Sbjct: 118 VELTERSMLNALEKNGVKKFDPIGEKFDPNFQQAMYEVPDSSVAAGTVVQVVQAGFTLGD 177

Query: 176 RVLRPALVSISKGKTQ 191
           RVLRPALV++SKG  +
Sbjct: 178 RVLRPALVAVSKGGAK 193


>gi|90420648|ref|ZP_01228554.1| grpE chaperone protein [Aurantimonas manganoxydans SI85-9A1]
 gi|90334939|gb|EAS48700.1| grpE chaperone protein [Aurantimonas manganoxydans SI85-9A1]
          Length = 242

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 80/179 (44%), Positives = 119/179 (66%), Gaps = 3/179 (1%)

Query: 31  NIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRA 90
                   ++ + +D+ LR+ A+MENLRRRT+RE KDA++Y++  FAR++LSV+DNL RA
Sbjct: 66  ERIAALEAENADVKDRLLRLAADMENLRRRTEREVKDARTYAVTGFAREILSVADNLRRA 125

Query: 91  LDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM 150
           L++ P +        E  L  LI+G+E+T R ++STLE++GV+K+D + Q+F+PN HQAM
Sbjct: 126 LEAVPAEAKAD---GEGGLAGLIDGVEVTERSLISTLEKHGVRKLDPEGQRFDPNFHQAM 182

Query: 151 FEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQPSPLDI 209
           FE P+  VP  T+++VVQ GYAI ERVLRPA+V +SKG  +    + +         D 
Sbjct: 183 FEIPNTEVPNGTVLQVVQAGYAIGERVLRPAMVGVSKGGPKASAAKAEADAAPQDVGDT 241


>gi|307942844|ref|ZP_07658189.1| co-chaperone GrpE [Roseibium sp. TrichSKD4]
 gi|307773640|gb|EFO32856.1| co-chaperone GrpE [Roseibium sp. TrichSKD4]
          Length = 209

 Score =  143 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 91/206 (44%), Positives = 130/206 (63%), Gaps = 7/206 (3%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEIN----IPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           MS+ NI  E+      ++ A  ++E        E  + ++ E +DK LR +AEMENLRRR
Sbjct: 1   MSDDNIKTEEQMEANEAAHAPNEAEAEAGGNPVEALMAENAELKDKVLRTMAEMENLRRR 60

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+++  DA+ Y+++ FARDML+V DNL RALDS P +         + L  LIEG+EMT 
Sbjct: 61  TEKQVSDAKQYAVSTFARDMLTVGDNLRRALDSLPEEERAGA---AAGLVGLIEGVEMTE 117

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           RE+++ L + GVKK++ + QKF+PN HQAMFE P+  VP NT+++VVQ GY I ERVLRP
Sbjct: 118 RELLNQLCKNGVKKLEPEGQKFDPNFHQAMFEVPNPDVPNNTVVQVVQAGYVIGERVLRP 177

Query: 181 ALVSISKGKTQNPTEEKKETIEQPSP 206
           A+V ++KG  ++     K     P  
Sbjct: 178 AMVGVAKGGPKDVPAADKADGAAPGQ 203


>gi|158425910|ref|YP_001527202.1| putative heat shock protein [Azorhizobium caulinodans ORS 571]
 gi|158332799|dbj|BAF90284.1| putative heat shock protein [Azorhizobium caulinodans ORS 571]
          Length = 210

 Score =  143 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 80/174 (45%), Positives = 115/174 (66%), Gaps = 3/174 (1%)

Query: 28  SEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNL 87
           S ++  E    +   F+DKYLR  AE EN+RRR DRE  DA+ Y IA FARD+L+V+D+L
Sbjct: 33  SPVSEKERLEGEVAAFKDKYLRAFAEAENIRRRADREIADAKVYGIASFARDVLNVADDL 92

Query: 88  SRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMH 147
           +RAL +   +   +    E  LK LI+GIE+T R ++  LE++GV+K++   +KF+PN+H
Sbjct: 93  ARALATVDAETKANA---EGALKGLIDGIELTERGLLKNLEKHGVRKVEPVGEKFDPNLH 149

Query: 148 QAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETI 201
           QAMFE P  +V A T+++VVQ GY I +RVLRPALV +++G  + P     E  
Sbjct: 150 QAMFEVPDPSVAAGTVVQVVQSGYVIGDRVLRPALVGVARGGPKAPPAAPSEEA 203


>gi|222084660|ref|YP_002543189.1| molecular chaperone heat shock protein (hsp-70) [Agrobacterium
           radiobacter K84]
 gi|221722108|gb|ACM25264.1| molecular chaperone heat shock protein (hsp-70) [Agrobacterium
           radiobacter K84]
          Length = 208

 Score =  143 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 94/213 (44%), Positives = 135/213 (63%), Gaps = 13/213 (6%)

Query: 5   MSEKNIDKEKNPSNAN--------SSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMEN 56
           M+++      + + A+          T  E  E +  E    ++ + RD+YLR+ A+M+N
Sbjct: 1   MTDETTKTGPDATAADLAQDVADTVETTAETQEPDPVELLKAENSDLRDRYLRLAADMDN 60

Query: 57  LRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGI 116
           LRRRT+RE KDA+SYS+A FARDML+VSDNL R LD+ P +L +      + LK+LIEG+
Sbjct: 61  LRRRTEREIKDAKSYSVAGFARDMLAVSDNLRRTLDAIPAELRDD-----AGLKTLIEGV 115

Query: 117 EMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINER 176
           EMT R M+S LER+GV++I+   QKF+PN HQAMFE P+  VP NT+++VVQ G+ I ER
Sbjct: 116 EMTERSMLSALERHGVRQIEPVGQKFDPNFHQAMFEVPNSEVPNNTVVQVVQAGFVIGER 175

Query: 177 VLRPALVSISKGKTQNPTEEKKETIEQPSPLDI 209
           VLRPA+V ++KG  +     +  +       D 
Sbjct: 176 VLRPAMVGVAKGGPKLAEVSELGSNSPFDEKDA 208


>gi|328545808|ref|YP_004305917.1| Protein grpE [polymorphum gilvum SL003B-26A1]
 gi|326415548|gb|ADZ72611.1| Protein grpE [Polymorphum gilvum SL003B-26A1]
          Length = 206

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 96/203 (47%), Positives = 134/203 (66%), Gaps = 3/203 (1%)

Query: 4   FMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDR 63
              E  I   + P  +  + A E +E++  E    ++ + RD+ LRV+AEMENLRRRT++
Sbjct: 1   MSDENKIADSQEPEASAQAAAGEAAEVDPVEALRAENADLRDRTLRVMAEMENLRRRTEK 60

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           E KD + ++IA FARDML+VSDNL RALDS P D   S    ++ L +LIEG+EMT RE+
Sbjct: 61  EVKDTRQFAIAGFARDMLAVSDNLRRALDSLPEDARQSA---DAGLVALIEGVEMTEREL 117

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
           ++ LE++GVK++D   QKF+PN HQAMFE P+  VP NT+++VVQ GY I ERVLRPALV
Sbjct: 118 LNQLEKHGVKQLDPSGQKFDPNFHQAMFEIPNTEVPNNTVVQVVQAGYVIGERVLRPALV 177

Query: 184 SISKGKTQNPTEEKKETIEQPSP 206
            +SKG  ++  +       +   
Sbjct: 178 GVSKGGPKDAAQPAGNAQGEAGQ 200


>gi|85714059|ref|ZP_01045048.1| GrpE protein [Nitrobacter sp. Nb-311A]
 gi|85699185|gb|EAQ37053.1| GrpE protein [Nitrobacter sp. Nb-311A]
          Length = 197

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 80/188 (42%), Positives = 116/188 (61%), Gaps = 3/188 (1%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           +   E  P  +      +  E    +    +  E +D+ LR +AEMENLRRRT RE  DA
Sbjct: 13  DPAAEVEPVVSKPYVMPDDPEEGTLDVLSKELAEAKDRTLRTLAEMENLRRRTAREVSDA 72

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
           ++Y I+ FARD+L ++DNL RAL       A +   ++  LK+LIEG+E+T R + + LE
Sbjct: 73  RTYGISGFARDVLEIADNLQRAL---DAVSAEARAAADPGLKALIEGVELTERSLHNALE 129

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           ++GVKK D   +KF+PN+HQAM+E P  ++P  T+ +V+Q GY I ERVLRPALV ++KG
Sbjct: 130 KHGVKKFDPAGEKFDPNVHQAMYEVPDPSIPVGTVAQVIQAGYMIGERVLRPALVGVAKG 189

Query: 189 KTQNPTEE 196
             +    E
Sbjct: 190 GAKAAVPE 197


>gi|86356022|ref|YP_467914.1| molecular chaperone heat shock protein (hsp-70) [Rhizobium etli CFN
           42]
 gi|123738420|sp|Q2KD99|GRPE_RHIEC RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|86280124|gb|ABC89187.1| molecular chaperone heat shock protein (hsp-70) [Rhizobium etli CFN
           42]
          Length = 211

 Score =  142 bits (357), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 92/188 (48%), Positives = 129/188 (68%), Gaps = 3/188 (1%)

Query: 18  NANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFA 77
             ++S  EE  + +  E    ++ E RD+YLR+ AEM+NLRRRT+RE KDA+SYS+A FA
Sbjct: 26  EIDNSVQEEAKQPDPLELLKAENAELRDRYLRLAAEMDNLRRRTEREVKDAKSYSVAGFA 85

Query: 78  RDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDA 137
           RDML+VSDNL RALD+   +   +    ++ L +LIEG+EMT R M+S LER+GV+K++ 
Sbjct: 86  RDMLAVSDNLRRALDAISPEAKATA---DAGLTTLIEGVEMTERSMLSALERHGVRKLEP 142

Query: 138 KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEK 197
             QKF+PN HQAMFE P+  VP NT+++VVQ G+ I ERVLRPA+V ++KG  +    E 
Sbjct: 143 VGQKFDPNFHQAMFEVPNSEVPNNTVVQVVQAGFTIGERVLRPAMVGVAKGGPKPVEAEI 202

Query: 198 KETIEQPS 205
               ++  
Sbjct: 203 NSVFDEKD 210


>gi|218509095|ref|ZP_03506973.1| molecular chaperone heat shock protein [Rhizobium etli Brasil 5]
          Length = 205

 Score =  141 bits (356), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 89/178 (50%), Positives = 124/178 (69%), Gaps = 3/178 (1%)

Query: 19  ANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFAR 78
            N +  EE ++ +  E    ++ E RD+YLR+ AEM+NLRRRT+RE KDA+SYS+A FAR
Sbjct: 26  ENDTVQEETAQPDPLELLKAENSELRDRYLRLAAEMDNLRRRTEREVKDAKSYSVAGFAR 85

Query: 79  DMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
           DML+VSDNL RALD+   +   +    ++ L +LIEG+EMT R M+S LER+GV+K++  
Sbjct: 86  DMLAVSDNLRRALDAISPEAKATA---DAGLTTLIEGVEMTERAMLSALERHGVRKLEPV 142

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEE 196
            QKF+PN H AMFE P+  V  NT+++VV  G+ I ERVLRPA+V ++KG  +    E
Sbjct: 143 GQKFDPNFHHAMFEVPNPEVANNTVVQVVHAGFTIGERVLRPAMVGVAKGGPKPAEAE 200


>gi|218528431|ref|YP_002419247.1| ribulose-phosphate 3-epimerase [Methylobacterium chloromethanicum
           CM4]
 gi|218520734|gb|ACK81319.1| Ribulose-phosphate 3-epimerase [Methylobacterium chloromethanicum
           CM4]
          Length = 202

 Score =  141 bits (355), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 87/202 (43%), Positives = 123/202 (60%), Gaps = 4/202 (1%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEK-SEINIPEESLNQSEEFRDKYLRVIAEMENLRR 59
           M   M +              S A +  ++      ++ + +EF+D+ LR +AEMENLRR
Sbjct: 2   MADDMEKHERHDGAEAEVPPQSGASQTGADAEGLAAAIAERDEFKDRLLRTLAEMENLRR 61

Query: 60  RTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMT 119
           RT+RE  DA++Y++  FARDML+ +DN+ RALDS P +        E   K LIEGI++T
Sbjct: 62  RTEREVADARTYAVTNFARDMLNTADNIRRALDSVPEEARAGA---EGPFKGLIEGIDLT 118

Query: 120 RREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
            R++  TLER+GVK +D K Q+F+PN HQAMFE P+  VP  T+++VVQ GY I +R LR
Sbjct: 119 ERDLTKTLERHGVKVVDPKGQRFDPNRHQAMFEVPNTEVPNGTVVQVVQTGYVIGDRTLR 178

Query: 180 PALVSISKGKTQNPTEEKKETI 201
           PALV +SKG  +    + K   
Sbjct: 179 PALVGVSKGGPKPEANKDKSAD 200


>gi|163849788|ref|YP_001637831.1| ribulose-phosphate 3-epimerase [Methylobacterium extorquens PA1]
 gi|163661393|gb|ABY28760.1| Ribulose-phosphate 3-epimerase [Methylobacterium extorquens PA1]
          Length = 202

 Score =  141 bits (355), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 87/202 (43%), Positives = 122/202 (60%), Gaps = 4/202 (1%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEK-SEINIPEESLNQSEEFRDKYLRVIAEMENLRR 59
           M   M +              S A    ++      ++ + +EF+D+ LR +AEMENLRR
Sbjct: 2   MADDMEKHERHDGAEAEVPPQSGASRAGADAEGLAAAIAERDEFKDRLLRTLAEMENLRR 61

Query: 60  RTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMT 119
           RT+RE  DA++Y++  FARDML+ +DN+ RALDS P +        E   K LIEGI++T
Sbjct: 62  RTEREVADARTYAVTNFARDMLNTADNIRRALDSVPEEARAGA---EGPFKGLIEGIDLT 118

Query: 120 RREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
            R++  TLER+GVK +D K Q+F+PN HQAMFE P+  VP  T+++VVQ GY I +R LR
Sbjct: 119 ERDLTKTLERHGVKVVDPKGQRFDPNRHQAMFEVPNTEVPNGTVVQVVQTGYVIGDRTLR 178

Query: 180 PALVSISKGKTQNPTEEKKETI 201
           PALV +SKG  +    + K   
Sbjct: 179 PALVGVSKGGPKPEANKDKPAD 200


>gi|240137000|ref|YP_002961469.1| putative heat shock protein (HSP-70 COFACTOR), grpE
           [Methylobacterium extorquens AM1]
 gi|240006966|gb|ACS38192.1| putative heat shock protein (HSP-70 COFACTOR), grpE
           [Methylobacterium extorquens AM1]
          Length = 202

 Score =  141 bits (355), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 87/202 (43%), Positives = 123/202 (60%), Gaps = 4/202 (1%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEK-SEINIPEESLNQSEEFRDKYLRVIAEMENLRR 59
           M   M +              S A +  ++      ++ + +EF+D+ LR +AEMENLRR
Sbjct: 2   MADDMEKHERHDGAEAEVPPQSGASQAGADAEGLAAAIAERDEFKDRLLRTLAEMENLRR 61

Query: 60  RTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMT 119
           RT+RE  DA++Y++  FARDML+ +DN+ RALDS P +        E   K LIEGI++T
Sbjct: 62  RTEREVADARTYAVTNFARDMLNTADNIRRALDSVPEEARAGA---EGPFKGLIEGIDLT 118

Query: 120 RREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
            R++  TLER+GVK +D K Q+F+PN HQAMFE P+  VP  T+++VVQ GY I +R LR
Sbjct: 119 ERDLTKTLERHGVKVVDPKGQRFDPNRHQAMFEVPNTEVPNGTVVQVVQTGYVIGDRTLR 178

Query: 180 PALVSISKGKTQNPTEEKKETI 201
           PALV +SKG  +    + K   
Sbjct: 179 PALVGVSKGGPKPEANKDKSAD 200


>gi|45185804|ref|NP_983520.1| ACR118Wp [Ashbya gossypii ATCC 10895]
 gi|52782892|sp|Q75C01|GRPE_ASHGO RecName: Full=GrpE protein homolog, mitochondrial; Flags: Precursor
 gi|44981559|gb|AAS51344.1| ACR118Wp [Ashbya gossypii ATCC 10895]
          Length = 212

 Score =  141 bits (355), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 48/171 (28%), Positives = 86/171 (50%), Gaps = 4/171 (2%)

Query: 19  ANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFAR 78
            +++            +   ++ + +D+ LR +A+  NL+  T R+ + A+ +++ +F++
Sbjct: 44  ESAADPRVAELEKQLADKSKEAADLKDRLLRSVADFRNLQEVTRRDVQKARDFALQRFSK 103

Query: 79  DMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
           D+L   DN   AL +   +      +    +  L  G+ +TR     TL ++G+  IDA 
Sbjct: 104 DLLESLDNFGHALGAVSPEAL----QRSPEIADLHAGVRLTRDVFEKTLLKHGIAPIDAL 159

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
            Q F+PN+H+A FE P       T+  V Q GY +N RV+RPA V + K  
Sbjct: 160 GQPFDPNLHEATFELPQPDKTPGTVFHVQQPGYTLNGRVIRPAKVGVVKDP 210


>gi|222147324|ref|YP_002548281.1| heat shock protein GrpE [Agrobacterium vitis S4]
 gi|254799578|sp|B9JZG5|GRPE_AGRVS RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|221734314|gb|ACM35277.1| GRPE protein [Agrobacterium vitis S4]
          Length = 204

 Score =  141 bits (355), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 89/189 (47%), Positives = 130/189 (68%), Gaps = 3/189 (1%)

Query: 12  KEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
           + +     NS+  +   + N       ++ E RD++LR+ AEM+NLRRRT+R+ KDA+SY
Sbjct: 19  EPQVQEETNSTAEDAGQDNNPTAALQAENAELRDRFLRLAAEMDNLRRRTERDVKDAKSY 78

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
           ++  FARDML+VSDNL RA+D+ P +     +   + L +LIEG+EMT R M+STLER+G
Sbjct: 79  AVTAFARDMLAVSDNLRRAIDAVPAEAKEEAQ---AGLTALIEGVEMTERAMLSTLERHG 135

Query: 132 VKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQ 191
           V+KI+ + QKF+PN HQAMFE P+  VP NT+++VVQ GY I +RVLRPA+V ++KG  +
Sbjct: 136 VRKIEPEGQKFDPNFHQAMFEIPNPQVPNNTVVQVVQPGYTIGDRVLRPAMVGVAKGGPK 195

Query: 192 NPTEEKKET 200
             T +  + 
Sbjct: 196 AETAQAADA 204


>gi|217978934|ref|YP_002363081.1| GrpE protein [Methylocella silvestris BL2]
 gi|254799600|sp|B8ET77|GRPE_METSB RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|217504310|gb|ACK51719.1| GrpE protein [Methylocella silvestris BL2]
          Length = 187

 Score =  141 bits (354), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 79/185 (42%), Positives = 119/185 (64%), Gaps = 6/185 (3%)

Query: 10  IDKEKNPSNANSSTAEEKSEINI---PEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
            + E  P  A++       E +     E    ++   +DK LR +A+MENLRRRT++E  
Sbjct: 5   KNAENGPDEADTPQGAPSQEPDPFVVLENLQAENTSLKDKLLRTLADMENLRRRTEKEVA 64

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
           DA++Y +  FARDML+ +DNL RAL + P +        E  +++LIEG+++T R+  S 
Sbjct: 65  DAKTYGVTSFARDMLTFADNLHRALANVPAEARAKA---EPAVQTLIEGLQLTERDFASR 121

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           LER+GVKKID   QKF+PN+H+A+FE+P ++VP  T+ +V++ GY I ERVLRPA V +S
Sbjct: 122 LERFGVKKIDPAGQKFDPNLHEALFEQPDESVPNGTVTQVIEPGYVIGERVLRPAKVGVS 181

Query: 187 KGKTQ 191
           +G  +
Sbjct: 182 RGGPK 186


>gi|153007525|ref|YP_001368740.1| heat shock protein GrpE [Ochrobactrum anthropi ATCC 49188]
 gi|166215272|sp|A6WVA7|GRPE_OCHA4 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|151559413|gb|ABS12911.1| Ribulose-phosphate 3-epimerase [Ochrobactrum anthropi ATCC 49188]
          Length = 228

 Score =  141 bits (354), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 84/165 (50%), Positives = 117/165 (70%), Gaps = 4/165 (2%)

Query: 36  SLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAP 95
               + E +D+ LR  AEMENLR+RT R+ +DA++Y++  FARDMLSVSDNL RALD+ P
Sbjct: 65  LEADNGELKDQLLRAAAEMENLRKRTQRDVQDARTYAVTNFARDMLSVSDNLRRALDAIP 124

Query: 96  LDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPH 155
            D   +    ++ LKSL +G+EMT R M+  LER+GVKK++ + +KF+PN HQAMFE P+
Sbjct: 125 ADALAT----DASLKSLADGVEMTERAMLQALERHGVKKLEPEGEKFDPNFHQAMFEVPN 180

Query: 156 DTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKET 200
             +P NT+++VVQDGYAI +RVLRPA+V +SKG  +   +     
Sbjct: 181 PDLPNNTVVQVVQDGYAIGDRVLRPAMVGVSKGGPKATADNGASE 225


>gi|254558852|ref|YP_003065947.1| heat shock protein [Methylobacterium extorquens DM4]
 gi|254266130|emb|CAX21882.1| putative heat shock protein (HSP-70 COFACTOR), grpE
           [Methylobacterium extorquens DM4]
          Length = 202

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 87/202 (43%), Positives = 123/202 (60%), Gaps = 4/202 (1%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEK-SEINIPEESLNQSEEFRDKYLRVIAEMENLRR 59
           M   M +              S A +  ++      ++ + +EF+D+ LR +AEMENLRR
Sbjct: 2   MADDMEKHERHDGAEAEVPPQSGASQAGADAEGLAAAIAERDEFKDRLLRTLAEMENLRR 61

Query: 60  RTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMT 119
           RT+RE  DA++Y++  FARDML+ +DN+ RALDS P +        E   K LIEGI++T
Sbjct: 62  RTEREVADARTYAVTNFARDMLNTADNIRRALDSVPEEARAGA---EGPFKDLIEGIDLT 118

Query: 120 RREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
            R++  TLER+GVK +D K Q+F+PN HQAMFE P+  VP  T+++VVQ GY I +R LR
Sbjct: 119 ERDLTKTLERHGVKVVDPKGQRFDPNRHQAMFEVPNTEVPNGTVVQVVQTGYVIGDRTLR 178

Query: 180 PALVSISKGKTQNPTEEKKETI 201
           PALV +SKG  +    + K   
Sbjct: 179 PALVGVSKGGPKPEANKDKSAD 200


>gi|306842544|ref|ZP_07475195.1| heat shock protein GrpE [Brucella sp. BO2]
 gi|306287400|gb|EFM58880.1| heat shock protein GrpE [Brucella sp. BO2]
          Length = 234

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 93/181 (51%), Positives = 122/181 (67%), Gaps = 4/181 (2%)

Query: 25  EEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVS 84
           E     N        + E +D+ LRV AEMENLR+RT R+ +DA++Y+I  FARDMLSVS
Sbjct: 58  EVDDTANRIAVLEADNTELKDQMLRVAAEMENLRKRTQRDVQDARAYAITNFARDMLSVS 117

Query: 85  DNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNP 144
           DNL RALD+ P D   +    +S LKSL EG+EMT R M+  LER+GVKK++ + QKF+P
Sbjct: 118 DNLRRALDAIPADALEA----DSNLKSLSEGVEMTERAMLLALERHGVKKLEPEGQKFDP 173

Query: 145 NMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQP 204
           N HQAMFE P+  +P NT+++VVQ GYAI +RVLRPA+V +SKG  +   E    T E  
Sbjct: 174 NFHQAMFEVPNPDLPNNTVVQVVQAGYAIGDRVLRPAMVGVSKGGPKVSAENGASTSEDN 233

Query: 205 S 205
           +
Sbjct: 234 A 234


>gi|163842440|ref|YP_001626844.1| protein grpE [Brucella suis ATCC 23445]
 gi|189041735|sp|B0CJ30|GRPE_BRUSI RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|163673163|gb|ABY37274.1| Protein grpE [Brucella suis ATCC 23445]
          Length = 230

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 93/181 (51%), Positives = 122/181 (67%), Gaps = 4/181 (2%)

Query: 25  EEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVS 84
           E     N        + E +D+ LRV AEMENLR+RT R+ +DA++Y+I  FARDMLSVS
Sbjct: 54  EVDETANRIAVLEADNTELKDQMLRVAAEMENLRKRTQRDVQDARAYAITNFARDMLSVS 113

Query: 85  DNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNP 144
           DNL RALD+ P D   +    +S LKSL EG+EMT R M+  LER+GVKK++ + QKF+P
Sbjct: 114 DNLRRALDAIPADALEA----DSNLKSLSEGVEMTERAMLLALERHGVKKLEPEGQKFDP 169

Query: 145 NMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQP 204
           N HQAMFE P+  +P NT+++VVQ GYAI +RVLRPA+V +SKG  +   E    T E  
Sbjct: 170 NFHQAMFEVPNPDLPNNTVVQVVQAGYAIGDRVLRPAMVGVSKGGPKVSAENGASTSEDN 229

Query: 205 S 205
           +
Sbjct: 230 A 230


>gi|254718385|ref|ZP_05180196.1| heat shock protein GrpE [Brucella sp. 83/13]
 gi|265983349|ref|ZP_06096084.1| grpE [Brucella sp. 83/13]
 gi|306839618|ref|ZP_07472422.1| heat shock protein GrpE [Brucella sp. NF 2653]
 gi|264661941|gb|EEZ32202.1| grpE [Brucella sp. 83/13]
 gi|306405316|gb|EFM61591.1| heat shock protein GrpE [Brucella sp. NF 2653]
          Length = 230

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 93/181 (51%), Positives = 122/181 (67%), Gaps = 4/181 (2%)

Query: 25  EEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVS 84
           E     N        + E +D+ LRV AEMENLR+RT R+ +DA++Y+I  FARDMLSVS
Sbjct: 54  EVDETANRIAVLEADNTELKDQMLRVAAEMENLRKRTQRDVQDARAYAITNFARDMLSVS 113

Query: 85  DNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNP 144
           DNL RALD+ P D   +    +S LKSL EG+EMT R M+  LER+GVKK++ + QKF+P
Sbjct: 114 DNLRRALDAIPADALEA----DSNLKSLSEGVEMTERAMLLALERHGVKKLEPEGQKFDP 169

Query: 145 NMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQP 204
           N HQAMFE P+  +P NT+++VVQ GYAI +RVLRPA+V +SKG  +   E    T E  
Sbjct: 170 NFHQAMFEVPNPDLPNNTVVQVVQAGYAIGDRVLRPAMVGVSKGGPKISAENGASTSEDN 229

Query: 205 S 205
           +
Sbjct: 230 A 230


>gi|23501082|ref|NP_697209.1| heat shock protein GrpE [Brucella suis 1330]
 gi|161618159|ref|YP_001592046.1| protein grpE [Brucella canis ATCC 23365]
 gi|225626709|ref|ZP_03784748.1| Protein grpE [Brucella ceti str. Cudo]
 gi|225851704|ref|YP_002731937.1| heat shock protein GrpE [Brucella melitensis ATCC 23457]
 gi|254700976|ref|ZP_05162804.1| heat shock protein GrpE [Brucella suis bv. 5 str. 513]
 gi|254705347|ref|ZP_05167175.1| heat shock protein GrpE [Brucella suis bv. 3 str. 686]
 gi|254709317|ref|ZP_05171128.1| heat shock protein GrpE [Brucella pinnipedialis B2/94]
 gi|256030840|ref|ZP_05444454.1| heat shock protein GrpE [Brucella pinnipedialis M292/94/1]
 gi|256060310|ref|ZP_05450483.1| heat shock protein GrpE [Brucella neotomae 5K33]
 gi|256112673|ref|ZP_05453594.1| heat shock protein GrpE [Brucella melitensis bv. 3 str. Ether]
 gi|256158869|ref|ZP_05456723.1| heat shock protein GrpE [Brucella ceti M490/95/1]
 gi|256254246|ref|ZP_05459782.1| heat shock protein GrpE [Brucella ceti B1/94]
 gi|256264786|ref|ZP_05467318.1| protein grpE [Brucella melitensis bv. 2 str. 63/9]
 gi|256368635|ref|YP_003106141.1| heat shock protein GrpE [Brucella microti CCM 4915]
 gi|260169744|ref|ZP_05756555.1| heat shock protein GrpE [Brucella sp. F5/99]
 gi|260567192|ref|ZP_05837662.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|261221397|ref|ZP_05935678.1| protein grpE [Brucella ceti B1/94]
 gi|261316828|ref|ZP_05956025.1| grpE [Brucella pinnipedialis B2/94]
 gi|261324285|ref|ZP_05963482.1| protein grpE [Brucella neotomae 5K33]
 gi|261751497|ref|ZP_05995206.1| protein grpE [Brucella suis bv. 5 str. 513]
 gi|261756060|ref|ZP_05999769.1| protein grpE [Brucella suis bv. 3 str. 686]
 gi|261759285|ref|ZP_06002994.1| protein grpE [Brucella sp. F5/99]
 gi|265987898|ref|ZP_06100455.1| protein grpE [Brucella pinnipedialis M292/94/1]
 gi|265994116|ref|ZP_06106673.1| protein grpE [Brucella melitensis bv. 3 str. Ether]
 gi|265997359|ref|ZP_06109916.1| protein grpE [Brucella ceti M490/95/1]
 gi|294851569|ref|ZP_06792242.1| grpE [Brucella sp. NVSL 07-0026]
 gi|306844438|ref|ZP_07477028.1| heat shock protein GrpE [Brucella sp. BO1]
 gi|52782949|sp|Q8G2Y6|GRPE_BRUSU RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|189041734|sp|A9M7B6|GRPE_BRUC2 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|23346951|gb|AAN29124.1| heat shock protein GrpE [Brucella suis 1330]
 gi|161334970|gb|ABX61275.1| Protein grpE [Brucella canis ATCC 23365]
 gi|225618366|gb|EEH15409.1| Protein grpE [Brucella ceti str. Cudo]
 gi|225640069|gb|ACN99982.1| Protein grpE [Brucella melitensis ATCC 23457]
 gi|255998793|gb|ACU47192.1| heat shock protein GrpE [Brucella microti CCM 4915]
 gi|260156710|gb|EEW91790.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260919981|gb|EEX86634.1| protein grpE [Brucella ceti B1/94]
 gi|261296051|gb|EEX99547.1| grpE [Brucella pinnipedialis B2/94]
 gi|261300265|gb|EEY03762.1| protein grpE [Brucella neotomae 5K33]
 gi|261739269|gb|EEY27265.1| protein grpE [Brucella sp. F5/99]
 gi|261741250|gb|EEY29176.1| protein grpE [Brucella suis bv. 5 str. 513]
 gi|261745813|gb|EEY33739.1| protein grpE [Brucella suis bv. 3 str. 686]
 gi|262551827|gb|EEZ07817.1| protein grpE [Brucella ceti M490/95/1]
 gi|262765097|gb|EEZ11018.1| protein grpE [Brucella melitensis bv. 3 str. Ether]
 gi|263095195|gb|EEZ18864.1| protein grpE [Brucella melitensis bv. 2 str. 63/9]
 gi|264660095|gb|EEZ30356.1| protein grpE [Brucella pinnipedialis M292/94/1]
 gi|294820158|gb|EFG37157.1| grpE [Brucella sp. NVSL 07-0026]
 gi|306275251|gb|EFM57001.1| heat shock protein GrpE [Brucella sp. BO1]
 gi|326408192|gb|ADZ65257.1| heat shock protein GrpE [Brucella melitensis M28]
 gi|326537907|gb|ADZ86122.1| protein grpE [Brucella melitensis M5-90]
          Length = 230

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 93/181 (51%), Positives = 122/181 (67%), Gaps = 4/181 (2%)

Query: 25  EEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVS 84
           E     N        + E +D+ LRV AEMENLR+RT R+ +DA++Y+I  FARDMLSVS
Sbjct: 54  EVDETANRIAVLEADNTELKDQMLRVAAEMENLRKRTQRDVQDARAYAITNFARDMLSVS 113

Query: 85  DNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNP 144
           DNL RALD+ P D   +    +S LKSL EG+EMT R M+  LER+GVKK++ + QKF+P
Sbjct: 114 DNLRRALDAIPADALEA----DSNLKSLSEGVEMTERAMLLALERHGVKKLEPEGQKFDP 169

Query: 145 NMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQP 204
           N HQAMFE P+  +P NT+++VVQ GYAI +RVLRPA+V +SKG  +   E    T E  
Sbjct: 170 NFHQAMFEVPNPDLPNNTVVQVVQAGYAIGDRVLRPAMVGVSKGGPKVSAENGASTSEDN 229

Query: 205 S 205
           +
Sbjct: 230 A 230


>gi|148560678|ref|YP_001258203.1| heat shock protein GrpE [Brucella ovis ATCC 25840]
 gi|166215250|sp|A5VNA6|GRPE_BRUO2 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|148371935|gb|ABQ61914.1| heat shock protein GrpE [Brucella ovis ATCC 25840]
          Length = 230

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 93/181 (51%), Positives = 122/181 (67%), Gaps = 4/181 (2%)

Query: 25  EEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVS 84
           E     N        + E +D+ LRV AEMENLR+RT R+ +DA++Y+I  FARDMLSVS
Sbjct: 54  EVDETANRIAVLEADNTELKDQMLRVAAEMENLRKRTQRDVQDARAYAITNFARDMLSVS 113

Query: 85  DNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNP 144
           DNL RALD+ P D   +    +S LKSL EG+EMT R M+  LER+GVKK++ + QKF+P
Sbjct: 114 DNLRRALDTIPADALEA----DSNLKSLSEGVEMTERAMLLALERHGVKKLEPEGQKFDP 169

Query: 145 NMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQP 204
           N HQAMFE P+  +P NT+++VVQ GYAI +RVLRPA+V +SKG  +   E    T E  
Sbjct: 170 NFHQAMFEVPNPDLPNNTVVQVVQAGYAIGDRVLRPAMVGVSKGGPKVSAENGASTSEDN 229

Query: 205 S 205
           +
Sbjct: 230 A 230


>gi|209883569|ref|YP_002287426.1| co-chaperone GrpE [Oligotropha carboxidovorans OM5]
 gi|226737152|sp|B6JCI1|GRPE_OLICO RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|209871765|gb|ACI91561.1| co-chaperone GrpE [Oligotropha carboxidovorans OM5]
          Length = 200

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 82/203 (40%), Positives = 127/203 (62%), Gaps = 16/203 (7%)

Query: 5   MSEKNIDKEKNPSNANSSTAE-------------EKSEINIPEESLNQSEEFRDKYLRVI 51
           M++ +  K+ + + A ++ ++             +  E    E  + ++ E +D+ LR +
Sbjct: 1   MTDNDGQKDFSEAAAENAGSKPGEPRVSKPYIMPDDPEETPSEALVKEAAEAKDRMLRTL 60

Query: 52  AEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKS 111
           AEMENLR+RT RE  DA++Y IA FARD+L ++DNL RAL       A +   ++  L +
Sbjct: 61  AEMENLRKRTQREVADARAYGIAGFARDVLEIADNLQRAL---DAVPAEARAAADPGLTA 117

Query: 112 LIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGY 171
           LIEG+E+T R +   LE+ GVKK+DA  +KF+PN+HQAMFE P ++VP  T+++V+Q GY
Sbjct: 118 LIEGVELTERSLHRALEKNGVKKLDAAGEKFDPNIHQAMFEVPDNSVPPGTVVQVIQTGY 177

Query: 172 AINERVLRPALVSISKGKTQNPT 194
            I +RVLRPALV +SK + +   
Sbjct: 178 MIGDRVLRPALVGVSKAEPKPAA 200


>gi|330504844|ref|YP_004381713.1| heat shock protein GrpE [Pseudomonas mendocina NK-01]
 gi|328919130|gb|AEB59961.1| heat shock protein GrpE [Pseudomonas mendocina NK-01]
          Length = 189

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 63/197 (31%), Positives = 106/197 (53%), Gaps = 8/197 (4%)

Query: 4   FMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDR 63
              E+N+D +   + A  + A         +    Q    +D+ LRV AE++N+RRR ++
Sbjct: 1   MADEQNLDTQNPETPAAENAASSDDLAARVQALEEQLAAAQDQSLRVAAELQNVRRRAEQ 60

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           + + A  +++ KFA D+L V D+L R L+ +  D        +  +K++ EG+++T +  
Sbjct: 61  DVEKAHKFALEKFANDLLPVVDSLERGLELSSPD--------DEAIKAVREGMQLTLKLF 112

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
           + TL R+ ++ ID     FNP  HQAM  E    V  N+++KV Q GY +N R+LRPA+V
Sbjct: 113 LDTLARHQLEAIDPHGAPFNPEHHQAMAMEESINVEPNSVLKVFQKGYLLNGRLLRPAMV 172

Query: 184 SISKGKTQNPTEEKKET 200
            +SK  T  P    ++ 
Sbjct: 173 VVSKAPTTPPPSIDEQA 189


>gi|254566553|ref|XP_002490387.1| GrpE protein homolog, mitochondrial [Pichia pastoris GS115]
 gi|238030183|emb|CAY68106.1| GrpE protein homolog, mitochondrial [Pichia pastoris GS115]
          Length = 295

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 66/203 (32%), Positives = 104/203 (51%), Gaps = 11/203 (5%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEE-------FRDKYLRVIAEME 55
            F ++K+        +  S   +  SE++  E+   +  E        +D+YLR +A+  
Sbjct: 43  KFNAKKDEAPNAKEESTESPEKDASSELSEVEQLKAKLAEKDQEVTLLKDRYLRSVADFR 102

Query: 56  NLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEG 115
           NL+  T RE + A+ +++ KFARD+L   DN   AL +   +   +       +  L +G
Sbjct: 103 NLQETTKREIQKARDFALQKFARDLLESLDNFGHALSAVKDETLAA----NKEVSQLYDG 158

Query: 116 IEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINE 175
           +EMT+     TL R+G+ KID  D++F+PN H+A FE P       T+  V Q GY +N 
Sbjct: 159 VEMTKNIFEKTLVRHGINKIDPVDERFDPNRHEATFEVPQPDKEPGTVFHVQQPGYELNG 218

Query: 176 RVLRPALVSISKGKTQNPTEEKK 198
           RVLR A V + KG T+N   +K 
Sbjct: 219 RVLRAAKVGVVKGGTENLNSDKD 241


>gi|300024888|ref|YP_003757499.1| GrpE protein [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526709|gb|ADJ25178.1| GrpE protein [Hyphomicrobium denitrificans ATCC 51888]
          Length = 205

 Score =  139 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 68/206 (33%), Positives = 113/206 (54%), Gaps = 13/206 (6%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEI---------NIPEESLNQSEEFRDKYLRVIAEME 55
           MS++N   ++   +A S   +   E             +    +    +D YLR +AE E
Sbjct: 1   MSDENKPVDEPIEDAASEHGDVTPEQLKAMVAALQAEIDNKTAEVAAKQDAYLRAVAETE 60

Query: 56  NLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEG 115
           N+RRR ++EK++   Y+I+KFA+D+L+V DN  RA+ + P D        +  L +L++G
Sbjct: 61  NVRRRLEKEKEETAKYAISKFAKDILTVGDNFQRAIAAVPKDALEG----DPALSALLDG 116

Query: 116 IEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINE 175
           + +  R+    LER+G+   D   Q FNP+ HQA+ E+ +  VP+ T+++V Q GY I +
Sbjct: 117 VVLAERDYRGALERHGIVVDDPVGQPFNPHHHQAVMEQENPDVPSGTVLQVFQVGYLIED 176

Query: 176 RVLRPALVSISKGKTQNPTEEKKETI 201
           R LRPA+V +SKG  +   ++  E  
Sbjct: 177 RCLRPAMVVVSKGGPKVAKQDVNEPP 202


>gi|23012592|ref|ZP_00052639.1| COG0576: Molecular chaperone GrpE (heat shock protein)
           [Magnetospirillum magnetotacticum MS-1]
          Length = 208

 Score =  139 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 83/165 (50%), Positives = 113/165 (68%), Gaps = 3/165 (1%)

Query: 37  LNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPL 96
           + + +EF+D+ LR +AEMENLRRRT+RE  DA++Y++  FARDML+ +DN+ RAL+S P 
Sbjct: 42  IAERDEFKDRLLRTLAEMENLRRRTEREVADARTYAVTSFARDMLNAADNIRRALESVPE 101

Query: 97  DLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHD 156
           D        E   K LIEGIE+T R++  TLER+GVK +D   Q+F+PN HQAMFE P+ 
Sbjct: 102 DARAGA---EGAFKGLIEGIELTERDLAKTLERHGVKVVDPNGQRFDPNRHQAMFEVPNT 158

Query: 157 TVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETI 201
            VP  T+++VVQ GY I +R LRPALV +SKG  +    + K   
Sbjct: 159 EVPNGTVVQVVQTGYIIGDRTLRPALVGVSKGGPKPEANKDKPAD 203


>gi|188579683|ref|YP_001923128.1| GrpE protein [Methylobacterium populi BJ001]
 gi|179343181|gb|ACB78593.1| GrpE protein [Methylobacterium populi BJ001]
          Length = 202

 Score =  139 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 84/200 (42%), Positives = 127/200 (63%), Gaps = 3/200 (1%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           +   ++   +  +      ++++   ++      ++ + +EF+D+ LR +AEMENLRRRT
Sbjct: 4   DDMENQDRHNGAEAEVPPQAASSTAGADAEALAAAIAERDEFKDRLLRTLAEMENLRRRT 63

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           +RE  DA++Y++  FARDML+ +DN+ RAL+S P D   S    E   K+L+EGIE+T R
Sbjct: 64  EREVADARTYAVTNFARDMLNAADNIHRALESVPADARASA---EGAFKALVEGIELTER 120

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           ++  TLER+GVK +D + Q+F+PN HQAMFE P+  VP  T+++VVQ GY I ER LRPA
Sbjct: 121 DLAKTLERHGVKVVDPQGQRFDPNRHQAMFEVPNTEVPNGTVVQVVQTGYVIGERTLRPA 180

Query: 182 LVSISKGKTQNPTEEKKETI 201
           LV +SKG  +      K   
Sbjct: 181 LVGVSKGGPKPEASRDKPAD 200


>gi|254713262|ref|ZP_05175073.1| heat shock protein GrpE [Brucella ceti M644/93/1]
 gi|254716385|ref|ZP_05178196.1| heat shock protein GrpE [Brucella ceti M13/05/1]
 gi|261218171|ref|ZP_05932452.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261320981|ref|ZP_05960178.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|260923260|gb|EEX89828.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261293671|gb|EEX97167.1| conserved hypothetical protein [Brucella ceti M644/93/1]
          Length = 230

 Score =  139 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 92/179 (51%), Positives = 121/179 (67%), Gaps = 4/179 (2%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
               N        + E +D+ LRV AEMENLR+RT R+ +DA++Y+I  FARDMLSVSDN
Sbjct: 56  DETANRIAVLEADNTELKDQMLRVAAEMENLRKRTQRDVQDARAYAITNFARDMLSVSDN 115

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNM 146
           L RALD+ P D   +    +S LKSL EG+EMT R M+  LER+GVKK++ + QKF+PN 
Sbjct: 116 LRRALDAIPADALEA----DSNLKSLSEGVEMTERAMLLALERHGVKKLEPEGQKFDPNF 171

Query: 147 HQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQPS 205
           HQAMFE P+  +P NT+++VVQ GYAI +RVLRPA+V +SKG  +   E    T E  +
Sbjct: 172 HQAMFEVPNPDLPNNTVVQVVQAGYAIGDRVLRPAMVGVSKGGPKVSAENGASTSEDNA 230


>gi|62289147|ref|YP_220940.1| heat shock protein GrpE [Brucella abortus bv. 1 str. 9-941]
 gi|82699086|ref|YP_413660.1| heat shock protein GrpE [Brucella melitensis biovar Abortus 2308]
 gi|189023421|ref|YP_001934189.1| heat shock protein GrpE [Brucella abortus S19]
 gi|237814640|ref|ZP_04593638.1| Protein grpE [Brucella abortus str. 2308 A]
 gi|254690472|ref|ZP_05153726.1| heat shock protein GrpE [Brucella abortus bv. 6 str. 870]
 gi|254694961|ref|ZP_05156789.1| heat shock protein GrpE [Brucella abortus bv. 3 str. Tulya]
 gi|254696592|ref|ZP_05158420.1| heat shock protein GrpE [Brucella abortus bv. 2 str. 86/8/59]
 gi|254731505|ref|ZP_05190083.1| heat shock protein GrpE [Brucella abortus bv. 4 str. 292]
 gi|256045960|ref|ZP_05448832.1| heat shock protein GrpE [Brucella melitensis bv. 1 str. Rev.1]
 gi|256258728|ref|ZP_05464264.1| heat shock protein GrpE [Brucella abortus bv. 9 str. C68]
 gi|260546444|ref|ZP_05822184.1| grpE [Brucella abortus NCTC 8038]
 gi|260563243|ref|ZP_05833729.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260756026|ref|ZP_05868374.1| HSP-70 cofactor [Brucella abortus bv. 6 str. 870]
 gi|260759250|ref|ZP_05871598.1| HSP-70 cofactor [Brucella abortus bv. 4 str. 292]
 gi|260760972|ref|ZP_05873315.1| HSP-70 cofactor [Brucella abortus bv. 2 str. 86/8/59]
 gi|260885047|ref|ZP_05896661.1| protein grpE [Brucella abortus bv. 9 str. C68]
 gi|261215303|ref|ZP_05929584.1| HSP-70 cofactor [Brucella abortus bv. 3 str. Tulya]
 gi|265992373|ref|ZP_06104930.1| protein grpE [Brucella melitensis bv. 1 str. Rev.1]
 gi|297247563|ref|ZP_06931281.1| grpE protein [Brucella abortus bv. 5 str. B3196]
 gi|52782965|sp|Q8YEV0|GRPE_BRUME RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|62195279|gb|AAX73579.1| GrpE, heat shock protein [Brucella abortus bv. 1 str. 9-941]
 gi|82615187|emb|CAJ10126.1| GrpE protein [Brucella melitensis biovar Abortus 2308]
 gi|189018993|gb|ACD71715.1| GrpE protein [Brucella abortus S19]
 gi|237789477|gb|EEP63687.1| Protein grpE [Brucella abortus str. 2308 A]
 gi|260096551|gb|EEW80427.1| grpE [Brucella abortus NCTC 8038]
 gi|260153259|gb|EEW88351.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260669568|gb|EEX56508.1| HSP-70 cofactor [Brucella abortus bv. 4 str. 292]
 gi|260671404|gb|EEX58225.1| HSP-70 cofactor [Brucella abortus bv. 2 str. 86/8/59]
 gi|260676134|gb|EEX62955.1| HSP-70 cofactor [Brucella abortus bv. 6 str. 870]
 gi|260874575|gb|EEX81644.1| protein grpE [Brucella abortus bv. 9 str. C68]
 gi|260916910|gb|EEX83771.1| HSP-70 cofactor [Brucella abortus bv. 3 str. Tulya]
 gi|263003439|gb|EEZ15732.1| protein grpE [Brucella melitensis bv. 1 str. Rev.1]
 gi|297174732|gb|EFH34079.1| grpE protein [Brucella abortus bv. 5 str. B3196]
          Length = 226

 Score =  139 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 92/179 (51%), Positives = 121/179 (67%), Gaps = 4/179 (2%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
               N        + E +D+ LRV AEMENLR+RT R+ +DA++Y+I  FARDMLSVSDN
Sbjct: 52  DETANRIAVLEADNTELKDQMLRVAAEMENLRKRTQRDVQDARAYAITNFARDMLSVSDN 111

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNM 146
           L RALD+ P D   +    +S LKSL EG+EMT R M+  LER+GVKK++ + QKF+PN 
Sbjct: 112 LRRALDAIPADALEA----DSNLKSLSEGVEMTERAMLLALERHGVKKLEPEGQKFDPNF 167

Query: 147 HQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQPS 205
           HQAMFE P+  +P NT+++VVQ GYAI +RVLRPA+V +SKG  +   E    T E  +
Sbjct: 168 HQAMFEVPNPDLPNNTVVQVVQAGYAIGDRVLRPAMVGVSKGGPKVSAENGASTSEDNA 226


>gi|227818330|ref|YP_002822301.1| heat shock protein GrpE-like protein [Sinorhizobium fredii NGR234]
 gi|227337329|gb|ACP21548.1| heat shock protein GrpE-like protein [Sinorhizobium fredii NGR234]
          Length = 198

 Score =  138 bits (347), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 56/189 (29%), Positives = 106/189 (56%), Gaps = 5/189 (2%)

Query: 11  DKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQS 70
              ++  +A    AE  ++         +  E +D+ LR +AE +N+R +  R+ +DA  
Sbjct: 13  KAAESGPDAEMPAAETVADQASLTALQAELAETKDRLLRAVAEQQNIRLQMQRQCEDAVK 72

Query: 71  YSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERY 130
           ++ ++   D+L   DNL RA++S P + +        V+  L++G+E T   +++TL R+
Sbjct: 73  FAASQLMGDLLDTLDNLRRAIESVPSEASG-----HDVVNPLLKGVEATESNLLATLARH 127

Query: 131 GVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           GV++ID   Q F+P+ H A+F+ P  T    T+++V+Q GY ++ RVLRPA+V ++   +
Sbjct: 128 GVQRIDPLGQAFDPHHHHAIFQRPDATAAEGTVVEVLQPGYMLHGRVLRPAMVGVAVRGS 187

Query: 191 QNPTEEKKE 199
           Q+    + +
Sbjct: 188 QHGGPPRDD 196


>gi|298293786|ref|YP_003695725.1| GrpE protein [Starkeya novella DSM 506]
 gi|296930297|gb|ADH91106.1| GrpE protein [Starkeya novella DSM 506]
          Length = 206

 Score =  138 bits (346), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 76/198 (38%), Positives = 118/198 (59%), Gaps = 14/198 (7%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEI-----------NIPEESLNQSEEFRDKYLRVIAE 53
           MS++N      P  A+ + A E   +              +    +    +DK+LR  AE
Sbjct: 1   MSDENRKPADQPDVADEARAAENDALAATDDLAAHFTAEKDRLEGEIATLKDKFLRAFAE 60

Query: 54  MENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLI 113
            +N+RRR +RE  DA+ Y I  FARD+L+V+D+  RAL +   +        E  LK+++
Sbjct: 61  ADNVRRRAEREVADAKVYGITGFARDILTVADDFERALGAVDAEAREKA---EGPLKTVL 117

Query: 114 EGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAI 173
           +GI++T R +  TL ++GV +I+A+  KF+PN+HQAMFE P+  +P+ T+++V+Q GY I
Sbjct: 118 DGIDITARALTQTLAKHGVARIEAEGAKFDPNLHQAMFEVPNTELPSGTVVQVIQPGYKI 177

Query: 174 NERVLRPALVSISKGKTQ 191
            ERVLRPALV +SKG  +
Sbjct: 178 GERVLRPALVGVSKGGPK 195


>gi|296448432|ref|ZP_06890316.1| GrpE protein [Methylosinus trichosporium OB3b]
 gi|296254056|gb|EFH01199.1| GrpE protein [Methylosinus trichosporium OB3b]
          Length = 192

 Score =  138 bits (346), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 77/194 (39%), Positives = 121/194 (62%), Gaps = 10/194 (5%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEI-------NIPEESLNQSEEFRDKYLRVIAEMENL 57
           MSE    +   P        E ++         +  E    ++   +DK LR +A+MEN+
Sbjct: 1   MSEDKKTETTPPGEVPPLAGEAEAPAETAAEAGSELEALRAEAAGLKDKLLRTLADMENM 60

Query: 58  RRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIE 117
           RRRT++E  DA+ Y +A FAR+ML+ +DNL RA++S P+    +    +  + +LIEG+E
Sbjct: 61  RRRTEKEVADAKVYGVANFAREMLTFADNLRRAVESVPVGARETL---DQSVVTLIEGME 117

Query: 118 MTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERV 177
           +T R+ +S L R+GVK+I+AK Q+F+PN H+A+FE P ++VP  T+ +VV+ GY I ERV
Sbjct: 118 LTERDFLSRLGRFGVKRIEAKGQRFDPNQHEALFEIPDESVPNGTVAQVVEPGYLIGERV 177

Query: 178 LRPALVSISKGKTQ 191
           LRPA V +++G  +
Sbjct: 178 LRPAKVGVARGGPK 191


>gi|118593733|ref|ZP_01551102.1| GRPE protein [Stappia aggregata IAM 12614]
 gi|118433643|gb|EAV40306.1| GRPE protein [Stappia aggregata IAM 12614]
          Length = 207

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 91/204 (44%), Positives = 138/204 (67%), Gaps = 10/204 (4%)

Query: 5   MSEKNIDKEKNPSNAN-------SSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENL 57
           MS++N + E+ P+ A           A E + ++  E    ++ + +D+ LRV+AEMENL
Sbjct: 1   MSDENKNPEEQPAEATPETAAAEQPEAVEAAGVDPIEVLKAENADLKDRALRVMAEMENL 60

Query: 58  RRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIE 117
           RRRT++E KDA+ Y+++ FARDML+VSDNL RAL++ P D     K +++ + SLIEG+E
Sbjct: 61  RRRTEKEVKDARQYAVSGFARDMLTVSDNLRRALEALPED---DRKNADAGVASLIEGVE 117

Query: 118 MTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERV 177
           M  R++++ LE+ GVKK+D + QKF+PN HQAMFE P+  VP NT+++V+Q GY I +RV
Sbjct: 118 MIERDLLNQLEKNGVKKLDPEGQKFDPNFHQAMFEVPNTEVPNNTVVQVMQAGYVIGDRV 177

Query: 178 LRPALVSISKGKTQNPTEEKKETI 201
           LRPA+V +SKG  ++     +   
Sbjct: 178 LRPAMVGVSKGGPKDVAATAEAGQ 201


>gi|114706055|ref|ZP_01438958.1| probable heat shock protein [Fulvimarina pelagi HTCC2506]
 gi|114538901|gb|EAU42022.1| probable heat shock protein [Fulvimarina pelagi HTCC2506]
          Length = 229

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 89/205 (43%), Positives = 134/205 (65%), Gaps = 5/205 (2%)

Query: 8   KNIDKEKNPSNANSSTAEEKSE--INIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
           +N +         +   EE +E       E  +++ + +D+ +R+ A+MENLRRRT+R+ 
Sbjct: 16  ENDETLAFDDAEGTLEGEETAERYEARIIELESENADVKDRLIRLAADMENLRRRTERDV 75

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
           KDA++Y++  FAR+MLSV+DNL RALD+ P +        ES L +LIEG+EMT R + +
Sbjct: 76  KDARNYAVTNFAREMLSVADNLRRALDAVPEEARA---GGESGLTALIEGVEMTERGLQA 132

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
           TLE++GVKK+D + QKF+PN HQAMFE P+  VP NT+++VVQ GYAI ERVLRPA+V +
Sbjct: 133 TLEKHGVKKLDPEGQKFDPNYHQAMFEVPNPDVPNNTVVQVVQAGYAIGERVLRPAMVGV 192

Query: 186 SKGKTQNPTEEKKETIEQPSPLDIE 210
           +KG  +    +   +I +    + +
Sbjct: 193 AKGGPKQAASKADASIMEHDEANEQ 217


>gi|170043539|ref|XP_001849441.1| grpE [Culex quinquefasciatus]
 gi|167866847|gb|EDS30230.1| grpE [Culex quinquefasciatus]
          Length = 221

 Score =  137 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 61/184 (33%), Positives = 107/184 (58%), Gaps = 3/184 (1%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
             E   + E+ P +      E        E    +++E  DKY R +A+ ENLRRR  ++
Sbjct: 41  SEEAPKNTEELPESERKLVGENVELKKELEAVTAKTKELDDKYKRALADGENLRRRLTKQ 100

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
            +DA+ + I  F +D+L V+D L  A ++ P +  +        LK+L EG+ MT+ ++ 
Sbjct: 101 IEDAKLFGIQGFCKDLLEVADILGHATEAVPKEEISDS---NPHLKNLYEGLTMTKAQLN 157

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
              +R+G+++++  ++KFNPN+H+A+F++    V  NT++ V + GY ++ER +RPALV 
Sbjct: 158 QVFKRHGLEQVNPLNEKFNPNLHEALFQQEVQNVEPNTVVVVSKIGYKLHERCIRPALVG 217

Query: 185 ISKG 188
           +SKG
Sbjct: 218 VSKG 221


>gi|170730625|ref|YP_001776058.1| heat shock protein GrpE [Xylella fastidiosa M12]
 gi|167965418|gb|ACA12428.1| heat shock protein GrpE [Xylella fastidiosa M12]
          Length = 200

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 49/184 (26%), Positives = 89/184 (48%), Gaps = 13/184 (7%)

Query: 4   FMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDR 63
           +M++ +   E +      ++ E        E    +    +   LR  AE+EN R+R  R
Sbjct: 28  YMNQDH--PECDSEELTQNSPETDPLKVEVETLRGEIASIKADVLRERAELENQRKRLIR 85

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           + + A+ ++  K   ++L V D+L   L ++  + +            L +G+E+T +++
Sbjct: 86  DVEQARKFANEKLLGELLPVFDSLDAGLTASGSEPSP-----------LRDGLELTYKQL 134

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
           +      G+  +D   Q FNP  HQA+ +     V    +I+V Q GY +NER+LRPALV
Sbjct: 135 LKVAIDNGLMLLDPVGQLFNPEHHQAISQTEVTDVEPGHVIQVFQKGYLLNERLLRPALV 194

Query: 184 SISK 187
            ++K
Sbjct: 195 VVAK 198


>gi|28199255|ref|NP_779569.1| heat shock protein GrpE [Xylella fastidiosa Temecula1]
 gi|28057361|gb|AAO29218.1| heat shock protein GrpE [Xylella fastidiosa Temecula1]
          Length = 200

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 49/184 (26%), Positives = 89/184 (48%), Gaps = 13/184 (7%)

Query: 4   FMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDR 63
           +M++ +   E +      ++ E        E    +    +   LR  AE+EN R+R  R
Sbjct: 28  YMNQDH--PECDSEELTQNSPETDPLKVEVETLRGEIASIKADVLRERAELENQRKRLIR 85

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           + + A+ ++  K   ++L V D+L   L ++  + +            L +G+E+T +++
Sbjct: 86  DVEQARKFANEKLLGELLPVFDSLDAGLTASGSEPSP-----------LRDGLELTYKQL 134

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
           +      G+  +D   Q FNP  HQA+ +     V    +I+V Q GY +NER+LRPALV
Sbjct: 135 LKVAIDNGLMLLDPVGQLFNPEHHQAISQTEVTDVEPGHVIQVFQKGYLLNERLLRPALV 194

Query: 184 SISK 187
            ++K
Sbjct: 195 VVAK 198


>gi|162147058|ref|YP_001601519.1| chaperone binding [Gluconacetobacter diazotrophicus PAl 5]
 gi|161785635|emb|CAP55206.1| Chaperone binding [Gluconacetobacter diazotrophicus PAl 5]
          Length = 274

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 67/184 (36%), Positives = 97/184 (52%), Gaps = 4/184 (2%)

Query: 33  PEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALD 92
            +E     EE R+K+LR  AEM+NLR RT RE +DA+ Y+  KFARD++  ++NL RAL 
Sbjct: 94  IQELEAALEEMREKWLRSEAEMQNLRTRTKRELEDARQYATQKFARDVVEAAENLKRALA 153

Query: 93  SAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFE 152
           S P      ++     +  + EGIE T R  M  LER+G+   D     F+ N HQAM E
Sbjct: 154 SLPHATEGEDRL----IARMREGIESTERSFMGILERHGISAADPAGTPFDANHHQAMAE 209

Query: 153 EPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQPSPLDIEER 212
           +  D  P  T+I+     + ++ R+L+PA+V +SKG          +  E  +  D    
Sbjct: 210 QHSDEHPHGTVIQAWTPAWTLHGRLLKPAMVVVSKGAAAGTQPAAAQATESGTYSDPTYG 269

Query: 213 NKTQ 216
           NK  
Sbjct: 270 NKAD 273


>gi|319943276|ref|ZP_08017559.1| chaperone GrpE [Lautropia mirabilis ATCC 51599]
 gi|319743818|gb|EFV96222.1| chaperone GrpE [Lautropia mirabilis ATCC 51599]
          Length = 374

 Score =  136 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 58/179 (32%), Positives = 97/179 (54%), Gaps = 11/179 (6%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
            +  ++ +   +  AE ++      E+  ++ E  + ++R  AE EN+RRR+  E   A+
Sbjct: 207 AEAGQDDAVVAALQAEIEALKAQLAEAEQKAGENHEHFVRASAETENVRRRSKEELDKAR 266

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
            ++I  FA  +L V D+L  AL                 + S+ EG++ T R++   LER
Sbjct: 267 KFAIEGFAESLLPVCDSLEMALTV-----------ETPSVDSIREGVQATLRQLQQALER 315

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
             V+ +D   Q+F+PN  QA+  +P+  V AN +  V+Q GY IN+RVLRPA+V +S+G
Sbjct: 316 NKVQVVDPLGQRFDPNTQQAISMQPNPEVAANHVAAVLQKGYLINDRVLRPAMVVVSQG 374


>gi|299133263|ref|ZP_07026458.1| GrpE protein [Afipia sp. 1NLS2]
 gi|298593400|gb|EFI53600.1| GrpE protein [Afipia sp. 1NLS2]
          Length = 199

 Score =  136 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 81/202 (40%), Positives = 126/202 (62%), Gaps = 15/202 (7%)

Query: 5   MSEKNIDKEKNPSNANSSTAE------------EKSEINIPEESLNQSEEFRDKYLRVIA 52
           M++ +  KE + +  N+ +              +  E    E  + ++ E +DK LR +A
Sbjct: 1   MTDNDGRKEFSEAAENAGSKPGEPRVSKPYIMPDDPEETPSEALVKEAAEAKDKMLRTLA 60

Query: 53  EMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSL 112
           EMENLR+RT RE  DA++Y IA FARD+L ++DNL RALD+ P +   +    ++ L +L
Sbjct: 61  EMENLRKRTQREVADARAYGIAGFARDILEIADNLQRALDAVPAEARATA---DAGLTAL 117

Query: 113 IEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYA 172
           IEG+E+T R +  +LE+ GVKK D   +KF+PN+HQAM+E P ++V   T+++V+Q GY 
Sbjct: 118 IEGVELTERSLHRSLEKNGVKKFDPMGEKFDPNVHQAMYEVPDNSVAPGTVVQVIQTGYM 177

Query: 173 INERVLRPALVSISKGKTQNPT 194
           I +R+LRPALV +SK + +   
Sbjct: 178 IGDRMLRPALVGVSKAEPKPAN 199


>gi|20151765|gb|AAM11242.1| RE56495p [Drosophila melanogaster]
          Length = 213

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 64/182 (35%), Positives = 106/182 (58%), Gaps = 4/182 (2%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
           S +   +E     A  S+ E +        +  Q+ E  DKY R +A+ EN+R R +++ 
Sbjct: 35  STEKQPEEATEQKATESSPEVEKLTKELAAAKEQNAELMDKYKRSLADSENMRNRLNKQI 94

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
            DA+ + I  F +D+L V+D L  A  + P D  +      + LK+L EG+ MTR  ++ 
Sbjct: 95  SDAKIFGIQSFCKDLLEVADTLGHATQAVPKDKLSG----NADLKNLYEGLTMTRASLLQ 150

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
             +R+G+K +D  +QKF+PN H+A+F++   TV  NT+++V + GY ++ER +RPALV +
Sbjct: 151 VFKRHGLKPLDPINQKFDPNQHEALFQKEDKTVEPNTVVEVTKLGYKLHERCIRPALVGV 210

Query: 186 SK 187
           SK
Sbjct: 211 SK 212


>gi|154246474|ref|YP_001417432.1| ribulose-phosphate 3-epimerase [Xanthobacter autotrophicus Py2]
 gi|154160559|gb|ABS67775.1| Ribulose-phosphate 3-epimerase [Xanthobacter autotrophicus Py2]
          Length = 217

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 71/175 (40%), Positives = 115/175 (65%), Gaps = 3/175 (1%)

Query: 31  NIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRA 90
              +    +    +DK+LR  AE EN+RRR ++E  DA++Y IA FARD+L+V+D+L+RA
Sbjct: 46  AEKQRLEAEIASLKDKFLRAFAEAENIRRRAEKEVVDAKTYGIASFARDVLNVADDLARA 105

Query: 91  LDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM 150
           L +   +   +    +  +K L+EG+E+T R ++  LE++G++KI+ K +KF+PN+HQAM
Sbjct: 106 LGTVDEEAKATA---DGAVKGLLEGLELTERGLVKALEKHGIRKIEPKGEKFDPNLHQAM 162

Query: 151 FEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQPS 205
           FE P  +VP+ T+++VVQ GY I ERVLRPA+V +++G  +      K+     +
Sbjct: 163 FEVPDPSVPSGTVVQVVQSGYVIGERVLRPAMVGVARGGPKAEATSGKDKEAGAA 217


>gi|146308640|ref|YP_001189105.1| GrpE protein [Pseudomonas mendocina ymp]
 gi|166215279|sp|A4XYF7|GRPE_PSEMY RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|145576841|gb|ABP86373.1| GrpE protein [Pseudomonas mendocina ymp]
          Length = 189

 Score =  135 bits (340), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 60/197 (30%), Positives = 106/197 (53%), Gaps = 8/197 (4%)

Query: 4   FMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDR 63
              E+N+D +   + A  + A         +    Q    +D+ LR+ AE++N+RRR ++
Sbjct: 1   MADEQNLDTQNPEAQAAENAAPSDDLAARVQALEEQLAAAQDQSLRMAAELQNVRRRAEQ 60

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           + + A  +++ KFA D+L V D+L R L+ +  D        +  +K + EG+++T +  
Sbjct: 61  DVEKAHKFALEKFANDLLPVVDSLERGLELSSPD--------DEAIKGVREGMQLTLKLF 112

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
           + TL R+ ++ ++   + FNP  HQAM  E    V  N+++KV Q GY +N R+LRPA+V
Sbjct: 113 IDTLARHQLEAVEPHGEPFNPEHHQAMAMEESTHVEPNSVLKVFQKGYLLNGRLLRPAMV 172

Query: 184 SISKGKTQNPTEEKKET 200
            +SK  T  P    ++ 
Sbjct: 173 VVSKAPTTPPPSIDEQA 189


>gi|15838932|ref|NP_299620.1| heat shock protein GrpE [Xylella fastidiosa 9a5c]
 gi|9107512|gb|AAF85140.1|AE004044_11 heat shock protein GrpE [Xylella fastidiosa 9a5c]
          Length = 200

 Score =  135 bits (340), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 49/184 (26%), Positives = 89/184 (48%), Gaps = 13/184 (7%)

Query: 4   FMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDR 63
           +M++ +   E +      ++ E        E    +    +   LR  AE+EN R+R  R
Sbjct: 28  YMNQDH--PECDSEELTQNSPETDPLKVEVETLRGEIASIKADVLRERAELENQRKRLIR 85

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           + + A+ ++  K   ++L V D+L   L ++  + +            L +G+E+T +++
Sbjct: 86  DVEQARKFANEKLLGELLPVFDSLDAGLTASGSEPSP-----------LRDGLELTYKQL 134

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
           +      G+  +D   Q FNP  HQA+ +     V    +I+V Q GY +NER+LRPALV
Sbjct: 135 LKVATDNGLMLLDPVGQLFNPEHHQAISQTEVTDVEPGYVIQVFQKGYLLNERLLRPALV 194

Query: 184 SISK 187
            ++K
Sbjct: 195 VVAK 198


>gi|49474880|ref|YP_032921.1| heat shock protein (hsp-70 cofactor) grpE [Bartonella henselae str.
           Houston-1]
 gi|52782867|sp|Q6G563|GRPE_BARHE RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|49237685|emb|CAF26872.1| Heat shock protein (hsp-70 cofactor) grpE [Bartonella henselae str.
           Houston-1]
          Length = 220

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 86/185 (46%), Positives = 124/185 (67%), Gaps = 4/185 (2%)

Query: 16  PSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAK 75
                      ++ ++      ++++E +D+ LR+ A+MENLRRRT R+  DA++YSIA 
Sbjct: 40  AEADADVKGGGEALVDPLAALQDENKELKDQLLRLAADMENLRRRTARDVADAKAYSIAN 99

Query: 76  FARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI 135
           FARDMLSVSDNL+RALD+ P         +++ LK+L EG+EMT R M++ LER+GV+KI
Sbjct: 100 FARDMLSVSDNLNRALDAIPEGAKE----NDAGLKTLAEGVEMTERAMIAALERHGVQKI 155

Query: 136 DAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTE 195
             + QKF+P+ HQAMFE P+  VP NT+ +VVQ GY I ERVLRPA+V ++KG  ++ + 
Sbjct: 156 HPEGQKFDPHFHQAMFEIPNSDVPDNTVQQVVQAGYIIGERVLRPAIVGVAKGGAKDISV 215

Query: 196 EKKET 200
           E    
Sbjct: 216 ESDSD 220


>gi|24653432|ref|NP_610886.2| Roe1 [Drosophila melanogaster]
 gi|52788262|sp|P48604|GRPE_DROME RecName: Full=GrpE protein homolog, mitochondrial; AltName:
           Full=dRoe1; Flags: Precursor
 gi|7303294|gb|AAF58354.1| Roe1 [Drosophila melanogaster]
 gi|211938555|gb|ACJ13174.1| FI04716p [Drosophila melanogaster]
          Length = 213

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 63/182 (34%), Positives = 106/182 (58%), Gaps = 4/182 (2%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
           S +   +E     A  S+ E +        +  Q+ E  DKY R +A+ EN+R R +++ 
Sbjct: 35  STEKQPEEATEQKATESSPEVEKLTKELAAAKEQNAELMDKYKRSLADSENMRNRLNKQI 94

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
            DA+ + I  F +D+L V+D L  A  + P D  +      + LK+L EG+ MTR  ++ 
Sbjct: 95  SDAKIFGIQSFCKDLLEVADTLGHATQAVPKDKLSG----NADLKNLYEGLTMTRASLLQ 150

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
             +R+G++ +D  +QKF+PN H+A+F++   TV  NT+++V + GY ++ER +RPALV +
Sbjct: 151 VFKRHGLEPLDPINQKFDPNQHEALFQKEDKTVEPNTVVEVTKLGYKLHERCIRPALVGV 210

Query: 186 SK 187
           SK
Sbjct: 211 SK 212


>gi|312116139|ref|YP_004013735.1| GrpE protein [Rhodomicrobium vannielii ATCC 17100]
 gi|311221268|gb|ADP72636.1| GrpE protein [Rhodomicrobium vannielii ATCC 17100]
          Length = 288

 Score =  135 bits (339), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 65/202 (32%), Positives = 116/202 (57%), Gaps = 4/202 (1%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +N D      N  ++  + K+   +  +S  ++ E RD++LR+ AEMEN RRR++REK +
Sbjct: 15  ENNDSLGRDQNPQATEEQVKALAKMLADSRAENAELRDRHLRIAAEMENYRRRSEREKIE 74

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
              Y+ ++F +D + ++DNL RA+++A  +  +        L +L++G+E+T RE++   
Sbjct: 75  TAKYASSEFGKDAIVIADNLRRAIEAAQKEATD----QTPALNTLLQGVEVTERELLKVF 130

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           ER+G+ + +   +KF+P+  +AM +     VPA+ +++V+Q GY I ERVLRPA V ++K
Sbjct: 131 ERHGITRFEPLGEKFDPHTSEAMIKVDVPNVPADVVVQVLQAGYKIGERVLRPAAVIVAK 190

Query: 188 GKTQNPTEEKKETIEQPSPLDI 209
           G      E  +         D 
Sbjct: 191 GGAPVKPEPPQGEHSAKPVSDA 212


>gi|254503184|ref|ZP_05115335.1| co-chaperone GrpE [Labrenzia alexandrii DFL-11]
 gi|222439255|gb|EEE45934.1| co-chaperone GrpE [Labrenzia alexandrii DFL-11]
          Length = 211

 Score =  135 bits (339), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 93/205 (45%), Positives = 137/205 (66%), Gaps = 11/205 (5%)

Query: 5   MSEKNIDKEKNPS--------NANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMEN 56
           MSE+N   +  P            ++ A E+S ++  E  + ++ E +D+ LR +AEMEN
Sbjct: 1   MSEENKSPDNQPDGLKPQAEAVNEAAAAAEESAVDAVEALMAENAELKDRALRTMAEMEN 60

Query: 57  LRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGI 116
           LRRRT++E KDA+ Y+++ FARDML+VSDNLSRAL++ P D     K +++ + SLIEG+
Sbjct: 61  LRRRTEKEVKDARQYAVSGFARDMLTVSDNLSRALEALPED---DRKNADAGVASLIEGV 117

Query: 117 EMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINER 176
           EM  R++++ LE+ GV K++ + QKF+PN HQAMFE P+  VP NT+++VVQ GY I ER
Sbjct: 118 EMIERDLLNQLEKNGVSKLEPEGQKFDPNFHQAMFEVPNTEVPNNTVVQVVQAGYVIGER 177

Query: 177 VLRPALVSISKGKTQNPTEEKKETI 201
           VLRPA+V +SKG  +   +    T 
Sbjct: 178 VLRPAMVGVSKGGPKEAPKADAGTE 202


>gi|240012492|gb|ACS43717.1| hypothetical protein; RMQ06983 [Methylobacterium extorquens AM1]
          Length = 215

 Score =  135 bits (339), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 59/178 (33%), Positives = 106/178 (59%), Gaps = 4/178 (2%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
            N +    ++    +E    +E  +++   +D+ LR +AE EN+RRR +R+  D + Y+I
Sbjct: 39  SNSAKIPETSPRSDAESVARDELRSENATLKDRLLRALAETENVRRRGERDLNDMRQYAI 98

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
            KFA D+L V+DNL RAL S P +           ++ L++GI +T +E++  L+++G+K
Sbjct: 99  GKFAEDLLPVADNLQRALASLPTEAQLDG----GAVRGLVDGIALTEKELLRVLQKHGIK 154

Query: 134 KIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQ 191
           ++    ++F+P++H+A+FE     VP   + +VV+ GY+I  R LRPA V +++G   
Sbjct: 155 RLSPLGERFDPHIHEALFEVSDPAVPDGVVTQVVEPGYSIGARPLRPAKVGVARGGKP 212


>gi|195058370|ref|XP_001995438.1| GH23157 [Drosophila grimshawi]
 gi|193899644|gb|EDV98510.1| GH23157 [Drosophila grimshawi]
          Length = 215

 Score =  134 bits (338), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 62/185 (33%), Positives = 105/185 (56%), Gaps = 4/185 (2%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
           T   ++     +     +  + E          +  Q+ E  DKY R +A+ EN+R R +
Sbjct: 34  TEKQQQQPTGNEAMEGKSPLSPEIDRLTQELSTAKEQNRELLDKYKRALADGENMRTRLN 93

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           ++  DA+ + I  F +D+L V+D L  A  + P D  N      + LK+L EG+ MTR  
Sbjct: 94  KQISDAKIFGIQSFCKDLLEVADTLGHATQAVPKDKLNG----NADLKNLFEGLCMTRAS 149

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           ++   +R+G++ +D  + KF+PNMH+A+F++   TV ANT+++V + GY ++ER +RPAL
Sbjct: 150 LLQAFKRHGLEPVDPINTKFDPNMHEALFQKEDTTVEANTVVEVTKLGYKLHERCIRPAL 209

Query: 183 VSISK 187
           V +SK
Sbjct: 210 VGVSK 214


>gi|254432593|ref|ZP_05046296.1| co-chaperone GrpE [Cyanobium sp. PCC 7001]
 gi|197627046|gb|EDY39605.1| co-chaperone GrpE [Cyanobium sp. PCC 7001]
          Length = 227

 Score =  134 bits (338), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 46/201 (22%), Positives = 80/201 (39%), Gaps = 8/201 (3%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +               A              Q E    +Y+R+ A+ +N R+R  R+ +D
Sbjct: 27  EGDSPSPADPQQQGYDARVAEMEQELATLRAQHEALNGQYMRLAADFDNFRKRQSRDSED 86

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
            +         ++L V DN  RA                   +SL    +   R+++   
Sbjct: 87  QRLQITCSTLGEILPVLDNFDRARQQL--------NPQHEEAQSLHRSYQGLYRQLVDVF 138

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           ++ GV  +  + + F+P +H+A+  EP D    + +I+ +Q GY +N RVLR ALV +S 
Sbjct: 139 KQLGVSPMRVEGEPFDPTLHEAVLREPSDVHAEDVVIEELQRGYHLNGRVLRHALVKVSM 198

Query: 188 GKTQNPTEEKKETIEQPSPLD 208
           G        +    + P P D
Sbjct: 199 GPGPTGAPSQPPAGQAPGPED 219


>gi|91974873|ref|YP_567532.1| GrpE protein [Rhodopseudomonas palustris BisB5]
 gi|123763125|sp|Q13E58|GRPE_RHOPS RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|91681329|gb|ABE37631.1| GrpE protein [Rhodopseudomonas palustris BisB5]
          Length = 206

 Score =  134 bits (337), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 84/190 (44%), Positives = 122/190 (64%), Gaps = 11/190 (5%)

Query: 5   MSEKNIDKEKNPSNANSSTA--------EEKSEINIPEESLNQSEEFRDKYLRVIAEMEN 56
           M++ N  K+ N   A  +           +  E    E  + ++ E RDK LR +AEMEN
Sbjct: 1   MTDSNGQKDNNQDQAQPADPVVSKPYIMPDDPEEGTNEALVREAAEARDKMLRTLAEMEN 60

Query: 57  LRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGI 116
           LRRRT +E  DA++Y ++ FARD+L ++DNL RALD+ P +   +    ++ LK LIEG+
Sbjct: 61  LRRRTAKEVADARTYGVSAFARDVLEIADNLQRALDAVPAEARANA---DAGLKGLIEGV 117

Query: 117 EMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINER 176
           E+T R +++ LE+ GVKK D + +KF+PN  QAM+E P  +VPA T+++VVQ G+ I ER
Sbjct: 118 ELTERSLINALEKNGVKKFDPQGEKFDPNFQQAMYEVPDPSVPAGTVVQVVQAGFMIGER 177

Query: 177 VLRPALVSIS 186
           VLRPALV +S
Sbjct: 178 VLRPALVGVS 187


>gi|147811306|emb|CAN76715.1| hypothetical protein VITISV_018795 [Vitis vinifera]
          Length = 413

 Score =  134 bits (337), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 55/192 (28%), Positives = 106/192 (55%), Gaps = 5/192 (2%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           +    +   + +        +  + +    + E+ +DK LR  AEMEN+  R  RE +++
Sbjct: 221 SDSDSEADLSMDDLMKLVVEKEELLKMKNKEIEKMQDKVLRSYAEMENVMERARREAENS 280

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPL-----DLANSEKKSESVLKSLIEGIEMTRREM 123
           + ++I  FA+ +L V+DNL RA           D +     +  +LK+L+EG+EMT +++
Sbjct: 281 KKFAIQNFAKSLLDVADNLGRASLVVKESFSKIDESKDTAGAVPLLKTLLEGVEMTEKQL 340

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
                ++G++K D  +++F+P+ H A F+ P  + P+ T+  V++ GY +++RV+RPA V
Sbjct: 341 GEVFRKFGMEKFDPTNEQFDPHRHNAAFQIPDPSKPSGTVAVVLKAGYMLHDRVIRPAEV 400

Query: 184 SISKGKTQNPTE 195
            +++    N TE
Sbjct: 401 GVTQAVDNNETE 412


>gi|27375787|ref|NP_767316.1| heat shock protein GrpE [Bradyrhizobium japonicum USDA 110]
 gi|52782895|sp|Q79V15|GRPE_BRAJA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|6433783|emb|CAB60665.1| GrpE protein [Bradyrhizobium japonicum]
 gi|27348925|dbj|BAC45941.1| heat shock protein [Bradyrhizobium japonicum USDA 110]
          Length = 201

 Score =  134 bits (337), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 80/181 (44%), Positives = 110/181 (60%), Gaps = 3/181 (1%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
             E        P  +      +  E    E    ++ E RD+ LR +AEMENLR+RT +E
Sbjct: 7   QPEDTTAPTGEPVVSKPYIMPDDPEPGSVELLQKEAAEARDRMLRTLAEMENLRKRTTKE 66

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
             DA+ Y I  FARD+L ++DNL RAL       A +   ++  L SLIEG+E+T R ++
Sbjct: 67  VADARLYGITGFARDVLDIADNLQRAL---DAVPAEARAAADPGLTSLIEGVELTERSLL 123

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
           + LE++GVKK D + QKF+PN  QAMFE P  +VPA T+++V+Q GY I ERVLRPALV 
Sbjct: 124 NALEKHGVKKFDPQGQKFDPNFQQAMFEVPDASVPAGTVVQVMQAGYTIGERVLRPALVG 183

Query: 185 I 185
           +
Sbjct: 184 V 184


>gi|158287473|ref|XP_309497.4| AGAP011150-PA [Anopheles gambiae str. PEST]
 gi|157019667|gb|EAA05028.4| AGAP011150-PA [Anopheles gambiae str. PEST]
          Length = 221

 Score =  134 bits (337), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 63/186 (33%), Positives = 111/186 (59%), Gaps = 4/186 (2%)

Query: 4   FMSEKNIDKEKNPSNANSSTAEEKSEI-NIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
           F +EK+  + + P+        E  E+     E   + +   DKY R +AE EN+RRR  
Sbjct: 39  FSTEKDTARVEEPTENEKKLTVEVEELRKEAAELTEKVKSLDDKYKRALAESENIRRRLT 98

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           ++  DA+ + I  F +D+L V+D L  A ++ P D  + +      LK+L EG+ MTR++
Sbjct: 99  KQIDDAKLFGIQGFCKDLLEVADILGHATEAVPKDEISDK---NPHLKNLFEGLSMTRQQ 155

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           + S  +R+G++ ++  ++KFNPN+H+A+F++    V  NT++ V + GY +++R +RPAL
Sbjct: 156 LNSVFKRHGLETVNPMNEKFNPNLHEALFQQEVANVEPNTVVVVSKIGYKLHDRCIRPAL 215

Query: 183 VSISKG 188
           V ++KG
Sbjct: 216 VGVTKG 221


>gi|325115374|emb|CBZ50929.1| grpe protein homolog, related [Neospora caninum Liverpool]
          Length = 361

 Score =  134 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 56/207 (27%), Positives = 102/207 (49%), Gaps = 14/207 (6%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   +E++   E    +A +   + +  +   E    ++ E +DK LR  A+MEN R R 
Sbjct: 154 EQDEAERSEGAEGADEDAPAVEEKYRQCLEEVENLKKKNRELQDKALRAFADMENARMRH 213

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSE--------------S 107
            +E    + Y+++ FA+ ML V+D ++ A +S    + +                     
Sbjct: 214 QKEMASLKEYAVSDFAKAMLDVADAMAYATNSLHEAVQSDSSLLAGQEANGAVDLVALKE 273

Query: 108 VLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVV 167
            L+ + +G+++T   +  T +R+GV++ D   +KFNP +H+A+FE  H       + +V+
Sbjct: 274 RLQQIYDGVKLTENLLHKTFDRFGVEQFDPAGEKFNPALHEALFELEHPNKAKGEVAQVI 333

Query: 168 QDGYAINERVLRPALVSISKGKTQNPT 194
           Q GY I +RVLR A V ++KG     +
Sbjct: 334 QKGYKIKDRVLRAAKVGVAKGAPNATS 360


>gi|195334115|ref|XP_002033730.1| GM21478 [Drosophila sechellia]
 gi|194125700|gb|EDW47743.1| GM21478 [Drosophila sechellia]
          Length = 213

 Score =  134 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 63/182 (34%), Positives = 107/182 (58%), Gaps = 4/182 (2%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
           S +   +E     A  S+ E +        +  Q+ E  DKY R +A+ EN+R R +++ 
Sbjct: 35  STEKQPEETAEQKATESSPEVEKLTKELAAAKEQNAELLDKYKRSLADSENMRNRLNKQI 94

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
            DA+ + I  F +D+L V+D L  A  + P D  +      + LK+L +G+ MTR  ++ 
Sbjct: 95  SDAKIFGIQSFCKDLLEVADTLGHATQAVPKDKLSG----NADLKNLYDGLTMTRASLLQ 150

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
             +R+G++ +D  +QKF+PN H+A+F++   TV ANT+++V + GY ++ER +RPALV +
Sbjct: 151 VFKRHGLEPLDPINQKFDPNQHEALFQKEDKTVEANTVVEVTKLGYKLHERCIRPALVGV 210

Query: 186 SK 187
           SK
Sbjct: 211 SK 212


>gi|195583100|ref|XP_002081362.1| GD10974 [Drosophila simulans]
 gi|194193371|gb|EDX06947.1| GD10974 [Drosophila simulans]
          Length = 213

 Score =  134 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 64/182 (35%), Positives = 107/182 (58%), Gaps = 4/182 (2%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
           S +   +E     A  S+ E +        +  Q+ E  DKY R +A+ EN+R R +++ 
Sbjct: 35  STEKQPEETAEQKATESSPEVEKLTKELAAAKEQNAELLDKYKRSLADSENMRNRLNKQI 94

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
            DA+ + I  F +D+L V+D L  A  + P D  +      + LK+L EG+ MTR  ++ 
Sbjct: 95  SDAKIFGIQSFCKDLLEVADTLGHATQAVPKDKLSG----NADLKNLYEGLTMTRASLLQ 150

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
             +R+G++ +D  +QKF+PN H+A+F++   TV ANT+++V + GY ++ER +RPALV +
Sbjct: 151 VFKRHGLEPLDPINQKFDPNQHEALFQKEDKTVEANTVVEVTKLGYKLHERCIRPALVGV 210

Query: 186 SK 187
           SK
Sbjct: 211 SK 212


>gi|992710|gb|AAA79044.1| droe1 [Drosophila melanogaster]
          Length = 213

 Score =  134 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 63/182 (34%), Positives = 106/182 (58%), Gaps = 4/182 (2%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
           S +   +E     A  S+ E +        +  Q+ E  DKY R +A+ EN+R R +++ 
Sbjct: 35  STEKQPEEATEQKATESSPELEKLTKELAAAKEQNAELMDKYKRSLADSENMRNRLNKQI 94

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
            DA+ + I  F +D+L V+D L  A  + P D  +      + LK+L EG+ MTR  ++ 
Sbjct: 95  SDAKIFGIQSFCKDLLEVADTLGHATQAVPKDKLSG----NTDLKNLYEGLTMTRASLLQ 150

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
             +R+G++ +D  +QKF+PN H+A+F++   TV  NT+++V + GY ++ER +RPALV +
Sbjct: 151 VFKRHGLESLDPINQKFDPNQHEALFQKEDKTVEPNTVVEVTKLGYKLHERCIRPALVGV 210

Query: 186 SK 187
           SK
Sbjct: 211 SK 212


>gi|304311947|ref|YP_003811545.1| HSP-70 cofactor [gamma proteobacterium HdN1]
 gi|301797680|emb|CBL45902.1| HSP-70 cofactor [gamma proteobacterium HdN1]
          Length = 180

 Score =  134 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 61/185 (32%), Positives = 104/185 (56%), Gaps = 12/185 (6%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQ---SEEFRDKYLRVIAEMENLRRRT 61
           MSE++ +        + +   E +   + EE       +   +D+ LRV AEM+NLRRR 
Sbjct: 1   MSEQDNESTVVSEQPDVAIQPEITLETVMEELEQTRSGAANLQDQLLRVSAEMQNLRRRA 60

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           DR+ ++A+ +++ KF+ D+L V DNL R L +A  D             ++ EG+E+T R
Sbjct: 61  DRDVENARKFALEKFSTDLLPVVDNLERGLQAAGTD---------EAHIAVREGVELTLR 111

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
            +M  L ++GV+ +D   Q F+P +H+AM   P      NT++ V+Q GY ++ R++RPA
Sbjct: 112 LLMDVLRKHGVEVVDPIGQAFDPALHEAMSMAPSPDHAPNTVMAVLQKGYTLSGRLVRPA 171

Query: 182 LVSIS 186
           +V ++
Sbjct: 172 MVIVA 176


>gi|90416141|ref|ZP_01224073.1| heat shock protein GrpE [marine gamma proteobacterium HTCC2207]
 gi|90331866|gb|EAS47080.1| heat shock protein GrpE [marine gamma proteobacterium HTCC2207]
          Length = 195

 Score =  134 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 62/181 (34%), Positives = 101/181 (55%), Gaps = 8/181 (4%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +        +        E+ +I+  E+   Q  E  D+ LRV AEM+N+RRR +R+ ++
Sbjct: 22  EAEQTGSVSNEEIEQELLEEEQISETEQLQQQVTEANDQVLRVQAEMQNVRRRVERDVEN 81

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A  Y++ KF+ D+L V DNL RAL S   D        +   K++ EGIE+T +  +  L
Sbjct: 82  AHKYALDKFSADLLPVVDNLERALSSISAD--------DEGQKAVAEGIELTLKSFVDVL 133

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            R+ ++ +D   Q F+ N+HQA+   P+  +  NT++ V Q GY +N R++RPA+V +SK
Sbjct: 134 ARFKIEPVDPAGQPFDANLHQAVSMVPNPDLEPNTVMDVFQKGYTLNGRLIRPAMVIVSK 193

Query: 188 G 188
            
Sbjct: 194 A 194


>gi|121602522|ref|YP_989582.1| co-chaperone GrpE [Bartonella bacilliformis KC583]
 gi|254799579|sp|A1UUC9|GRPE_BARBK RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|120614699|gb|ABM45300.1| co-chaperone GrpE [Bartonella bacilliformis KC583]
          Length = 222

 Score =  134 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 89/186 (47%), Positives = 120/186 (64%), Gaps = 4/186 (2%)

Query: 15  NPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIA 74
                     E+    ++     ++++E +D++LR+ A+MENLRRRT R+  DA+ YSIA
Sbjct: 41  KEEVCADVEEEKNESTDLLATLQDENKELKDQFLRLAADMENLRRRTIRDVADAKIYSIA 100

Query: 75  KFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKK 134
            FARDMLSVSDNL+RAL++ P D   S+      LK L EG+EMT R MM+ LE +GVKK
Sbjct: 101 NFARDMLSVSDNLNRALEAIPADARESDTN----LKMLAEGVEMTERAMMAALEHHGVKK 156

Query: 135 IDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPT 194
           I  + QKF+PN HQAMFE  +  VP NT+ +VVQ GY I ERVLRPA+V ++KG  +  +
Sbjct: 157 ICPEGQKFDPNFHQAMFEISNSDVPDNTVQQVVQAGYIIGERVLRPAMVGVAKGGPKENS 216

Query: 195 EEKKET 200
            E    
Sbjct: 217 TEADSA 222


>gi|49473734|ref|YP_031776.1| heat shock protein (hsp-70 cofactor) grpE [Bartonella quintana str.
           Toulouse]
 gi|52782866|sp|Q6G1E4|GRPE_BARQU RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|49239237|emb|CAF25557.1| Heat shock protein (hsp-70 cofactor) grpE [Bartonella quintana str.
           Toulouse]
          Length = 220

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 88/186 (47%), Positives = 124/186 (66%), Gaps = 4/186 (2%)

Query: 12  KEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
           K       +    E     +      ++++E +D+ LR++A+MENLRRRT R+  DA++Y
Sbjct: 36  KTHEAEIHSEVKEENNEVSDPLAALQDENKELKDQLLRLVADMENLRRRTARDVADAKAY 95

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
           SIA FARDMLSVSDNL+RAL++ P         +++ LK+L EG+EMT R M++ LER+G
Sbjct: 96  SIANFARDMLSVSDNLNRALEAIPEGAKE----NDAGLKTLAEGVEMTERAMIAALERHG 151

Query: 132 VKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQ 191
           V+KI  + QKF+P+ HQAMFE P+  VP NT+ +VVQ GY I ERVLRPA+V ++KG T+
Sbjct: 152 VQKIYPEGQKFDPHFHQAMFEIPNCDVPDNTVQQVVQAGYIIGERVLRPAIVGVAKGGTK 211

Query: 192 NPTEEK 197
               E 
Sbjct: 212 GVPVES 217


>gi|323137183|ref|ZP_08072262.1| GrpE protein [Methylocystis sp. ATCC 49242]
 gi|322397541|gb|EFY00064.1| GrpE protein [Methylocystis sp. ATCC 49242]
          Length = 198

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 73/185 (39%), Positives = 109/185 (58%), Gaps = 3/185 (1%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +          +  S   E       E    ++   +DK LR +A+ EN+RRR ++E  D
Sbjct: 17  EQAGASSLSQPSAESNINEPEPFTELENLYAENAGLKDKLLRALADAENVRRRAEKEVSD 76

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A+ Y  A FAR+MLS  DNL RA++S P D        + V  SL+EG+E+  R+ +S L
Sbjct: 77  AKLYGAANFAREMLSFVDNLRRAVESVPQDKRGGL---DPVAASLLEGVELMERDFLSRL 133

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            R+GVKKI+A+  +F+PN H+A+FE P ++ PA T+ +VV+ GY I ERVLRPA V +++
Sbjct: 134 GRFGVKKIEAQGARFDPNQHEALFEIPDESQPAGTVAQVVEQGYMIGERVLRPAKVGVTR 193

Query: 188 GKTQN 192
           G  + 
Sbjct: 194 GGPKA 198


>gi|163867358|ref|YP_001608552.1| heat shock protein GrpE [Bartonella tribocorum CIP 105476]
 gi|254799580|sp|A9ILE9|GRPE_BART1 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|161016999|emb|CAK00557.1| heat shock protein GrpE [Bartonella tribocorum CIP 105476]
          Length = 222

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 92/186 (49%), Positives = 128/186 (68%), Gaps = 4/186 (2%)

Query: 16  PSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAK 75
            + A     EE  E++      ++++E +++ LR+ A+MENLRRRT R+  DA++YSIA 
Sbjct: 39  KTEAREDVEEESKEVDPLASLQDENKELKNQLLRLAADMENLRRRTARDVADARAYSIAN 98

Query: 76  FARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI 135
           FARDMLSVSDNL+RAL++ P     S    ++ LKSL EG+EMT R MM+ LER+GV+KI
Sbjct: 99  FARDMLSVSDNLNRALEAIPEGARES----DAGLKSLAEGVEMTERAMMAALERHGVQKI 154

Query: 136 DAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTE 195
             + QKF+P+ HQAMFE P+  VP NT+ +VVQ GY I ERVLRPA+V ++KG T+  + 
Sbjct: 155 HPEGQKFDPHFHQAMFEIPNADVPDNTVQQVVQAGYIIGERVLRPAIVGVAKGGTKEASI 214

Query: 196 EKKETI 201
           E  +  
Sbjct: 215 ETDKAS 220


>gi|194757703|ref|XP_001961102.1| GF13703 [Drosophila ananassae]
 gi|190622400|gb|EDV37924.1| GF13703 [Drosophila ananassae]
          Length = 224

 Score =  133 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 62/186 (33%), Positives = 109/186 (58%), Gaps = 4/186 (2%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E    E      +  + A +++ E +        +  Q+ E  DKY R +A+ EN+R R 
Sbjct: 42  EKQPEEATGQTAEQKAPAGAASPEVEKLTKDLAAAKEQNAELLDKYKRALADSENMRNRL 101

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           +++  DA+ + I  F +D+L V+D L  A  + P +  +      + LK+L EG+ MTR 
Sbjct: 102 NKQISDAKIFGIQSFCKDLLEVADTLGHATQAVPKEKLSG----NADLKNLYEGLSMTRA 157

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
            ++   +R+G++ +D  +QKF+PN+H+A+F++   TV ANT+++V + GY ++ER +RPA
Sbjct: 158 SLLQVFKRHGLEPLDPINQKFDPNLHEALFQKEDKTVEANTVVEVTKLGYKLHERCIRPA 217

Query: 182 LVSISK 187
           LV +SK
Sbjct: 218 LVGVSK 223


>gi|82658254|ref|NP_001032461.1| grpE protein homolog 1, mitochondrial [Danio rerio]
 gi|81294299|gb|AAI08003.1| GrpE-like 1, mitochondrial [Danio rerio]
          Length = 217

 Score =  133 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 56/179 (31%), Positives = 96/179 (53%), Gaps = 3/179 (1%)

Query: 11  DKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQS 70
            +E++ +        EK+ +    +   Q ++  DKY R +A+ ENLR+R+ +   DA+ 
Sbjct: 42  TEEESGAQKQEPGTAEKAFLEEKTQLEEQLKDVTDKYKRALADTENLRQRSQKMIDDAKL 101

Query: 71  YSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERY 130
           Y I  F +D+L V+D L +A +S P    ++       LK+L +G+ MT  ++    +++
Sbjct: 102 YGIQGFCKDLLEVADILEKATESVPKTEISAA---NPHLKNLYDGLVMTEVQIQKVFQKH 158

Query: 131 GVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
           G+ K+    QKF+P  H+A+F  P +     TI  V + GY ++ R LRPALV + K  
Sbjct: 159 GLVKLSPDGQKFDPYEHEAVFHAPVEGKEPGTIALVTKVGYKLHGRTLRPALVGVVKAP 217


>gi|330950324|gb|EGH50584.1| heat shock protein GrpE [Pseudomonas syringae Cit 7]
          Length = 187

 Score =  133 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 56/174 (32%), Positives = 95/174 (54%), Gaps = 8/174 (4%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
                  +    Q    +D+ LRV A+++N+RRR +++ + A  +++ KFA D+L + D+
Sbjct: 22  DELTTRVQVLEEQLAAAQDQSLRVAADLQNVRRRAEQDVEKAHKFALEKFAGDLLPIIDS 81

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNM 146
           L R LD +  D        +  ++ + EGIE+T +    TL+RY ++ ID   Q F+ + 
Sbjct: 82  LERGLDLSSPD--------DESIRPMREGIELTLKMFQDTLKRYQLEAIDPHGQPFSADQ 133

Query: 147 HQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKET 200
           HQAM  +    V  NT++KV Q GY +N R+LRPA+V +SK  +       ++ 
Sbjct: 134 HQAMAMQESADVEPNTVLKVFQKGYQLNGRLLRPAMVVVSKAPSPATPSINEQA 187


>gi|321477283|gb|EFX88242.1| hypothetical protein DAPPUDRAFT_305539 [Daphnia pulex]
          Length = 217

 Score =  133 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 61/181 (33%), Positives = 105/181 (58%), Gaps = 4/181 (2%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           ++     +   N     AE +S     E    +  +  DKY R +A+ EN+R+R  ++ +
Sbjct: 41  DEKAAAPELSENEKKLVAEIESLNKDVENYKEKCSDLDDKYKRSLADTENMRKRLTKQIE 100

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
           DA+ + I  F +D+LSVSD L +A +  P D    + K+ + LK+L EG+ MT  E+   
Sbjct: 101 DAKLFGIQGFCKDLLSVSDILQKATECVPAD----QVKTNTHLKNLYEGLTMTEAELQKV 156

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
            +R+G+ ++    +KFNPN H+A+FE+P +     T+I V + GY ++ER++RPA+V ++
Sbjct: 157 FKRHGLAQVSPLGEKFNPNHHEALFEQPIEGKEPGTVIAVTKIGYKLHERIVRPAMVGVA 216

Query: 187 K 187
           K
Sbjct: 217 K 217


>gi|226499250|ref|NP_001140305.1| hypothetical protein LOC100272350 [Zea mays]
 gi|194698920|gb|ACF83544.1| unknown [Zea mays]
          Length = 303

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 58/186 (31%), Positives = 109/186 (58%), Gaps = 5/186 (2%)

Query: 28  SEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNL 87
            +  + +    + ++ +DK LR  AEMEN+  RT RE ++++ Y++  F++ +L V+DNL
Sbjct: 118 EKDELLKSKDGEIKDMKDKVLRSYAEMENIIARTKRESENSKKYAVQNFSKSLLDVADNL 177

Query: 88  SRALDSAPLDLANSEKKSESV-----LKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKF 142
           +RA        +  +   +S      LK+L+EG++MT +++    +++GV+K D  +++F
Sbjct: 178 ARASSVVKESFSKIDTSKDSAGAVPLLKTLLEGVDMTEKQLAEVFKKFGVEKFDPLNEEF 237

Query: 143 NPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIE 202
           +PN H A+F+ P  + P  T+  VV+ GY +++RVLRPA V ++  +      E+ E  E
Sbjct: 238 DPNRHCAVFQIPDPSKPPGTVASVVKVGYMLHDRVLRPAEVGVTATEGGAHATEEAEKPE 297

Query: 203 QPSPLD 208
           + +  D
Sbjct: 298 EKTARD 303


>gi|21230928|ref|NP_636845.1| GrpE protein [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66769071|ref|YP_243833.1| heat shock protein GrpE [Xanthomonas campestris pv. campestris str.
           8004]
 gi|188992195|ref|YP_001904205.1| heat shock protein GrpE [Xanthomonas campestris pv. campestris str.
           B100]
 gi|21112542|gb|AAM40769.1| GrpE protein [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66574403|gb|AAY49813.1| GrpE protein [Xanthomonas campestris pv. campestris str. 8004]
 gi|167733955|emb|CAP52161.1| heat shock protein GrpE [Xanthomonas campestris pv. campestris]
          Length = 197

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 47/186 (25%), Positives = 94/186 (50%), Gaps = 13/186 (6%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E  M++ +   E +  + + +  E        E   ++    +   LR  A++EN R+R 
Sbjct: 23  ELHMNQDH--PEFDSEDLSQNPPETDPLKAEIESLRSEIALVKADALRERADLENQRKRI 80

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
            R+ ++A+ ++  K   ++L V D+L   L +A  + +            L +G+++T +
Sbjct: 81  ARDVENARKFANEKLLGELLPVFDSLDAGLTAAGTEPSP-----------LRDGLDLTYK 129

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           +++      G+  +D   Q FNP+ HQA+ +   + +    +++V Q GY +NER+LRPA
Sbjct: 130 QLLKVAADNGLTLLDPVGQPFNPDQHQAISQGEAEGIAPGHVVQVFQKGYLLNERLLRPA 189

Query: 182 LVSISK 187
           LV ++K
Sbjct: 190 LVVVAK 195


>gi|330937930|gb|EGH41717.1| heat shock protein GrpE [Pseudomonas syringae pv. pisi str. 1704B]
          Length = 187

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 55/174 (31%), Positives = 94/174 (54%), Gaps = 8/174 (4%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
                  +    Q    +D+ LRV A+++N+RRR +++ + A  +++ KFA D+L + D+
Sbjct: 22  DELTTRVQVLEEQLAAAQDQSLRVAADLQNVRRRAEQDVEKAHKFALEKFAGDLLPIIDS 81

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNM 146
           L R LD +  D        +  ++ +  GIE+T +    TL+RY ++ ID   Q F+ + 
Sbjct: 82  LERGLDLSSPD--------DESIRPMRGGIELTLKMFQDTLKRYQLEAIDPHGQPFSADQ 133

Query: 147 HQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKET 200
           HQAM  +    V  NT++KV Q GY +N R+LRPA+V +SK  +       ++ 
Sbjct: 134 HQAMAMQESADVEPNTVLKVFQKGYQLNGRLLRPAMVVVSKAPSPATPSINEQA 187


>gi|115478362|ref|NP_001062776.1| Os09g0284400 [Oryza sativa Japonica Group]
 gi|50252542|dbj|BAD28716.1| putative chaperone GrpE type 2 [Oryza sativa Japonica Group]
 gi|50253109|dbj|BAD29356.1| putative chaperone GrpE type 2 [Oryza sativa Japonica Group]
 gi|113631009|dbj|BAF24690.1| Os09g0284400 [Oryza sativa Japonica Group]
 gi|125605029|gb|EAZ44065.1| hypothetical protein OsJ_28684 [Oryza sativa Japonica Group]
 gi|215766781|dbj|BAG99009.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 302

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 65/211 (30%), Positives = 115/211 (54%), Gaps = 6/211 (2%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   +  N   E    +          +  + +    +  + +DK LR  AEMEN+  RT
Sbjct: 92  ENSTNVSNEGTEDVDLSKEDLVQLVLEKDGLLKSKDEEINDMKDKVLRSYAEMENVIART 151

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPL-----DLANSEKKSESVLKSLIEGI 116
            RE ++++ Y++  F++ +L V+DNL+RA           D +     +  +LK+L+EG+
Sbjct: 152 KRESENSKKYAVQNFSKSLLDVADNLTRASSVVKESFSKIDTSKDSTGAVPLLKTLLEGV 211

Query: 117 EMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINER 176
           +MT +++    +++GV+K D  ++KF+P+ H A+F+ P  + P+ T+  VV+ GY +++R
Sbjct: 212 DMTDKQLGEVFKKFGVEKFDPLNEKFDPSRHCAIFQIPDPSKPSGTVASVVKVGYMLHDR 271

Query: 177 VLRPALVSISKGKTQNPTEEKKETIEQPSPL 207
           VLRPA V +++G     TEE  E  EQ S  
Sbjct: 272 VLRPAEVGVTEGGPTT-TEEAAENSEQKSSE 301


>gi|325914035|ref|ZP_08176391.1| molecular chaperone GrpE (heat shock protein) [Xanthomonas
           vesicatoria ATCC 35937]
 gi|325539804|gb|EGD11444.1| molecular chaperone GrpE (heat shock protein) [Xanthomonas
           vesicatoria ATCC 35937]
          Length = 172

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 46/180 (25%), Positives = 89/180 (49%), Gaps = 11/180 (6%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
                E +  + + +  E        E   ++    +   LR  A++EN R+R  R+ ++
Sbjct: 2   NQDHPEFDSEDLSQNPPETDPLKAEIESLRSEIALVKADALRERADLENQRKRIARDVEN 61

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A+ ++  K   ++L V D+L   L +A  + +            L +G++MT ++++   
Sbjct: 62  ARKFANEKLLGELLPVFDSLDAGLTAAGTEPSP-----------LRDGLDMTYKQLLKVA 110

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
              G+  +D   Q FNP+ HQA+ +   D +    +++V Q GY +N+R+LRPALV ++K
Sbjct: 111 ADNGLTLLDPVGQPFNPDQHQAISQGEADGIAPGHVVQVFQKGYLLNDRLLRPALVVVAK 170


>gi|115522379|ref|YP_779290.1| GrpE protein [Rhodopseudomonas palustris BisA53]
 gi|122297941|sp|Q07US4|GRPE_RHOP5 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|115516326|gb|ABJ04310.1| GrpE protein [Rhodopseudomonas palustris BisA53]
          Length = 207

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 83/190 (43%), Positives = 120/190 (63%), Gaps = 11/190 (5%)

Query: 5   MSEKNIDKEKNPSNANSSTA--------EEKSEINIPEESLNQSEEFRDKYLRVIAEMEN 56
           M++ N  K+    +A ++           +  E +  E    ++ E RDK LR +AEMEN
Sbjct: 1   MTDPNGPKDIPEQSAEAAEPVVSKPYIMPDDPEPDAVELLAKEAAEARDKMLRTLAEMEN 60

Query: 57  LRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGI 116
           LR+RT RE  DA+ Y +  FARD+L ++DNL RALD+ P +   +    E  LK+LI+G+
Sbjct: 61  LRKRTTREVADARIYGVTAFARDVLEIADNLQRALDAVPAEARANA---EPGLKALIDGV 117

Query: 117 EMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINER 176
           E+T R +++ LE+ GVKK D   QKF+PN  QAM+E P  +VPA T+++VVQ G+ + ER
Sbjct: 118 ELTERSLINALEKNGVKKFDPSGQKFDPNFQQAMYEVPDASVPAGTVVQVVQAGFMLGER 177

Query: 177 VLRPALVSIS 186
           VLRPALV +S
Sbjct: 178 VLRPALVGVS 187


>gi|319403539|emb|CBI77120.1| heat shock protein GrpE [Bartonella rochalimae ATCC BAA-1498]
          Length = 220

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 93/193 (48%), Positives = 133/193 (68%), Gaps = 5/193 (2%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
           S++ +   +  S+ N+   E +S  +      +++++ +D+ LR+ A+MENLRRRT R+ 
Sbjct: 31  SDEFLKIHEGESDPNAEVEEIQS-ADPLVILQDENKQLKDQILRLAADMENLRRRTARDV 89

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
            DA++YSIA FARDMLSVSD+L RAL + P D       + S LK+L+EG+EMT R MM+
Sbjct: 90  ADAKAYSIANFARDMLSVSDDLHRALAAIPKDAGE----NNSGLKTLVEGVEMTERAMMT 145

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
            LER+GVKKID + QKF+P+ HQAMFE P+  VP NT+ +VVQ GY I ERVLRPA+V +
Sbjct: 146 ALERHGVKKIDPEGQKFDPHFHQAMFEIPNADVPENTVQQVVQAGYIIGERVLRPAIVGV 205

Query: 186 SKGKTQNPTEEKK 198
           +KG  +  + E +
Sbjct: 206 TKGAVKEVSVESE 218


>gi|317122990|ref|YP_004102993.1| GrpE protein [Thermaerobacter marianensis DSM 12885]
 gi|315592970|gb|ADU52266.1| GrpE protein [Thermaerobacter marianensis DSM 12885]
          Length = 316

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 48/165 (29%), Positives = 81/165 (49%), Gaps = 11/165 (6%)

Query: 38  NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD 97
            Q+E + D+  R+ A+  N RRR   E+   +  + A+ AR +L V DNL RAL +    
Sbjct: 123 QQAEVYLDQLRRLQADFTNYRRRMMEEQSRWRQDAEAELARALLPVVDNLERALAAGG-- 180

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
                         +++G+ M  R+ +  L + GV+ +DA+ Q F+P+ H+A+       
Sbjct: 181 ---------DASHPVVQGVAMVHRQFLDVLRQAGVEPMDAEGQPFDPHRHEAVARVETAD 231

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIE 202
            P  T+I+V Q GY    R LRPA+V ++      P+   +   +
Sbjct: 232 HPDGTVIEVFQRGYLYRGRTLRPAMVKVAVAPAGAPSGPGEAGPD 276


>gi|194883305|ref|XP_001975743.1| GG20391 [Drosophila erecta]
 gi|190658930|gb|EDV56143.1| GG20391 [Drosophila erecta]
          Length = 215

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 63/185 (34%), Positives = 110/185 (59%), Gaps = 5/185 (2%)

Query: 4   FMSEKNIDKEKNPSNANSSTAEEKSEI-NIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
           F +EK  ++        + ++ E  ++      +  Q+ E  DKY R +A+ EN+R R +
Sbjct: 34  FSTEKQPEETATAEQKATESSPEVEKLTKELAAAKEQNAELLDKYKRSLADSENMRNRLN 93

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           ++  DA+ + I  F +D+L V+D L  A  + P D  +      + LK+L EG+ MTR  
Sbjct: 94  KQISDAKIFGIQSFCKDLLEVADTLGHATQAVPKDKLSG----NADLKNLYEGLSMTRAS 149

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           ++   +R+G++ +D  +QKF+PN H+A+F++   TV ANT+++V + GY ++ER +RPAL
Sbjct: 150 LLQVFKRHGLEPLDPINQKFDPNQHEALFQKEDKTVEANTVVEVTKLGYKLHERCIRPAL 209

Query: 183 VSISK 187
           V +SK
Sbjct: 210 VGVSK 214


>gi|125563069|gb|EAZ08449.1| hypothetical protein OsI_30714 [Oryza sativa Indica Group]
          Length = 302

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 65/211 (30%), Positives = 114/211 (54%), Gaps = 6/211 (2%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   +  N   E    +          +  + +    +  + +DK LR  AEMEN+  RT
Sbjct: 92  ENATNVSNEGTEDVDLSKEDLVQLVLEKDGLLKSKDEEINDMKDKVLRSYAEMENVIART 151

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPL-----DLANSEKKSESVLKSLIEGI 116
            RE ++++ Y++  F++ +L V+DNL+RA           D +     +  +LK+L+EG+
Sbjct: 152 KRESENSKKYAVQNFSKSLLDVADNLTRASSVVKESFSKIDTSKDSTGAVPLLKTLLEGV 211

Query: 117 EMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINER 176
           +MT +++    +++GV+K D  ++KF+P+ H A+F+ P    P+ T+  VV+ GY +++R
Sbjct: 212 DMTDKQLGEVFKKFGVEKFDPLNEKFDPSRHCAIFQIPDPLKPSGTVASVVKVGYMLHDR 271

Query: 177 VLRPALVSISKGKTQNPTEEKKETIEQPSPL 207
           VLRPA V +++G     TEE  E  EQ S  
Sbjct: 272 VLRPAEVGVTEGGPTT-TEEAAENSEQKSSE 301


>gi|62859157|ref|NP_001016179.1| GrpE-like 1, mitochondrial [Xenopus (Silurana) tropicalis]
 gi|60688505|gb|AAH91625.1| GrpE-like 1, mitochondrial (E. coli) [Xenopus (Silurana)
           tropicalis]
 gi|89268263|emb|CAJ83537.1| GrpE like 1 mitochondrial (E.coli) [Xenopus (Silurana) tropicalis]
          Length = 216

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 63/189 (33%), Positives = 100/189 (52%), Gaps = 3/189 (1%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           M T   E+N   +    + N +            +  +Q ++  DKY R +A+ ENLR+R
Sbjct: 31  MCTATKEQNNPTQDEDKSKNQTEESPDQAATEKAKLEDQIKDLTDKYKRALADTENLRQR 90

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           + +   +A+ Y I  F +D+L V+D L +A +S P     +E      LK+L EG+ MT 
Sbjct: 91  SKKLVDEAKLYGIQGFCKDLLEVADILEKATESVPKAEIKAE---NPHLKNLYEGLIMTE 147

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
            +M   L+++GV K++    KFNP  H+A+F  P +     T+  V + GY ++ER LRP
Sbjct: 148 VQMQKVLKKHGVVKLNPVGDKFNPYEHEALFHSPVEGKEPGTVALVTKVGYKLHERTLRP 207

Query: 181 ALVSISKGK 189
           ALV + KG 
Sbjct: 208 ALVGVVKGP 216


>gi|182677334|ref|YP_001831480.1| GrpE protein [Beijerinckia indica subsp. indica ATCC 9039]
 gi|254799581|sp|B2IDD9|GRPE_BEII9 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|182633217|gb|ACB93991.1| GrpE protein [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 201

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 75/173 (43%), Positives = 113/173 (65%), Gaps = 3/173 (1%)

Query: 20  NSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARD 79
             + A E     + E    ++   +DK LR  A+MENLRRR+++E  DA+ Y +  FARD
Sbjct: 32  AQAPAGEPDPFVVLENLQLENAGLKDKVLRTYADMENLRRRSEKEVADAKLYGVTSFARD 91

Query: 80  MLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKD 139
           ML+ +DNL RA++S P +   +    +  LK+ +EGIE+T R+ +S L +YGVKKI+   
Sbjct: 92  MLTFADNLHRAIESLPAEAKQA---VDGPLKTFVEGIELTERDFLSRLAKYGVKKIEPLG 148

Query: 140 QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQN 192
            KF+PN+H+A+FE P ++V + T+ +VV+DGY I ERVLRPA V +S+G  + 
Sbjct: 149 NKFDPNLHEALFEIPDESVVSGTVKQVVEDGYVIGERVLRPAKVGVSRGGPKA 201


>gi|92115785|ref|YP_575514.1| GrpE protein [Nitrobacter hamburgensis X14]
 gi|91798679|gb|ABE61054.1| GrpE protein [Nitrobacter hamburgensis X14]
          Length = 203

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 79/174 (45%), Positives = 111/174 (63%), Gaps = 3/174 (1%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           +   E  P  +      +  E    E    +  E +D+ LR +AEMENLR+RT RE  DA
Sbjct: 19  DPAPEAEPVVSKPYIMPDDPEEGSLEALAKEVAEAKDRMLRTLAEMENLRKRTAREVSDA 78

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
           ++Y I+ FARD+L ++DNL RALD+ P +   +    +  LK+LIEG+E+T R + + LE
Sbjct: 79  RTYGISGFARDVLDIADNLQRALDAVPTEARAAA---DPGLKALIEGVELTERSLHNALE 135

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           ++GVKK D   +KF+PN+HQAM+E P  +VP  TI +V+Q GY I ERVLRPAL
Sbjct: 136 KHGVKKFDPAGEKFDPNVHQAMYEIPDPSVPVGTIAQVIQAGYTIGERVLRPAL 189


>gi|70734321|ref|YP_257961.1| heat shock protein GrpE [Pseudomonas fluorescens Pf-5]
 gi|123748551|sp|Q4KIH2|GRPE_PSEF5 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|68348620|gb|AAY96226.1| co-chaperone GrpE [Pseudomonas fluorescens Pf-5]
          Length = 188

 Score =  131 bits (330), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 58/196 (29%), Positives = 101/196 (51%), Gaps = 8/196 (4%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           M+++     +N     +  A         +    Q    +D+ LRV A+++N+RRR +++
Sbjct: 1   MADEQTLDTQNLDANQAPEASGDDLAARVQVLEEQLAGAQDQALRVAADLQNVRRRAEQD 60

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
            + A  +++ KFA D+L V D+L R L+ +  D        +  ++ + EGIE+T +   
Sbjct: 61  VEKAHKFALEKFAGDLLPVIDSLERGLELSNPD--------DESIRPMREGIELTLKMFH 112

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
            TL+RY ++ ID   + FN   HQAM  +    V  N+++KV Q GY +N R+LRPA+V 
Sbjct: 113 DTLKRYQLEAIDPHGEPFNAEQHQAMAMQESADVEPNSVLKVFQKGYQLNGRLLRPAMVV 172

Query: 185 ISKGKTQNPTEEKKET 200
           +SK          ++ 
Sbjct: 173 VSKAPAPVSPSIDEKA 188


>gi|260831059|ref|XP_002610477.1| hypothetical protein BRAFLDRAFT_124277 [Branchiostoma floridae]
 gi|229295843|gb|EEN66487.1| hypothetical protein BRAFLDRAFT_124277 [Branchiostoma floridae]
          Length = 223

 Score =  131 bits (330), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 57/184 (30%), Positives = 105/184 (57%), Gaps = 4/184 (2%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
            +    K + P+   +++  +K       +   + +E++DKY+R +AE EN+R+R  ++ 
Sbjct: 44  EDVEAAKSETPAEGETTSPADKKLTEEKAKLDKELKEYKDKYVRALAETENVRQRMKQQL 103

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
            D++ Y+I  F +D+L V+D L +A ++ P +    E K+   LK+L EG++MT  +M  
Sbjct: 104 ADSKLYAIQGFCKDLLEVADVLQKATETVPAE----EMKNNPTLKTLFEGLKMTETQMQK 159

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
              R G++ ++   +KF+PN H+A+F  P +     T+  V + GY ++ RV+RPALV +
Sbjct: 160 VFSRNGLEMLNPVGEKFDPNFHEALFMAPMEGKEPGTVAVVSKVGYTLHSRVIRPALVGV 219

Query: 186 SKGK 189
            K  
Sbjct: 220 VKAP 223


>gi|21242272|ref|NP_641854.1| heat shock protein GrpE [Xanthomonas axonopodis pv. citri str. 306]
 gi|78047119|ref|YP_363294.1| heat shock protein GrpE [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|294625462|ref|ZP_06704092.1| heat shock protein GrpE [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|294666511|ref|ZP_06731753.1| heat shock protein GrpE [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|325928714|ref|ZP_08189884.1| molecular chaperone GrpE (heat shock protein) [Xanthomonas
           perforans 91-118]
 gi|52782957|sp|Q8PMB1|GRPE_XANAC RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|123771417|sp|Q3BVB9|GRPE_XANC5 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|21107699|gb|AAM36390.1| heat shock protein GrpE [Xanthomonas axonopodis pv. citri str. 306]
 gi|78035549|emb|CAJ23195.1| heat shock protein GrpE [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|292600229|gb|EFF44336.1| heat shock protein GrpE [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292603742|gb|EFF47151.1| heat shock protein GrpE [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|325540882|gb|EGD12454.1| molecular chaperone GrpE (heat shock protein) [Xanthomonas
           perforans 91-118]
          Length = 172

 Score =  131 bits (330), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 46/180 (25%), Positives = 89/180 (49%), Gaps = 11/180 (6%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
                E +  + + +  E        E   ++    +   LR  A++EN R+R  R+ ++
Sbjct: 2   NQDHPEFDSEDLSQNPPETDPLKAEIESLRSEIALVKADALRERADLENQRKRIARDVEN 61

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A+ ++  K   ++L V D+L   L +A  + +            L +G++MT ++++   
Sbjct: 62  ARKFANEKLLGELLPVFDSLDAGLTAAGTEPSP-----------LRDGLDMTYKQLLKVA 110

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
              G+  +D   Q FNP+ HQA+ +   + V    +++V Q GY +N+R+LRPALV ++K
Sbjct: 111 ADNGLTLLDPVGQPFNPDQHQAISQGEAEGVAPGHVVQVFQKGYLLNDRLLRPALVVVAK 170


>gi|66047423|ref|YP_237264.1| heat shock protein GrpE [Pseudomonas syringae pv. syringae B728a]
 gi|289676008|ref|ZP_06496898.1| heat shock protein GrpE [Pseudomonas syringae pv. syringae FF5]
 gi|81307931|sp|Q4ZNP6|GRPE_PSEU2 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|63258130|gb|AAY39226.1| GrpE protein [Pseudomonas syringae pv. syringae B728a]
 gi|330895321|gb|EGH27659.1| heat shock protein GrpE [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330969635|gb|EGH69701.1| heat shock protein GrpE [Pseudomonas syringae pv. aceris str.
           M302273PT]
 gi|330981073|gb|EGH79176.1| heat shock protein GrpE [Pseudomonas syringae pv. aptata str. DSM
           50252]
          Length = 187

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 56/174 (32%), Positives = 95/174 (54%), Gaps = 8/174 (4%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
                  +    Q    +D+ LRV A+++N+RRR +++ + A  +++ KFA D+L + D+
Sbjct: 22  DELTTRVQVLEEQLAAAQDQSLRVAADLQNVRRRAEQDVEKAHKFALEKFAGDLLPIIDS 81

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNM 146
           L R LD +  D        +  ++ + EGIE+T +    TL+RY ++ ID   Q F+ + 
Sbjct: 82  LERGLDLSSPD--------DESIRPMREGIELTLKMFQDTLKRYQLEAIDPHGQPFSADQ 133

Query: 147 HQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKET 200
           HQAM  +    V  NT++KV Q GY +N R+LRPA+V +SK  +       ++ 
Sbjct: 134 HQAMAMQESADVEPNTVLKVFQKGYQLNGRLLRPAMVVVSKAPSPATPSINEQA 187


>gi|254470696|ref|ZP_05084099.1| co-chaperone GrpE [Pseudovibrio sp. JE062]
 gi|211959838|gb|EEA95035.1| co-chaperone GrpE [Pseudovibrio sp. JE062]
          Length = 216

 Score =  131 bits (329), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 91/209 (43%), Positives = 136/209 (65%), Gaps = 6/209 (2%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E  M+ + +  E+  S   +  AE   E++  E    ++   +D+ LR +AEMENLRRRT
Sbjct: 13  EEQMNPEAV-VEEAASANGAEQAEAAVEVDPIEALQAENAALKDRALRTMAEMENLRRRT 71

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           ++E KDA++Y++A FARDML V+DNL RA+++ P D       ++  LK+L+EG+E+  R
Sbjct: 72  EKEVKDAKAYAVASFARDMLVVNDNLGRAIEALPDDARE----NDDNLKALVEGVELVER 127

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           EM++ LE++GVK++  + +KFNP+ HQAMFE P+  VP NT+++VVQ GY I ERVLRPA
Sbjct: 128 EMLNHLEKHGVKRLSPEGEKFNPHFHQAMFEVPNTEVPNNTVVQVVQAGYVIGERVLRPA 187

Query: 182 LVSISKGKTQNPTEEKKETIEQPSPLDIE 210
           +V +SKG          +  E  S +D E
Sbjct: 188 MVGVSKGGP-KVAPVADKAAEPGSTIDKE 215


>gi|146337339|ref|YP_001202387.1| heat shock protein GrpE [Bradyrhizobium sp. ORS278]
 gi|166215249|sp|A4YJR1|GRPE_BRASO RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|146190145|emb|CAL74137.1| Protein grpE (HSP-70 cofactor) [Bradyrhizobium sp. ORS278]
          Length = 206

 Score =  131 bits (329), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 86/198 (43%), Positives = 121/198 (61%), Gaps = 3/198 (1%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +N  +   P  +      +  E    E    ++ E RDK LR +AEMENLR+RT RE  D
Sbjct: 12  ENPAQASEPVVSKPYIMPDDPETGSAEAYAKEAAEARDKMLRTLAEMENLRKRTAREVAD 71

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A+ Y I  FARD+L ++DNL RALD+ P +   +    ++ LKSLIEG+E+T R +++TL
Sbjct: 72  ARMYGITGFARDVLDIADNLQRALDAVPAETRANA---DAGLKSLIEGVELTERSLLNTL 128

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           E+ GVKK D   QKF+PN  QAM+E P  +VP+ T+++VVQ G+ I ERVLRPALV +SK
Sbjct: 129 EKNGVKKFDPTGQKFDPNFQQAMYEVPDPSVPSGTVVQVVQAGFMIGERVLRPALVGVSK 188

Query: 188 GKTQNPTEEKKETIEQPS 205
           G  +       +     +
Sbjct: 189 GGAKAAPAASNDQSNSAA 206


>gi|195484937|ref|XP_002090884.1| GE12552 [Drosophila yakuba]
 gi|194176985|gb|EDW90596.1| GE12552 [Drosophila yakuba]
          Length = 215

 Score =  131 bits (329), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 60/182 (32%), Positives = 107/182 (58%), Gaps = 4/182 (2%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
            ++  +       A+ ++ E +        +  Q+ E  DKY R +A+ EN+R R +++ 
Sbjct: 37  EKQPEEAATTEQKASEASPEVEKLTKELAAAKEQNAELLDKYKRSLADSENMRNRLNKQI 96

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
            DA+ + I  F +D+L V+D L  A  + P +  +      + LK+L EG+ MTR  ++ 
Sbjct: 97  SDAKIFGIQSFCKDLLEVADTLGHATQAVPKEKLSG----NADLKNLYEGLSMTRASLLQ 152

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
             +R+G++ +D  +QKF+PN H+A+F++   TV ANT+++V + GY ++ER +RPALV +
Sbjct: 153 VFKRHGLEPLDPINQKFDPNQHEALFQKEDKTVEANTVVEVTKLGYKLHERCIRPALVGV 212

Query: 186 SK 187
           SK
Sbjct: 213 SK 214


>gi|149424842|ref|XP_001521091.1| PREDICTED: similar to GrpE protein homolog 1, mitochondrial
           precursor (Mt-GrpE#1) (HMGE), partial [Ornithorhynchus
           anatinus]
          Length = 285

 Score =  131 bits (329), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 57/185 (30%), Positives = 103/185 (55%), Gaps = 4/185 (2%)

Query: 4   FMSEKNIDKEKNP-SNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
             + +N++++ NP       ++ EK+ I    +   Q +E  +KY R +A+ ENLR+R+ 
Sbjct: 102 KNNGQNLEEDSNPGDQKPEPSSAEKTLIEEKVKLEEQLKETMEKYKRALADTENLRQRSQ 161

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           +   +A+ Y I  F +D+L V+D L +A +S P +    E      LK+L EG+ MT  +
Sbjct: 162 KMVDEAKLYGIQGFCKDLLEVADILEKATESVPQEEIKEE---NPHLKNLYEGLVMTEVQ 218

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           +    +++G+ K++    +F+P  H+A+F  P +     T+  V + GY ++ R LRPAL
Sbjct: 219 IQKVFKKHGLLKLNPVGARFDPYEHEALFHTPVEGKEPGTVALVTKVGYKLHGRTLRPAL 278

Query: 183 VSISK 187
           V ++K
Sbjct: 279 VGVAK 283


>gi|157106034|ref|XP_001649137.1| hypothetical protein AaeL_AAEL004438 [Aedes aegypti]
 gi|108879963|gb|EAT44188.1| conserved hypothetical protein [Aedes aegypti]
          Length = 226

 Score =  131 bits (329), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 60/184 (32%), Positives = 106/184 (57%), Gaps = 3/184 (1%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
             E     E+   N    T E +      +    + +E  DKY R +A+ EN+RRR  ++
Sbjct: 46  NEEATKKDEELSENEKKLTTEIEGLKKETDSLNEKVKELDDKYKRALADGENMRRRLTKQ 105

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
            +DA+ + I  F +D+L V+D L  A ++ P +  + +      LK+L EG+ MT+ ++ 
Sbjct: 106 IEDAKLFGIQGFCKDLLEVADILGHATEAVPKEEISDK---NPHLKNLYEGLTMTKAQLN 162

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
              +R+G++ ++  ++KFNPN+H+A+F++    V  NT++ V + GY ++ER +RPALV 
Sbjct: 163 QVFKRHGLETVNPLNEKFNPNLHEALFQQEVQNVEPNTVVVVSKIGYKLHERCIRPALVG 222

Query: 185 ISKG 188
           +SKG
Sbjct: 223 VSKG 226


>gi|330807467|ref|YP_004351929.1| Chaperone protein (heat shock protein) [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|327375575|gb|AEA66925.1| Chaperone protein (heat shock protein) [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
          Length = 188

 Score =  131 bits (329), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 55/196 (28%), Positives = 102/196 (52%), Gaps = 8/196 (4%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           M+++     +N     +S    +      +    Q    +D+ LRV A+++N+RRR +++
Sbjct: 1   MADEQTQDTQNLDANQASQDSGEDLAARVQVLEEQLAGAQDQALRVAADLQNVRRRAEQD 60

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
            + A  +++ +FA D+L + D+L R L+ +  D        +  ++ + EGIE+T +   
Sbjct: 61  VEKAHKFALERFAGDLLPIIDSLERGLELSNPD--------DENIRPMREGIELTLKMFQ 112

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
            TL+RY ++ +D   + FN   HQAM  +    V  N+++KV Q GY +N R+LRPA+V 
Sbjct: 113 DTLKRYQLETLDPHGEPFNAEHHQAMAMQESADVEPNSVLKVFQKGYLLNGRLLRPAMVV 172

Query: 185 ISKGKTQNPTEEKKET 200
           +SK          ++ 
Sbjct: 173 VSKTPAPVSPSIDEQA 188


>gi|195440246|ref|XP_002067953.1| GK11616 [Drosophila willistoni]
 gi|194164038|gb|EDW78939.1| GK11616 [Drosophila willistoni]
          Length = 223

 Score =  131 bits (328), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 61/186 (32%), Positives = 107/186 (57%), Gaps = 6/186 (3%)

Query: 4   FMSEKNIDKEKNPSNANSSTA--EEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           + +E N+++    +   + T+  E +  +    ++  Q  +  DKY R +AE EN+R R 
Sbjct: 42  YNTESNLEETATTTEKAAPTSSPEVERLMKELADAKEQHSDLLDKYRRSLAETENMRARL 101

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           +++  DA+ + I  F RD+L V+D L  A  + P D           LK+L EG+ MT+ 
Sbjct: 102 NKQIADAKMFGIQVFCRDLLDVADTLGHATQAVPKDKLAD----NLDLKNLFEGLSMTKA 157

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
            ++   +R+G++  +  ++KFNPN+H+A+FE     V ANTI+ V + GY +++R +RPA
Sbjct: 158 CLLQVFKRHGLEPFNPINEKFNPNLHEALFEIEDKNVDANTIVDVTKLGYILHKRCIRPA 217

Query: 182 LVSISK 187
           LV ++K
Sbjct: 218 LVGVAK 223


>gi|163797071|ref|ZP_02191026.1| GrpE protein [alpha proteobacterium BAL199]
 gi|159177587|gb|EDP62140.1| GrpE protein [alpha proteobacterium BAL199]
          Length = 205

 Score =  131 bits (328), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 70/194 (36%), Positives = 118/194 (60%), Gaps = 9/194 (4%)

Query: 2   ETFMSEKNIDKEK-----NPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMEN 56
           ET   + N +        +      +   E        E   QS ++RD+ LR +AE EN
Sbjct: 4   ETSKPDPNEEPSAFDVGIDDDGTIDTGEFEDPRDARIAELEAQSAQYRDQALRALAESEN 63

Query: 57  LRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGI 116
           +RRRT+R+K+  + Y+ A FA+D+L+  DNL RALD+AP D   +    +  +K+LI G+
Sbjct: 64  VRRRTERDKEQTRLYAAAGFAKDLLNAVDNLRRALDAAPKDQEAT----DEAVKNLIVGV 119

Query: 117 EMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINER 176
           E+T RE+++  E+ G+K+I+   ++F+PN+HQAMFE  +   PA T+++++  GY +++R
Sbjct: 120 ELTERELLNAFEKNGIKRIEPLGERFDPNLHQAMFEVENSGKPAGTVVQLLAPGYVLHDR 179

Query: 177 VLRPALVSISKGKT 190
           +LR A+V ++KG  
Sbjct: 180 LLRAAMVGVAKGGA 193


>gi|330888675|gb|EGH21336.1| heat shock protein GrpE [Pseudomonas syringae pv. mori str. 301020]
          Length = 187

 Score =  131 bits (328), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 55/174 (31%), Positives = 95/174 (54%), Gaps = 8/174 (4%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
                  +    Q    +D+ LRV A+++N+RRR +++ + A  +++ +FA D+L + D+
Sbjct: 22  DELTTRVQVLEEQLAAAQDQSLRVAADLQNVRRRAEQDVEKAHKFALERFAGDLLPIIDS 81

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNM 146
           L R LD +  D        +  ++ + EGIE+T +    TL+RY ++ ID   Q F+ + 
Sbjct: 82  LERGLDLSNPD--------DESIRPMREGIELTLKMFQDTLKRYQLEAIDPHGQPFSADQ 133

Query: 147 HQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKET 200
           HQAM  +    V  NT++KV Q GY +N R+LRPA+V +SK  +       ++ 
Sbjct: 134 HQAMAMQESADVEPNTVLKVFQKGYQLNGRLLRPAMVVVSKAPSPATPSINEQA 187


>gi|240849731|ref|YP_002971119.1| heat shock protein GrpE [Bartonella grahamii as4aup]
 gi|240266854|gb|ACS50442.1| heat shock protein GrpE [Bartonella grahamii as4aup]
          Length = 220

 Score =  131 bits (328), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 90/189 (47%), Positives = 124/189 (65%), Gaps = 4/189 (2%)

Query: 12  KEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
           K            E     ++     ++++E +D+ LR++A+MENLRRRT R+  DA++Y
Sbjct: 36  KTHKTEEHEDVEKESNEVSDLLASLQDENKELKDQLLRLVADMENLRRRTMRDVADAKAY 95

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
           SIA FARDMLSVSDNL+RAL++ P     S    ++ LKSL EG+EMT R MM+ LER+G
Sbjct: 96  SIANFARDMLSVSDNLNRALEAIPEGARES----DAGLKSLAEGVEMTERAMMAALERHG 151

Query: 132 VKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQ 191
           V+KI  + QKF+P+ HQAMFE P+  VP NT+ +VVQ GY I ERVLRPA+V ++KG  +
Sbjct: 152 VQKIHPEGQKFDPHFHQAMFEIPNADVPDNTVQQVVQAGYIIGERVLRPAIVGVAKGGAK 211

Query: 192 NPTEEKKET 200
             + E    
Sbjct: 212 EASVEADSA 220


>gi|302185416|ref|ZP_07262089.1| heat shock protein GrpE [Pseudomonas syringae pv. syringae 642]
          Length = 187

 Score =  131 bits (328), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 56/193 (29%), Positives = 99/193 (51%), Gaps = 8/193 (4%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
              + +    +  +            +    Q    +D+ LRV A+++N+RRR +++ + 
Sbjct: 3   DEQNLDAQAQDQAADAGAGDELTTRVQVLEEQLAAAQDQSLRVAADLQNVRRRAEQDVEK 62

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A  +++ KFA D+L + D+L R LD +  D        +  ++ + EGIE+T +    TL
Sbjct: 63  AHKFALEKFAGDLLPIIDSLERGLDLSSPD--------DESIRPMREGIELTLKMFQDTL 114

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +RY ++ ID   Q F+ + HQAM  +    V  NT++KV Q GY +N R+LRPA+V +SK
Sbjct: 115 KRYQLEAIDPHGQPFSADQHQAMAMQESADVEPNTVLKVFQKGYQLNGRLLRPAMVVVSK 174

Query: 188 GKTQNPTEEKKET 200
             +       ++ 
Sbjct: 175 APSPATPSINEQA 187


>gi|28871640|ref|NP_794259.1| heat shock protein GrpE [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|52782933|sp|Q87WN9|GRPE_PSESM RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|28854892|gb|AAO57954.1| heat shock protein GrpE [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|330963959|gb|EGH64219.1| heat shock protein GrpE [Pseudomonas syringae pv. actinidiae str.
           M302091]
          Length = 187

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 56/174 (32%), Positives = 95/174 (54%), Gaps = 8/174 (4%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
                  +    Q    +D+ LRV A+++N+RRR +++ + A  +++ KFA D+L + D+
Sbjct: 22  DELTTRVQVLEEQLAAAQDQSLRVAADLQNVRRRAEQDVEKAHKFALEKFAGDLLPIIDS 81

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNM 146
           L R LD +  D        +  ++ + EGIE+T +    TL+RY ++ ID   Q F+ + 
Sbjct: 82  LERGLDLSNPD--------DESIRPMREGIELTLKMFQDTLKRYQLEAIDPHGQPFSADQ 133

Query: 147 HQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKET 200
           HQAM  +    V  NT++KV Q GY +N R+LRPA+V +SK  +       ++ 
Sbjct: 134 HQAMAMQESADVEPNTVLKVFQKGYQLNGRLLRPAMVVVSKAPSPATPSINEQA 187


>gi|325920215|ref|ZP_08182170.1| molecular chaperone GrpE (heat shock protein) [Xanthomonas gardneri
           ATCC 19865]
 gi|325549301|gb|EGD20200.1| molecular chaperone GrpE (heat shock protein) [Xanthomonas gardneri
           ATCC 19865]
          Length = 172

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 45/180 (25%), Positives = 87/180 (48%), Gaps = 11/180 (6%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
                E +  + + +  E        E   ++    +   LR  A++EN R+R  R+  +
Sbjct: 2   NQDHSEFDSEDLSQNPPETDPLKAEIESLRSEIALVKADALRERADLENQRKRIARDVDN 61

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A+ ++  K   ++L V D+L   L +A    +            L +G++MT ++++   
Sbjct: 62  ARKFANEKLLGELLPVFDSLDAGLTAAGSQPSP-----------LRDGLDMTYKQLLKVA 110

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
              G+  +D   Q FNP+ HQA+ +   + +    +++V Q GY +N+R+LRPALV ++K
Sbjct: 111 ADNGLTLLDPVGQPFNPDQHQAISQGEAEDIAPGHVVQVFQKGYLLNDRLLRPALVVVAK 170


>gi|288959666|ref|YP_003450007.1| molecular chaperone [Azospirillum sp. B510]
 gi|288911974|dbj|BAI73463.1| molecular chaperone [Azospirillum sp. B510]
          Length = 205

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 62/173 (35%), Positives = 105/173 (60%), Gaps = 4/173 (2%)

Query: 17  SNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKF 76
           S  ++  A   S  +   +   +    +D+ LR +AE EN RRR  R+++DA  ++++ F
Sbjct: 26  SQTDAGQAGSGSPEDRVAKLEAEVASLKDQLLRAMAETENTRRRAQRDREDATKFAVSSF 85

Query: 77  ARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID 136
           A++++SV+DNL RALD+ P +        + +LK L  G+E T R++ +  +R G+KK+D
Sbjct: 86  AKELVSVADNLRRALDAVPAEGRE----RDEMLKGLAVGVEATERQLFAAFDRAGIKKLD 141

Query: 137 AKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
              + F+PN HQ MFE  +    A T+++V+Q GY I+ R+LR A+V ++KG 
Sbjct: 142 PAGEPFDPNFHQVMFEIENTGKAAGTVVQVLQPGYTIHGRLLREAMVGVAKGG 194


>gi|319404964|emb|CBI78566.1| heat shock protein GrpE [Bartonella sp. AR 15-3]
          Length = 219

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 94/183 (51%), Positives = 129/183 (70%), Gaps = 4/183 (2%)

Query: 16  PSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAK 75
             +  ++ AEE    +      ++++E RD+ LR+ A+MENLRRRT R+  DA++YSIA 
Sbjct: 39  EEDCPNAEAEEIKPTDPLVILQDENKELRDQILRLAADMENLRRRTARDIADAKTYSIAN 98

Query: 76  FARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI 135
           FARDMLSVSD+L RAL++ P D       ++  LK+LIEG+EMT R MM+ LER+GVKKI
Sbjct: 99  FARDMLSVSDDLQRALEAIPKDAGE----NDPGLKTLIEGVEMTERAMMTALERHGVKKI 154

Query: 136 DAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTE 195
           D + QKF+P+ HQAMFE P+  VP NT+ +VVQ GY I ERVLRPA+V ++KGK +  + 
Sbjct: 155 DPEGQKFDPHFHQAMFEIPNADVPENTVQQVVQAGYIIGERVLRPAIVGVTKGKVKEVSV 214

Query: 196 EKK 198
           E +
Sbjct: 215 ESE 217


>gi|237798547|ref|ZP_04587008.1| heat shock protein GrpE [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331021400|gb|EGI01457.1| heat shock protein GrpE [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 187

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 62/197 (31%), Positives = 105/197 (53%), Gaps = 10/197 (5%)

Query: 4   FMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDR 63
              E+N+D +     A +   EE       +    Q    +D+ LRV A+++N+RRR ++
Sbjct: 1   MADEQNLDAQAQDQAAEAGAGEE--LTTRVQVLEEQLAAAQDQSLRVAADLQNVRRRAEQ 58

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           + + A  +++ KFA D+L + D+L R LD +  D        +  ++ + EGIE+T +  
Sbjct: 59  DVEKAHKFALEKFAGDLLPIIDSLERGLDLSSPD--------DESIRPMREGIELTLKMF 110

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
             TL+RY ++ ID   Q F+ + HQAM  +    V  NT++KV Q GY +N R+LRPA+V
Sbjct: 111 QDTLKRYQLEAIDPHGQPFSADQHQAMAMQESTDVEPNTVLKVFQKGYQLNGRLLRPAMV 170

Query: 184 SISKGKTQNPTEEKKET 200
            +SK  +       ++ 
Sbjct: 171 VVSKAPSPATPSINEQA 187


>gi|26991411|ref|NP_746836.1| heat shock protein GrpE [Pseudomonas putida KT2440]
 gi|52782934|sp|Q88DU1|GRPE_PSEPK RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|24986482|gb|AAN70300.1|AE016671_1 heat shock protein GrpE [Pseudomonas putida KT2440]
 gi|313500637|gb|ADR62003.1| GrpE [Pseudomonas putida BIRD-1]
          Length = 185

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 56/196 (28%), Positives = 106/196 (54%), Gaps = 11/196 (5%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           M+++ ++++        +     + +   EE   Q    +D+ LR +A+++N+RRR +++
Sbjct: 1   MADEQLNEKDLNVEETGAGNAADTRVLELEE---QLAAAKDQALRAVADLQNVRRRAEQD 57

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
            + A  +++ KF+ D+L V D+L  AL  +  D        +  +K + EG+E+T +   
Sbjct: 58  VEKAHKFALEKFSSDLLPVIDSLELALAHSSAD--------DEHVKQIREGVELTLKMFQ 109

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
            TL+RY ++ +D   Q FNP  HQAM  + +  V  N+++ V Q GY +N R+LRPA+V 
Sbjct: 110 DTLKRYNLEAVDPHGQPFNPEHHQAMAMQENAEVEPNSVLNVFQKGYLLNGRLLRPAMVV 169

Query: 185 ISKGKTQNPTEEKKET 200
           +SK  +       ++ 
Sbjct: 170 VSKAPSAAQPSINEKA 185


>gi|195400711|ref|XP_002058959.1| GJ15316 [Drosophila virilis]
 gi|194141611|gb|EDW58028.1| GJ15316 [Drosophila virilis]
          Length = 238

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 57/171 (33%), Positives = 103/171 (60%), Gaps = 4/171 (2%)

Query: 17  SNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKF 76
           S       E +        +  +  E  DKY R +A+ EN+R+R +++  DA+ + I  F
Sbjct: 71  SADEEPKGEIEWLTQELAAARVEHNELLDKYKRALADGENMRKRLNKQIDDAKIFGIQGF 130

Query: 77  ARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID 136
            +D++ V+D L  A  + P D  N+     + L++L EG+ +TR  ++   +R+G++ +D
Sbjct: 131 CKDLIEVADVLGHATQAVPKDKLNA----NADLRNLYEGLNLTRASLLQVFKRHGLEALD 186

Query: 137 AKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
             +QKF+PN+H+A+F+   +TV ANT+++V + GY +++R +RPALV +SK
Sbjct: 187 PINQKFDPNLHEALFQTLDNTVEANTVVQVTKLGYKLHKRCIRPALVGVSK 237


>gi|242010313|ref|XP_002425913.1| grpe protein, putative [Pediculus humanus corporis]
 gi|212509889|gb|EEB13175.1| grpe protein, putative [Pediculus humanus corporis]
          Length = 239

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 62/183 (33%), Positives = 107/183 (58%), Gaps = 3/183 (1%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +  + EK         ++ ++     E + N++  F DKY R +AE ENLR R  ++ +D
Sbjct: 60  EGNEGEKLSEAEKKLKSDIENLNKELEAATNKAATFEDKYKRSLAEGENLRLRLTKQIED 119

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A+ + I  F +D+L VSD L RA +S P +    +      LK+L EG+ MT  ++ +  
Sbjct: 120 AKLFGIQSFCKDLLEVSDILQRATESVPKEEITDK---NPHLKNLFEGLTMTEAQLQNVF 176

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            R+G+  ++  ++KF+PN+H+A+F++  +   A TI+ V + GY ++ERV+RPALV I+K
Sbjct: 177 RRHGLVPVNPLNEKFDPNLHEALFQQEVEGKEAGTIVVVSKIGYKLHERVIRPALVGIAK 236

Query: 188 GKT 190
             +
Sbjct: 237 SPS 239


>gi|75674394|ref|YP_316815.1| GrpE protein [Nitrobacter winogradskyi Nb-255]
 gi|123732163|sp|Q3SW78|GRPE_NITWN RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|74419264|gb|ABA03463.1| GrpE protein [Nitrobacter winogradskyi Nb-255]
          Length = 197

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 78/174 (44%), Positives = 111/174 (63%), Gaps = 3/174 (1%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
               E  P  +      +  E +  +    Q  E +D+ LR +AEMENLR+RT RE  DA
Sbjct: 13  EPAAEVEPVVSKPYVMPDDPEDDALDALNKQLAEAKDRTLRTLAEMENLRKRTAREVSDA 72

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
           ++Y I+ FARD+L ++DNL RALD+ P D   +    +  LK+LIEG+E+T R + + LE
Sbjct: 73  RTYGISGFARDVLEIADNLQRALDAVPADARAAP---DPGLKALIEGVELTERSLHNALE 129

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           ++GVKK D   +KF+PN+HQAM+E P  ++P  T+ +V+Q GY I ERVLRPAL
Sbjct: 130 KHGVKKFDPAGEKFDPNVHQAMYEVPDPSIPVGTVAQVIQAGYMIGERVLRPAL 183


>gi|332188371|ref|ZP_08390096.1| grpE family protein [Sphingomonas sp. S17]
 gi|332011600|gb|EGI53680.1| grpE family protein [Sphingomonas sp. S17]
          Length = 181

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 72/187 (38%), Positives = 108/187 (57%), Gaps = 7/187 (3%)

Query: 5   MSEKNIDK-EKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDR 63
           MS+   ++ + +     +  A E +  +   E  NQ  E + +YL   AE++N+RRR ++
Sbjct: 1   MSDNKTNEPQTDLREETAEAAPEVAGQDRLSELENQLAEAKQQYLYAQAEIQNIRRRAEK 60

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           +  DA++Y+   FARD+LSV+DNL RAL + P DL           K L+ G++ T REM
Sbjct: 61  DASDARNYAATSFARDVLSVADNLQRALATIPADLRTD-----DKWKGLVTGLDATGREM 115

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
            S L R+G+ KI+A  Q  +PN HQAM E P       TI++ +Q GY I +R+LRPALV
Sbjct: 116 ESVLGRHGITKIEAMGQTLDPNKHQAMIELP-SDQEPGTIVQEMQSGYMIKDRLLRPALV 174

Query: 184 SISKGKT 190
            ++K   
Sbjct: 175 GVAKKPE 181


>gi|330958065|gb|EGH58325.1| heat shock protein GrpE [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 187

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 56/174 (32%), Positives = 96/174 (55%), Gaps = 8/174 (4%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
           +      +    Q    +D+ LRV A+++N+RRR +++ + A  +++ KFA D+L + D+
Sbjct: 22  EELTTRVQVLEEQLAAAQDQSLRVAADLQNVRRRAEQDVEKAHKFALEKFAGDLLPIIDS 81

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNM 146
           L R LD +  D        +  ++ + EGIE+T +    TL+RY ++ ID   Q F+ + 
Sbjct: 82  LERGLDLSNPD--------DESIRPMREGIELTLKMFQDTLKRYQLEAIDPHGQPFSADQ 133

Query: 147 HQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKET 200
           HQAM  +    V  NT++KV Q GY +N R+LRPA+V +SK  +       ++ 
Sbjct: 134 HQAMAMQESADVEPNTVLKVFQKGYQLNGRLLRPAMVVVSKAPSPATPSIDEQA 187


>gi|58581653|ref|YP_200669.1| heat shock protein GrpE [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84623569|ref|YP_450941.1| heat shock protein GrpE [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|166711485|ref|ZP_02242692.1| heat shock protein GrpE [Xanthomonas oryzae pv. oryzicola BLS256]
 gi|188577109|ref|YP_001914038.1| co-chaperone GrpE [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|75508222|sp|Q5H187|GRPE_XANOR RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|123766591|sp|Q2P460|GRPE_XANOM RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737237|sp|B2SQU5|GRPE_XANOP RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|58426247|gb|AAW75284.1| heat shock protein GrpE [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84367509|dbj|BAE68667.1| heat shock protein GrpE [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188521561|gb|ACD59506.1| co-chaperone GrpE [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 172

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 45/180 (25%), Positives = 87/180 (48%), Gaps = 11/180 (6%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
                E +  +   +  E        E   ++    +   LR  A++EN R+R  R+ ++
Sbjct: 2   NQDHPEFDSEDLAQNPPETDPLKAEIESLRSEIALVKADALRERADLENQRKRIARDVEN 61

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A+ ++  K   ++L V D+L   L +A    +            L +G++MT ++++   
Sbjct: 62  ARKFANEKLLGELLPVFDSLDAGLTAAGTQPSP-----------LRDGLDMTYKQLLKVA 110

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
              G+  +D   Q FNP+ HQA+ +   + +    +++V Q GY +N+R+LRPALV ++K
Sbjct: 111 ADNGLTLLDPVGQPFNPDQHQAISQGEAEGIAPGHVVQVFQKGYLLNDRLLRPALVVVAK 170


>gi|192361899|ref|YP_001983802.1| heat shock protein GrpE [Cellvibrio japonicus Ueda107]
 gi|190688064|gb|ACE85742.1| co-chaperone GrpE [Cellvibrio japonicus Ueda107]
          Length = 191

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 52/182 (28%), Positives = 89/182 (48%), Gaps = 8/182 (4%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           + +   +            +S            E  +D+ LR  AE +N+RRR +++ + 
Sbjct: 18  EAMQAAEGAEPQAQGEVTIESLQAQLATLAAAYEAAKDQSLRTQAEAQNIRRRAEQDVEK 77

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A  + + +   D+L V DNL RAL S           ++  LK+  EGI++T +  +  L
Sbjct: 78  AHKFGLERIVSDLLPVVDNLERALASIDA--------NDEALKAAAEGIQLTHKTFVDAL 129

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            R+ V  +D     F+PN+HQA+   P+  V  NT++   Q GY ++ R++RPA+V +SK
Sbjct: 130 ARHQVLVVDPVGAPFDPNLHQAVSAVPNPDVEPNTVLNCFQRGYTLHGRLVRPAMVVVSK 189

Query: 188 GK 189
             
Sbjct: 190 AP 191


>gi|328350782|emb|CCA37182.1| GrpE protein homolog, mitochondrial [Pichia pastoris CBS 7435]
          Length = 233

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 63/195 (32%), Positives = 99/195 (50%), Gaps = 11/195 (5%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEE-------FRDKYLRVIAEME 55
            F ++K+        +  S   +  SE++  E+   +  E        +D+YLR +A+  
Sbjct: 43  KFNAKKDEAPNAKEESTESPEKDASSELSEVEQLKAKLAEKDQEVTLLKDRYLRSVADFR 102

Query: 56  NLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEG 115
           NL+  T RE + A+ +++ KFARD+L   DN   AL +   +   +       +  L +G
Sbjct: 103 NLQETTKREIQKARDFALQKFARDLLESLDNFGHALSAVKDETLAA----NKEVSQLYDG 158

Query: 116 IEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINE 175
           +EMT+     TL R+G+ KID  D++F+PN H+A FE P       T+  V Q GY +N 
Sbjct: 159 VEMTKNIFEKTLVRHGINKIDPVDERFDPNRHEATFEVPQPDKEPGTVFHVQQPGYELNG 218

Query: 176 RVLRPALVSISKGKT 190
           RVLR A V + KG  
Sbjct: 219 RVLRAAKVGVVKGTE 233


>gi|148237623|ref|NP_001089487.1| GrpE-like 1, mitochondrial [Xenopus laevis]
 gi|66911547|gb|AAH97708.1| MGC115379 protein [Xenopus laevis]
          Length = 216

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 66/188 (35%), Positives = 98/188 (52%), Gaps = 3/188 (1%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           M T   E+N   E    + N +            +   Q ++  DKY R +A+ ENLR+R
Sbjct: 31  MCTATKEQNHLGENEDKSKNQAEESPDQAAAEKAKLEEQIKDLTDKYKRALADTENLRQR 90

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           + +   +A+ Y I  F +DML V+D L +A +S P +   +E      LKSL EG+ MT 
Sbjct: 91  SKKLVDEAKLYGIQGFCKDMLEVADILEKATESVPKEEIKAE---NPHLKSLYEGLIMTE 147

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
            +M    E++GV K++    KFNP  H+A+F  P       T+  V + GY ++ER LRP
Sbjct: 148 VQMQKVFEKHGVLKLNPVGAKFNPYEHEALFHSPVAGKEPGTVALVTKVGYKLHERTLRP 207

Query: 181 ALVSISKG 188
           ALV + KG
Sbjct: 208 ALVGVVKG 215


>gi|171689618|ref|XP_001909749.1| hypothetical protein [Podospora anserina S mat+]
 gi|170944771|emb|CAP70882.1| unnamed protein product [Podospora anserina S mat+]
          Length = 238

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 67/189 (35%), Positives = 103/189 (54%), Gaps = 2/189 (1%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
           +  +EK   + KN     +   EE       E    +  +++DKYLR +A+  NL+ RT 
Sbjct: 50  SAEAEKKEAETKNGEEKAAEETEEAKLKKQLEAKEAEVRDWKDKYLRSVADFRNLQDRTA 109

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSE--SVLKSLIEGIEMTR 120
           RE K A+ ++I KFA+D++   DN  RAL   P +   SE+KS     L +L EG++MT 
Sbjct: 110 REMKAARDFAIQKFAKDLVDSVDNFDRALTMVPEEKLKSEEKSAHLQDLVNLYEGLKMTE 169

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
             ++ TL+++G+++ D     FNPN H+A F  P      NT+    Q G+ +N R+LRP
Sbjct: 170 NILLETLKKHGLERFDPHGLPFNPNEHEATFMTPMQDKEHNTVFHTQQKGFKLNGRILRP 229

Query: 181 ALVSISKGK 189
           A V + K K
Sbjct: 230 AKVGVVKNK 238


>gi|327270566|ref|XP_003220060.1| PREDICTED: grpE protein homolog 1, mitochondrial-like [Anolis
           carolinensis]
          Length = 225

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 58/190 (30%), Positives = 100/190 (52%), Gaps = 6/190 (3%)

Query: 3   TFMSEKNIDKEKNPSNAN---SSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRR 59
              +  N+D++ N ++      S +  K  +    +   Q +E  DKY R +A+ ENLR+
Sbjct: 39  EKNTGPNVDEDTNQNHVERKPDSDSATKILMEEKTKLEEQLKEINDKYKRALADAENLRQ 98

Query: 60  RTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMT 119
           RT +  ++A+ Y I  F +D+L V+D L +A +S P +           LK+L EG+ MT
Sbjct: 99  RTQKLVEEAKLYGIQSFCKDLLEVADVLEKATESVPKEELKE---GNPHLKNLYEGLAMT 155

Query: 120 RREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
             ++    +++G+ K++    KF+P  H+A+F  P +     T+  V + GY ++ R LR
Sbjct: 156 EAQIQKVFKKHGLIKLNPLGAKFDPYEHEALFHVPMEDKEPGTVALVSKVGYKLHGRTLR 215

Query: 180 PALVSISKGK 189
           PALV + K  
Sbjct: 216 PALVGVVKDP 225


>gi|48525531|gb|AAT45013.1| GrpE2 [Saccharum hybrid cultivar SP80-3280]
          Length = 298

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 61/193 (31%), Positives = 115/193 (59%), Gaps = 6/193 (3%)

Query: 18  NANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFA 77
           + +      + +  + +   ++ ++ +DK LR  AEMEN+  RT RE ++++ Y++  F+
Sbjct: 105 SKDDLVKLVREKDELLKSKDDEIKDMKDKVLRSYAEMENIIARTKRESENSKKYAVQNFS 164

Query: 78  RDMLSVSDNLSRALDSAPLDLANSEKKSESV-----LKSLIEGIEMTRREMMSTLERYGV 132
           + +L V+DNL+RA        +  +   +S      LK+L+EG++MT +++    +++GV
Sbjct: 165 KSLLDVADNLARASSVVKESFSKIDASKDSAGAIPLLKTLLEGVDMTEKQLAEVFKKFGV 224

Query: 133 KKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQN 192
           +K D  ++KF+PN H A+F+ P  + P  T+  VV+ GY +++RVLRPA V +++G    
Sbjct: 225 EKFDPLNEKFDPNRHCAVFQIPDPSKPPGTVASVVKVGYMLHDRVLRPAEVGVTEGGADA 284

Query: 193 PTEEKKETIEQPS 205
            TEE ++  E+ S
Sbjct: 285 -TEEAEQPEEKTS 296


>gi|326502024|dbj|BAK06504.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 327

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 45/204 (22%), Positives = 89/204 (43%), Gaps = 8/204 (3%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E  M++      +  S   S   E+ S ++       +    RD+ LR+ A+ +N R+RT
Sbjct: 112 EALMNDDEAKIAEIESFLLSIEDEKISLMSKITALDAELTTERDRILRISADFDNYRKRT 171

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           +REK    +    +    +L V DN  RA     ++              + +  +   +
Sbjct: 172 EREKLSLMTNVQGEVVESLLPVLDNFERAKTQIKVETEREA--------KINDSYQGIYK 223

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           +++  L   GV+ +    + F+P +H+A+  E         +++  + G+ + ER+LRPA
Sbjct: 224 QLVEILNSLGVEDVKTVGKPFDPMLHEAIMREESVEYEDGVVLQEFRKGFKLGERLLRPA 283

Query: 182 LVSISKGKTQNPTEEKKETIEQPS 205
           +V +S G     + +   TI + S
Sbjct: 284 MVKVSAGPGPEKSGDDDTTIGEDS 307


>gi|71735196|ref|YP_276327.1| heat shock protein GrpE [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|123761176|sp|Q48E61|GRPE_PSE14 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|71555749|gb|AAZ34960.1| heat shock protein GrpE [Pseudomonas syringae pv. phaseolicola
           1448A]
          Length = 187

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 56/174 (32%), Positives = 96/174 (55%), Gaps = 8/174 (4%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
           +      +    Q    +D+ LRV A+++N+RRR +++ + A  +++ KFA D+L + D+
Sbjct: 22  EELTTRVQVLEEQLAAAQDQSLRVAADLQNVRRRAEQDVEKAHKFALEKFAGDLLPIIDS 81

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNM 146
           L R LD +  D        +  ++ + EGIE+T +    TL+RY ++ ID   Q F+ + 
Sbjct: 82  LERGLDLSNPD--------DESIRPMREGIELTLKMFQDTLKRYQLEAIDPYGQPFSADQ 133

Query: 147 HQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKET 200
           HQAM  +    V  NT++KV Q GY +N R+LRPA+V +SK  +       ++ 
Sbjct: 134 HQAMAMQESADVEPNTVLKVFQKGYQLNGRLLRPAMVVVSKAPSPATPSINEQA 187


>gi|71898351|ref|ZP_00680524.1| GrpE protein [Xylella fastidiosa Ann-1]
 gi|71731874|gb|EAO33932.1| GrpE protein [Xylella fastidiosa Ann-1]
          Length = 172

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 48/180 (26%), Positives = 84/180 (46%), Gaps = 11/180 (6%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
                E +      ++ E        E    +    +   LR  AE+EN R+R  R+ + 
Sbjct: 2   NQDHPECDSEELTQNSPETDPLKVEVETLRGEIASIKADVLRERAELENQRKRLIRDVEQ 61

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A+ ++  K   ++L V D+L   L ++  + +            L +G+E+T ++++   
Sbjct: 62  ARKFANEKLLGELLPVFDSLDAGLTASGSEPSP-----------LRDGLELTYKQLLKVA 110

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
              G+  +D   Q FNP  HQA+ +     V    +I+V Q GY +NER+LRPALV ++K
Sbjct: 111 IDNGLMLLDPVGQLFNPEHHQAISQMEVTDVEPGHVIQVFQKGYLLNERLLRPALVVVAK 170


>gi|195153945|ref|XP_002017884.1| GL17413 [Drosophila persimilis]
 gi|194113680|gb|EDW35723.1| GL17413 [Drosophila persimilis]
          Length = 227

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 63/169 (37%), Positives = 101/169 (59%), Gaps = 4/169 (2%)

Query: 19  ANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFAR 78
             + + E         +S  Q  E  DKY R +AE EN+R R +++  DA+ + I  F +
Sbjct: 62  PKAVSPEVDRLTKELADSKEQKSELMDKYKRALAESENMRTRLNKQISDAKIFGIQSFCK 121

Query: 79  DMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
           D+L V+D L  A  + P D         + LKSL EG+ MTR  ++   +R+G++ +D  
Sbjct: 122 DLLEVADTLGHATQAVPKDKLGD----NADLKSLYEGLTMTRASLLQVFKRHGLEAVDPL 177

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +QKF+PN+H+A+F++   TV ANT+++V + GY ++ER +RPALV +SK
Sbjct: 178 NQKFDPNLHEALFQKEDKTVEANTVVEVTKLGYKLHERCIRPALVGVSK 226


>gi|310794497|gb|EFQ29958.1| GrpE protein [Glomerella graminicola M1.001]
          Length = 235

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 64/185 (34%), Positives = 102/185 (55%), Gaps = 2/185 (1%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
           S+     E        +   E +     E    ++ +++DK LR +A+  NL+ RT RE 
Sbjct: 50  SDAKETTEAPKEGEKPADDAESALKKQLEAKEKEAADWKDKCLRTVADFRNLQDRTQREV 109

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSES--VLKSLIEGIEMTRREM 123
           K A+ +++ KFA+D++   DNL RAL   P D  N+ +K+     L +L EG++MT   +
Sbjct: 110 KQARDFALQKFAKDLIDSIDNLDRALSMVPKDKINAPEKTGDLQDLANLYEGLKMTDDIL 169

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
           MSTL+++G+++ D + +KFNPN H A F  P      NT+  V Q G+ +N RV+R A V
Sbjct: 170 MSTLKKHGIERFDPEGEKFNPNEHDATFMAPQPDKEDNTVFHVQQKGFKLNGRVMRAAKV 229

Query: 184 SISKG 188
            + K 
Sbjct: 230 GVVKN 234


>gi|326498237|dbj|BAJ98546.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 327

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 45/204 (22%), Positives = 89/204 (43%), Gaps = 8/204 (3%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E  M++      +  S   S   E+ S ++       +    RD+ LR+ A+ +N R+RT
Sbjct: 112 EALMNDDEAKIAEIESFLLSIEDEKISLMSKITALGAELTTERDRILRISADFDNYRKRT 171

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           +REK    +    +    +L V DN  RA     ++              + +  +   +
Sbjct: 172 EREKLSLMTNVQGEVVESLLPVLDNFERAKTQIKVETEREA--------KINDSYQGIYK 223

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           +++  L   GV+ +    + F+P +H+A+  E         +++  + G+ + ER+LRPA
Sbjct: 224 QLVEILNSLGVEDVKTVGKPFDPMLHEAIMREESVEYEDGVVLQEFRKGFKLGERLLRPA 283

Query: 182 LVSISKGKTQNPTEEKKETIEQPS 205
           +V +S G     + +   TI + S
Sbjct: 284 MVKVSAGPGPEKSGDDDTTIGEDS 307


>gi|170719890|ref|YP_001747578.1| heat shock protein GrpE [Pseudomonas putida W619]
 gi|254799608|sp|B1J253|GRPE_PSEPW RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|169757893|gb|ACA71209.1| GrpE protein [Pseudomonas putida W619]
          Length = 184

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 58/191 (30%), Positives = 101/191 (52%), Gaps = 8/191 (4%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
            D++ N  + N+  A         +E   Q    +D+ LR +A+++N+RRR +++ + A 
Sbjct: 2   ADEQLNEKDLNAEEAGAVDNGARVQELEEQLAAAKDQSLRAVADLQNVRRRAEQDVEKAH 61

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
            +++ KFA D+L V D+L  AL  +  +        +  +K + EG+E+T +    TL+R
Sbjct: 62  KFALEKFAGDLLPVIDSLELALAHSSAE--------DEQVKKIREGVELTLKMFQDTLKR 113

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
           Y ++ ID   Q FN   HQAM  +    V  N+++ V Q GY +N R+LRPA+V +SK  
Sbjct: 114 YNLEAIDPHGQPFNAEHHQAMAMQESAEVEPNSVLNVFQKGYLLNGRLLRPAMVVVSKAP 173

Query: 190 TQNPTEEKKET 200
           +       ++ 
Sbjct: 174 SAPQPSIDEKA 184


>gi|254523503|ref|ZP_05135558.1| co-chaperone GrpE [Stenotrophomonas sp. SKA14]
 gi|219721094|gb|EED39619.1| co-chaperone GrpE [Stenotrophomonas sp. SKA14]
          Length = 171

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 54/182 (29%), Positives = 93/182 (51%), Gaps = 13/182 (7%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           M+ ++ D E   S A+++ A   +  +  E    + E+ +   LR  A++EN R+R  R+
Sbjct: 1   MNHEHPDIESQQSAADAAAAAGVN--DEVERLRAEVEQIKADALRERADLENQRKRVARD 58

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
            + A+ ++  K   ++L V D+L   L +A  D              L EG+E+T ++++
Sbjct: 59  IEQARKFANEKLLGELLPVFDSLDAGLKAAGDDP-----------HPLREGLELTYKQLL 107

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
                 G+  +D   Q FNP  HQA+ + P       T++ V Q GY +NER+LRPALV 
Sbjct: 108 KVAADNGLVLLDPTGQPFNPEHHQAISQVPTPGAAPGTVVTVFQKGYLLNERLLRPALVV 167

Query: 185 IS 186
           ++
Sbjct: 168 VA 169


>gi|326529893|dbj|BAK08226.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 297

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 59/198 (29%), Positives = 112/198 (56%), Gaps = 5/198 (2%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
           S+++   E    +          +  +      + ++ +DK LR  AEMEN+  RT RE 
Sbjct: 97  SKEDSGTEDLDLSKEDLVKLVFEKDELLTLKDEEVKDMKDKVLRSYAEMENVIARTKRES 156

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPL-----DLANSEKKSESVLKSLIEGIEMTR 120
           ++++ Y++  F++ +L V+DNL+RA           D +     +  +LK+L+EG++MT 
Sbjct: 157 ENSKKYAVQNFSKSLLDVADNLARASSVVKESFSKLDTSEDSSGAVPLLKTLLEGVDMTD 216

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           +++    +++GV+K D  ++KF+P+ H A+F+ P  + P+ T+  VV+ GY +++RVLRP
Sbjct: 217 KQLGEVFKKFGVEKFDPMNEKFDPDKHFALFQIPDPSKPSGTVASVVKVGYMLHDRVLRP 276

Query: 181 ALVSISKGKTQNPTEEKK 198
           A V +++G      E+K 
Sbjct: 277 AEVGVTEGGPSEEPEDKS 294


>gi|195431968|ref|XP_002063999.1| GK15968 [Drosophila willistoni]
 gi|194160084|gb|EDW74985.1| GK15968 [Drosophila willistoni]
          Length = 209

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 64/182 (35%), Positives = 108/182 (59%), Gaps = 4/182 (2%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
           S +   +E   + A +S+ E +       E+  Q  E  DKY R +A+ EN+R R +++ 
Sbjct: 32  STEKQPEETATTAAPTSSPEIERLTKELAEAKEQHSELLDKYKRSLADSENMRTRLNKQI 91

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
            DA+ + I  F +D+L V+D L  A  + P +           LK+L EG+ MT+  ++ 
Sbjct: 92  ADAKIFGIQSFCKDLLEVADTLGHATQAVPKEKLAD----NPDLKNLFEGLSMTKASLLQ 147

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
             +R+G++ +D  +QKFNPN+H+A+F++   TV ANT+++V + GY ++ER +RPALV +
Sbjct: 148 VFKRHGLEPLDPINQKFNPNLHEALFQKEDKTVDANTVVEVTKLGYTLHERCIRPALVGV 207

Query: 186 SK 187
           SK
Sbjct: 208 SK 209


>gi|169853164|ref|XP_001833263.1| mitochondrial grpe [Coprinopsis cinerea okayama7#130]
 gi|116505641|gb|EAU88536.1| mitochondrial grpe [Coprinopsis cinerea okayama7#130]
          Length = 229

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 53/188 (28%), Positives = 91/188 (48%), Gaps = 9/188 (4%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
            +   E  P++   +  E+       +   ++  + + +   + A+  NL+R   +EK  
Sbjct: 38  DDKASESKPADKEPAKDEKALCEEKLQAKESEVADLKSRLQYLQADFINLQRNAAKEKDQ 97

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANS---------EKKSESVLKSLIEGIEM 118
            + Y+I KFA D+L   D L+ A+ S P    +           K   S LK L  G+EM
Sbjct: 98  QRDYAITKFAADLLETVDVLAIAIKSVPASALSGVAETPPPAGTKSHASHLKDLHTGVEM 157

Query: 119 TRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVL 178
           T R ++ T+ +Y VK  D   + F+PN+H+A+++ P       T+I   + GY I +RVL
Sbjct: 158 THRMLLQTMAKYHVKPFDPTGEPFDPNLHEALYQAPVPGKTPGTVIDTQKIGYMIKDRVL 217

Query: 179 RPALVSIS 186
           R A V ++
Sbjct: 218 RAAQVGVA 225


>gi|88704206|ref|ZP_01101920.1| GrpE protein [Congregibacter litoralis KT71]
 gi|88701257|gb|EAQ98362.1| GrpE protein [Congregibacter litoralis KT71]
          Length = 203

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 55/196 (28%), Positives = 101/196 (51%), Gaps = 13/196 (6%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTA-----EEKSEINIPEESLNQSEEFRDKYLRVIAEMEN 56
           E  M++    +     +A   +       E S  +  E+   +    RD+ LR  AE +N
Sbjct: 16  EESMTDDQGPETTETDDAADVSEGGGSDAELSLEDQLEKLQEEVGLARDQALRAQAEAQN 75

Query: 57  LRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGI 116
            +RR D++ + A+ +++ +F  ++L V DNL RALD+   D        +  L S+ EG+
Sbjct: 76  AQRRADQDVEKARKFALERFCSELLPVVDNLERALDAINGD--------DPALSSIAEGV 127

Query: 117 EMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINER 176
           ++T +  +  L ++ + ++D   + F+P +HQAM    +     NT++ V+Q GY +N R
Sbjct: 128 DLTLKSFVGALGKFQIVQLDPAGEPFDPQLHQAMSMIENPDAEPNTVLTVMQKGYTLNGR 187

Query: 177 VLRPALVSISKGKTQN 192
           ++RPA+V +SK     
Sbjct: 188 LVRPAMVMVSKAPAAE 203


>gi|289626204|ref|ZP_06459158.1| heat shock protein GrpE [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289646945|ref|ZP_06478288.1| heat shock protein GrpE [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|298488440|ref|ZP_07006471.1| Heat shock protein GrpE [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|298157065|gb|EFH98154.1| Heat shock protein GrpE [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|320322544|gb|EFW78637.1| heat shock protein GrpE [Pseudomonas syringae pv. glycinea str.
           B076]
 gi|320329987|gb|EFW85974.1| heat shock protein GrpE [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330868230|gb|EGH02939.1| heat shock protein GrpE [Pseudomonas syringae pv. aesculi str.
           0893_23]
 gi|330875241|gb|EGH09390.1| heat shock protein GrpE [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330877249|gb|EGH11398.1| heat shock protein GrpE [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
 gi|330987039|gb|EGH85142.1| heat shock protein GrpE [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 187

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 56/174 (32%), Positives = 96/174 (55%), Gaps = 8/174 (4%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
           +      +    Q    +D+ LRV A+++N+RRR +++ + A  +++ KFA D+L + D+
Sbjct: 22  EELTTRVQVLEEQLAAAQDQSLRVAADLQNVRRRAEQDVEKAHKFALEKFAGDLLPIIDS 81

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNM 146
           L R LD +  D        +  ++ + EGIE+T +    TL+RY ++ ID   Q F+ + 
Sbjct: 82  LERGLDLSNPD--------DESIRPMREGIELTLKMFQDTLKRYQLEAIDPHGQPFSADQ 133

Query: 147 HQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKET 200
           HQAM  +    V  NT++KV Q GY +N R+LRPA+V +SK  +       ++ 
Sbjct: 134 HQAMAMQESADVEPNTVLKVFQKGYQLNGRLLRPAMVVVSKAPSPATPSINEQA 187


>gi|225459431|ref|XP_002285824.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|302141888|emb|CBI19091.3| unnamed protein product [Vitis vinifera]
          Length = 298

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 33/194 (17%), Positives = 81/194 (41%), Gaps = 8/194 (4%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
                 +  +  ++  +E+            +    ++KY+R+ A+ +N R+R+++E+  
Sbjct: 100 DEKAVSEIEAMIDTIESEKAELAQKVSALSAEITSGKEKYIRLQADFDNFRKRSEKERLT 159

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
            ++ +  +    +L + DN  RA      +            K +    +   ++ +  +
Sbjct: 160 VRTDAQGEVVESLLPMIDNFERAKQQIKPETEKE--------KKIDTSYQGIYKQFVEIM 211

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
               V  +    + F+P +H+A+  E         II+ ++ G+ + +R+LRPA+V +S 
Sbjct: 212 RSCHVAAVATVGKPFDPALHEAIAREESQEFKEGIIIQEIRRGFLLGDRLLRPAMVKVST 271

Query: 188 GKTQNPTEEKKETI 201
           G  +  T    +  
Sbjct: 272 GPGRKKTSAVADKS 285


>gi|71276148|ref|ZP_00652428.1| GrpE protein [Xylella fastidiosa Dixon]
 gi|71900371|ref|ZP_00682505.1| GrpE protein [Xylella fastidiosa Ann-1]
 gi|182681981|ref|YP_001830141.1| heat shock protein GrpE [Xylella fastidiosa M23]
 gi|52782931|sp|Q87BS7|GRPE_XYLFT RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737238|sp|B2I6F7|GRPE_XYLF2 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|71163066|gb|EAO12788.1| GrpE protein [Xylella fastidiosa Dixon]
 gi|71729874|gb|EAO31971.1| GrpE protein [Xylella fastidiosa Ann-1]
 gi|182632091|gb|ACB92867.1| GrpE protein [Xylella fastidiosa M23]
 gi|307578246|gb|ADN62215.1| heat shock protein GrpE [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 172

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 48/180 (26%), Positives = 84/180 (46%), Gaps = 11/180 (6%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
                E +      ++ E        E    +    +   LR  AE+EN R+R  R+ + 
Sbjct: 2   NQDHPECDSEELTQNSPETDPLKVEVETLRGEIASIKADVLRERAELENQRKRLIRDVEQ 61

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A+ ++  K   ++L V D+L   L ++  + +            L +G+E+T ++++   
Sbjct: 62  ARKFANEKLLGELLPVFDSLDAGLTASGSEPSP-----------LRDGLELTYKQLLKVA 110

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
              G+  +D   Q FNP  HQA+ +     V    +I+V Q GY +NER+LRPALV ++K
Sbjct: 111 IDNGLMLLDPVGQLFNPEHHQAISQTEVTDVEPGHVIQVFQKGYLLNERLLRPALVVVAK 170


>gi|332374942|gb|AEE62612.1| unknown [Dendroctonus ponderosae]
          Length = 218

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 63/186 (33%), Positives = 107/186 (57%), Gaps = 6/186 (3%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           ET  SE +     N   +N    +   +I    E   ++ E  DKY R +A+ ENLR+R 
Sbjct: 39  ETKKSETDTSPSANDDKSNVEIEKLNKQI---VELTEKNSELLDKYKRSLADGENLRQRL 95

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
            ++  +A+ Y I  F +D+L V+D L +A ++ P D           LK L EG+ MT  
Sbjct: 96  TKQIGEAKIYGIQGFCKDLLDVADVLGKATETVPKDEIKDS---NPHLKGLYEGLIMTEA 152

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           ++ S  +R+G+++++  ++KF+PN H+A+F++  +   A T++ V + GY +++RVLRPA
Sbjct: 153 QLKSVFKRHGLEQVNPLNEKFDPNFHEALFQQEVEGKAAGTVVVVSKIGYKLHDRVLRPA 212

Query: 182 LVSISK 187
           LV +SK
Sbjct: 213 LVGVSK 218


>gi|325276145|ref|ZP_08141952.1| heat shock protein GrpE [Pseudomonas sp. TJI-51]
 gi|324098721|gb|EGB96760.1| heat shock protein GrpE [Pseudomonas sp. TJI-51]
          Length = 185

 Score =  129 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 56/196 (28%), Positives = 106/196 (54%), Gaps = 11/196 (5%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           M+++ ++++        + A   + +   EE   Q    +D+ LR +A+++N+RRR +++
Sbjct: 1   MADEQLNEKDLNVEETGAQATADARVLELEE---QLAAAKDQSLRAVADLQNVRRRAEQD 57

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
            + A  +++ KF+ D+L V D+L  AL  +  +        +  +K + EG+E+T +   
Sbjct: 58  VEKAHKFALEKFSSDLLPVIDSLELALAHSSAE--------DENVKQIREGVELTLKMFQ 109

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
            TL+RY ++ +D   Q FNP  HQAM  +    V  N+++ V Q GY +N R+LRPA+V 
Sbjct: 110 DTLKRYNLEAVDPHGQPFNPEHHQAMAMQESADVEPNSVLNVFQKGYLLNGRLLRPAMVV 169

Query: 185 ISKGKTQNPTEEKKET 200
           +SK  +       ++ 
Sbjct: 170 VSKAPSAAQPSINEKA 185


>gi|146417047|ref|XP_001484493.1| hypothetical protein PGUG_03874 [Meyerozyma guilliermondii ATCC
           6260]
 gi|146391618|gb|EDK39776.1| hypothetical protein PGUG_03874 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 236

 Score =  129 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 57/174 (32%), Positives = 95/174 (54%), Gaps = 4/174 (2%)

Query: 15  NPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIA 74
           N    +    + +       +   +  + ++ Y R +A+  NL+  T +E + A+ +++ 
Sbjct: 66  NAEPLSEEQQQIQELQGKLTQKDKELADMKNHYARAVADFRNLQESTKKEVQKARDFALQ 125

Query: 75  KFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKK 134
           KFA+D+L   DN S AL++   D   +     + +K+L EG++MTR     TL ++G++K
Sbjct: 126 KFAKDLLESLDNFSLALNAVKEDTLAA----NNEVKNLYEGVDMTRNVFEKTLAKHGIEK 181

Query: 135 IDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           ID   ++F+PNMH+A FE P       T+  V Q GY +N RVLRPA V + KG
Sbjct: 182 IDPMGEQFDPNMHEATFEIPQPDKEPGTVFHVQQPGYTLNARVLRPAKVGLVKG 235


>gi|190573962|ref|YP_001971807.1| heat shock protein GrpE [Stenotrophomonas maltophilia K279a]
 gi|226737208|sp|B2FMY4|GRPE_STRMK RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|190011884|emb|CAQ45505.1| putative heat shock protein [Stenotrophomonas maltophilia K279a]
          Length = 171

 Score =  129 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 53/182 (29%), Positives = 91/182 (50%), Gaps = 13/182 (7%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           M+ +  D E   S A+++     +  +  E    + E+ +   LR  A++EN R+R  R+
Sbjct: 1   MNHEQPDIESQQSAADAAATAGVN--DEVERLRAEIEQVKADALRERADLENQRKRVARD 58

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
            + A+ ++  K   D+L V D+L   L +A  D              L EG+E+T ++++
Sbjct: 59  IEQARKFANEKLLGDLLPVFDSLDAGLKAAGDDP-----------HPLREGLELTYKQLL 107

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
                 G+  +D   Q FNP  HQA+ + P       +++ V Q GY +NER+LRPALV 
Sbjct: 108 KVAADNGLVLLDPIGQPFNPEHHQAISQVPTPGAAPGSVVTVFQKGYLLNERLLRPALVV 167

Query: 185 IS 186
           ++
Sbjct: 168 VA 169


>gi|213966663|ref|ZP_03394814.1| heat shock protein GrpE [Pseudomonas syringae pv. tomato T1]
 gi|301383174|ref|ZP_07231592.1| heat shock protein GrpE [Pseudomonas syringae pv. tomato Max13]
 gi|302063391|ref|ZP_07254932.1| heat shock protein GrpE [Pseudomonas syringae pv. tomato K40]
 gi|302133764|ref|ZP_07259754.1| heat shock protein GrpE [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|213928513|gb|EEB62057.1| heat shock protein GrpE [Pseudomonas syringae pv. tomato T1]
 gi|331016632|gb|EGH96688.1| heat shock protein GrpE [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 187

 Score =  129 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 57/174 (32%), Positives = 97/174 (55%), Gaps = 8/174 (4%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
           +   N  +    Q    +D+ LRV A+++N+RRR +++ + A  +++ KFA D+L + D+
Sbjct: 22  EELTNRVQVLEEQLAAAQDQSLRVAADLQNVRRRAEQDVEKAHKFALEKFAGDLLPIIDS 81

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNM 146
           L R LD +  D        +  ++ + EGIE+T +    TL+RY ++ ID   Q F+ + 
Sbjct: 82  LERGLDLSNPD--------DESIRPMREGIELTLKMFQDTLKRYQLEAIDPHGQPFSADQ 133

Query: 147 HQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKET 200
           HQAM  +    V  NT++KV Q GY +N R+LRPA+V +SK  +       ++ 
Sbjct: 134 HQAMAMQESADVEPNTVLKVFQKGYQLNGRLLRPAMVVVSKAPSPATPSINEQA 187


>gi|194365377|ref|YP_002027987.1| heat shock protein GrpE [Stenotrophomonas maltophilia R551-3]
 gi|226737207|sp|B4SSQ5|GRPE_STRM5 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|194348181|gb|ACF51304.1| GrpE protein [Stenotrophomonas maltophilia R551-3]
          Length = 171

 Score =  129 bits (323), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 53/182 (29%), Positives = 93/182 (51%), Gaps = 13/182 (7%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           M+ ++ D E   S A+++ A   +  +  E    + ++ +   LR  A++EN R+R  R+
Sbjct: 1   MNHEHPDIESQQSAADAAAAAGVN--DEVERLRAELDQVKADVLRERADLENQRKRVARD 58

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
            + A+ ++  K   ++L V D+L   L +A  D              L EG+E+T R+++
Sbjct: 59  IEQARKFANEKLLGELLPVFDSLDAGLKAAGDDA-----------HPLREGLELTYRQLL 107

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
                 G+  +D   Q FNP  HQA+ + P       +++ V Q GY +NER+LRPALV 
Sbjct: 108 KVAGDNGLVLLDPTGQPFNPEHHQAISQVPTPGAAPGSVVTVFQKGYLLNERLLRPALVV 167

Query: 185 IS 186
           ++
Sbjct: 168 VA 169


>gi|221219864|gb|ACM08593.1| GrpE protein homolog 1, mitochondrial precursor [Salmo salar]
          Length = 216

 Score =  129 bits (323), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 57/184 (30%), Positives = 98/184 (53%), Gaps = 3/184 (1%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           ++   +          +A EK       +   Q +E  DKY R +A+ ENLR R+ +  +
Sbjct: 35  QQKSGQGSEEDQNAEQSAAEKVLAEEKGQLEEQLKEVTDKYKRALADTENLRTRSQKMVE 94

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
           D + Y I  F +D+L V+D L +A +S P +  +S+K     LK+L +G+ MT +++   
Sbjct: 95  DTKLYGIQGFCKDLLEVADILEKATESVPSEEVSSQK--NPHLKNLYDGLVMTDKQIQKV 152

Query: 127 LERYGVKKIDAKD-QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
             ++G+ K++    QKF+P  H+A+F  P +     T+  V + GY ++ R LRPALV +
Sbjct: 153 FTKHGLVKLNPDGGQKFDPYEHEALFHSPVEGKEPGTVAIVTKVGYKLHGRTLRPALVGV 212

Query: 186 SKGK 189
           +K  
Sbjct: 213 AKAP 216


>gi|319407925|emb|CBI81579.1| heat shock protein GrpE [Bartonella schoenbuchensis R1]
          Length = 224

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 87/194 (44%), Positives = 123/194 (63%), Gaps = 4/194 (2%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
             + K        +   +E    +   +  N+++E +++ LR  A+MENLRRRT R+  D
Sbjct: 32  DELLKMNKEEVCENVEEKESESTDPLVDLQNENKELKNQLLRFAADMENLRRRTTRDVAD 91

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A++Y+IA FARDMLSVSDNL+RAL++ P     ++      LK L EG+EMT R MM+ L
Sbjct: 92  ARAYAIANFARDMLSVSDNLNRALEAIPEGARENDTG----LKMLAEGVEMTERAMMTAL 147

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           ER+GVKKI  + QKF+P+ HQAMFE P+  VP NT+ +VVQ GY I ERVLRPA+V ++K
Sbjct: 148 ERHGVKKIHPEGQKFDPHFHQAMFEIPNTDVPDNTVQQVVQAGYIIGERVLRPAMVGVAK 207

Query: 188 GKTQNPTEEKKETI 201
           G  +  + +     
Sbjct: 208 GGLKEDSVKVDPAS 221


>gi|125809037|ref|XP_001360966.1| GA19397 [Drosophila pseudoobscura pseudoobscura]
 gi|54636139|gb|EAL25542.1| GA19397 [Drosophila pseudoobscura pseudoobscura]
          Length = 227

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 63/169 (37%), Positives = 102/169 (60%), Gaps = 4/169 (2%)

Query: 19  ANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFAR 78
             + + E         +S  Q  E  DKY R +AE EN+R R +++  DA+ + I  F +
Sbjct: 62  QKAVSPEVDRLTKELADSKEQKSELMDKYKRALAESENMRTRLNKQISDAKIFGIQSFCK 121

Query: 79  DMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
           D+L V+D L  A  + P D  +      + LKSL EG+ MTR  ++   +R+G++ +D  
Sbjct: 122 DLLEVADTLGHATQAVPKDKLSD----NADLKSLYEGLTMTRASLLQVFKRHGLEAVDPL 177

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +QKF+PN+H+A+F++   TV ANT+++V + GY ++ER +RPALV +SK
Sbjct: 178 NQKFDPNLHEALFQKEDKTVEANTVVEVTKLGYKLHERCIRPALVGVSK 226


>gi|209877437|ref|XP_002140160.1| GrpE family protein [Cryptosporidium muris RN66]
 gi|209555766|gb|EEA05811.1| GrpE family protein, putative [Cryptosporidium muris RN66]
          Length = 236

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 58/181 (32%), Positives = 102/181 (56%), Gaps = 4/181 (2%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           +K+ + +           +     N   E++ +++E +DK+LR +A++ENLR+R  ++ +
Sbjct: 58  DKSNNLDNTSDTMEYLKEKIIILENDITENVKKTKETQDKFLRTLADLENLRQRHQKDLE 117

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
           + + Y+I+ FA+ +L V DNLSRAL + P D   S    +  LKS+ +GI++T   ++  
Sbjct: 118 NTRIYAISNFAKSLLEVIDNLSRALSAFPSDKIQS----DKNLKSIYDGIDLTNSTLLKI 173

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
            E +G+ K +   + F+P  H+ +FE   D  P  TI   +  GY I++R+LRPA V   
Sbjct: 174 FENFGIYKFECIGEIFDPKKHEVLFETIDDNKPKGTISCELLPGYTIHDRILRPAKVVTV 233

Query: 187 K 187
           K
Sbjct: 234 K 234


>gi|182413487|ref|YP_001818553.1| GrpE protein [Opitutus terrae PB90-1]
 gi|177840701|gb|ACB74953.1| GrpE protein [Opitutus terrae PB90-1]
          Length = 198

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 59/197 (29%), Positives = 100/197 (50%), Gaps = 8/197 (4%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           + T  +  +  K   P    S+        +    +  ++ +  D+YLR +A++EN RRR
Sbjct: 10  LNTSENPASEGKGAAPLTPESAATPPTPAADALAAAKKEAADNYDRYLRAVADLENFRRR 69

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T REK D + ++ A+   D+L V DNLS AL +A            +   S+  G+EM  
Sbjct: 70  TTREKDDLRQFAAARVLEDLLPVMDNLSLALKAAK--------HPGADAASVASGVEMVL 121

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
            ++ + L  +G+K++D   Q F+ N H+A+  +P   VP   +  VV+ GY +N R+LRP
Sbjct: 122 TQLKTGLANHGLKEVDPAGQLFDANFHEAVSAQPSQDVPEGHVQTVVRTGYVLNGRLLRP 181

Query: 181 ALVSISKGKTQNPTEEK 197
           A V +S G  +   ++ 
Sbjct: 182 ATVVVSSGAPKQEGQKS 198


>gi|289663025|ref|ZP_06484606.1| heat shock protein GrpE [Xanthomonas campestris pv. vasculorum
           NCPPB702]
 gi|289670125|ref|ZP_06491200.1| heat shock protein GrpE [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 172

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 46/180 (25%), Positives = 89/180 (49%), Gaps = 11/180 (6%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
                E +  + + +  E        E   ++    +   LR  A++EN R+R  R+ ++
Sbjct: 2   NQDHPEFDSEDLSQNPPETDPLKAEIESLRSEIALVKADALRERADLENQRKRIARDVEN 61

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A+ ++  K   ++L V D+L   L +A  + +            L +G++MT ++++   
Sbjct: 62  ARKFANEKLLGELLPVFDSLDAGLTAAGTEPSP-----------LRDGLDMTYKQLLKVA 110

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
              G+  +D   Q FNP+ HQA+ +   + +    +++V Q GY +NER+LRPALV ++K
Sbjct: 111 ADNGLTLLDPVGQPFNPDQHQAISQGEAEGIAPGHVVQVFQKGYLLNERLLRPALVVVAK 170


>gi|52782956|sp|Q8PAL0|GRPE_XANCP RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|12484030|gb|AAG53935.1|AF302775_2 GrpE [Xanthomonas campestris pv. campestris]
          Length = 172

 Score =  128 bits (322), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 45/180 (25%), Positives = 89/180 (49%), Gaps = 11/180 (6%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
                E +  + + +  E        E   ++    +   LR  A++EN R+R  R+ ++
Sbjct: 2   NQDHPEFDSEDLSQNPPETDPLKAEIESLRSEIALVKADALRERADLENQRKRIARDVEN 61

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A+ ++  K   ++L V D+L   L +A  + +            L +G+++T ++++   
Sbjct: 62  ARKFANEKLLGELLPVFDSLDAGLTAAGTEPSP-----------LRDGLDLTYKQLLKVA 110

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
              G+  +D   Q FNP+ HQA+ +   + +    +++V Q GY +NER+LRPALV ++K
Sbjct: 111 ADNGLTLLDPVGQPFNPDQHQAISQGEAEGIAPGHVVQVFQKGYLLNERLLRPALVVVAK 170


>gi|291228671|ref|XP_002734301.1| PREDICTED: GrpE-like 1, mitochondrial-like [Saccoglossus
           kowalevskii]
          Length = 216

 Score =  128 bits (322), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 58/182 (31%), Positives = 98/182 (53%), Gaps = 4/182 (2%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           K    E   S  +  +  EK       +   Q +E  DKY R +AE EN+R +  ++ +D
Sbjct: 39  KENVSENKDSMKDEVSQAEKQLQEEKSKLQKQLDELTDKYKRALAETENVRNQNKKQLED 98

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
            + Y+I  F +D+L ++D L +A +S      +S        KSL EG++MT  +++   
Sbjct: 99  IRLYAIQGFCKDLLEIADILGQATESVQKSELDS----SPSFKSLFEGLKMTESQLLKVF 154

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            R+G+ KI+   +KFNPN+H+A+FE P       T+  V + GY +++R +RPA+V ++K
Sbjct: 155 SRHGLTKIEPLGEKFNPNLHEALFELPVPDKTPGTVAVVSKIGYKLHDRTVRPAIVGVAK 214

Query: 188 GK 189
             
Sbjct: 215 AP 216


>gi|251772541|gb|EES53107.1| putative GrpE protein [Leptospirillum ferrodiazotrophum]
          Length = 187

 Score =  128 bits (322), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 56/180 (31%), Positives = 101/180 (56%), Gaps = 6/180 (3%)

Query: 11  DKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQS 70
           D  +  +  +  + +  S    PEE   + + ++DKY+R++A+ +N R+RT R+ +D + 
Sbjct: 13  DDPEIITPGDDLSPDGASSEAAPEEKSPE-DVWKDKYVRLLADFDNHRKRTVRDLEDGRR 71

Query: 71  YSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERY 130
           Y+     RD L V DNL RAL  A               + L EG+ +T ++ +  LE+ 
Sbjct: 72  YANEALLRDFLPVLDNLERALAHAKDGSELGP-----ACQGLFEGLRLTAKQFLEMLEKN 126

Query: 131 GVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           GV +I ++ Q F+P++H+A+      T P  T+++V Q GY +  R++RPA+V++S+G +
Sbjct: 127 GVTRIPSEGQPFDPSVHEAVGYAESTTHPEGTVVEVYQQGYRLQNRLVRPAMVTVSRGSS 186


>gi|91093058|ref|XP_967697.1| PREDICTED: similar to GrpE-like 1, mitochondrial [Tribolium
           castaneum]
 gi|270002666|gb|EEZ99113.1| hypothetical protein TcasGA2_TC005006 [Tribolium castaneum]
          Length = 222

 Score =  128 bits (322), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 55/181 (30%), Positives = 103/181 (56%), Gaps = 3/181 (1%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           E+       P +      + +       E   ++ E  DKY R +A+ ENLR R  ++  
Sbjct: 45  EQVSQNSTPPPSEQPKVEDIEQLNKNIAELTEKNNELLDKYKRALADGENLRNRLTKQIS 104

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
           +A+ + I  F +D+L V+D L +A ++ P +  + +      LKSL EG+ MT  ++ S 
Sbjct: 105 EAKLFGIQGFCKDLLDVADVLGKATETVPKEEISDK---NPHLKSLYEGLVMTEAQLQSV 161

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
            +R+G++ ++  ++KFNPN H+A+F++  +   + T++ V + GY +++RV+RPALV ++
Sbjct: 162 FKRHGLECVNPLNEKFNPNYHEALFQQEVEGKESGTVVVVSKIGYKLHDRVIRPALVGVA 221

Query: 187 K 187
           K
Sbjct: 222 K 222


>gi|224067415|ref|XP_002192870.1| PREDICTED: hypothetical protein [Taeniopygia guttata]
          Length = 225

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 44/173 (25%), Positives = 89/173 (51%), Gaps = 1/173 (0%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
           ++PS        + +  +   +   Q  +  ++Y R +A+ EN+RRRT +  +DA+ + I
Sbjct: 49  EDPSEEPKHPLSDCALEHKAIKLEEQVRDLTERYRRALADSENVRRRTQKFVEDAKLFGI 108

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
             F RD++ V+D L +  +SA              LK + EG+ +   ++ S   ++G++
Sbjct: 109 QSFCRDLVEVADILEKTAESAAGQAQQPSDP-NPALKKIYEGLALIEAKLQSVFAKHGLQ 167

Query: 134 KIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           K++    +++P  H+ +   P + +   T+  V QDGY ++ R +R ALV ++
Sbjct: 168 KMNPVGGRYDPYDHEIICHVPAEGMQPGTVALVTQDGYKLHGRTIRHALVGVA 220


>gi|196231631|ref|ZP_03130489.1| GrpE protein [Chthoniobacter flavus Ellin428]
 gi|196224484|gb|EDY18996.1| GrpE protein [Chthoniobacter flavus Ellin428]
          Length = 175

 Score =  128 bits (321), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 53/182 (29%), Positives = 98/182 (53%), Gaps = 9/182 (4%)

Query: 11  DKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQS 70
           +   + + +  + A E++E ++  +     E FRD  LR  A+ +N R+R  REK DA  
Sbjct: 3   NDTTDAAESAEAKAAEQTEESLLTQLQGDIERFRDHALRTQADFDNFRKRAAREKDDAIK 62

Query: 71  YSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERY 130
           Y+ A F   ++ + DN    L++A    A+S          ++ G++M  +++   L   
Sbjct: 63  YANASFLDRLIPILDNFELGLNAARGSAADSP---------ILAGMDMVSKQLFDFLASC 113

Query: 131 GVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           GV+ ++A+ Q F+PN+H+A+ +E   TV    +I+ ++ GY + +R+LRP+ V +SKG  
Sbjct: 114 GVEAVNAEGQPFDPNLHEAVAQEESATVADGVVIRQLRKGYKLRDRLLRPSTVVVSKGAP 173

Query: 191 QN 192
             
Sbjct: 174 AK 175


>gi|159046005|ref|YP_001534799.1| protein GrpE [Dinoroseobacter shibae DFL 12]
 gi|157913765|gb|ABV95198.1| protein GrpE [Dinoroseobacter shibae DFL 12]
          Length = 197

 Score =  128 bits (321), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 59/161 (36%), Positives = 98/161 (60%), Gaps = 8/161 (4%)

Query: 31  NIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRA 90
              E  + + +E +D+ +R +AE EN+R+R +R++++A+ +  +K ARDML V DNL RA
Sbjct: 43  AAVEAIIAERDELKDRLIRALAEAENIRKRGERDRREAEQFGGSKLARDMLPVFDNLRRA 102

Query: 91  LDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQA 149
           LD    +          +   LIEG+E+T RE+++   ++G+  I  +    F+P +HQA
Sbjct: 103 LDVVDDNQR-------EIAGGLIEGVELTLREILNVFGKHGITPIAPEVGDPFDPQLHQA 155

Query: 150 MFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           MFE P   VPA  II+V+ +G+ +++R+LRPA V +S    
Sbjct: 156 MFEAPVPNVPAGGIIQVMSEGFLLHDRLLRPAHVGVSSTPA 196


>gi|256269600|gb|EEU04882.1| Mge1p [Saccharomyces cerevisiae JAY291]
 gi|259149711|emb|CAY86515.1| Mge1p [Saccharomyces cerevisiae EC1118]
 gi|323302954|gb|EGA56758.1| Mge1p [Saccharomyces cerevisiae FostersB]
 gi|323307290|gb|EGA60570.1| Mge1p [Saccharomyces cerevisiae FostersO]
 gi|323331553|gb|EGA72968.1| Mge1p [Saccharomyces cerevisiae AWRI796]
 gi|323346422|gb|EGA80710.1| Mge1p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 228

 Score =  128 bits (321), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 54/184 (29%), Positives = 98/184 (53%), Gaps = 4/184 (2%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           K+ + ++N  +     +E K   +       ++ E +D+ LR +A+  NL++ T ++ + 
Sbjct: 49  KSEESKENNEDLTEEQSEIKKLESQLSAKTKEASELKDRLLRSVADFRNLQQVTKKDIQK 108

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A+ +++ KFA+D+L   DN   AL++   +           +  L  G+ MTR    +TL
Sbjct: 109 AKDFALQKFAKDLLESVDNFGHALNAFKEEDLQK----SKEISDLYTGVRMTRDVFENTL 164

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            ++G++K+D   + F+PN H+A FE P       T+  V Q G+ +N+RV+RPA V I K
Sbjct: 165 RKHGIEKLDPLGEPFDPNKHEATFELPQPDKEPGTVFHVQQLGFTLNDRVIRPAKVGIVK 224

Query: 188 GKTQ 191
           G+  
Sbjct: 225 GEEN 228


>gi|148549796|ref|YP_001269898.1| heat shock protein GrpE [Pseudomonas putida F1]
 gi|166215280|sp|A5W9A4|GRPE_PSEP1 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|148513854|gb|ABQ80714.1| GrpE protein [Pseudomonas putida F1]
          Length = 185

 Score =  128 bits (321), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 55/196 (28%), Positives = 106/196 (54%), Gaps = 11/196 (5%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           M+++ ++++        +     + +   EE   Q    +D+ LR +A+++N+RRR +++
Sbjct: 1   MADEQLNEKDLNVEETGAGNAADTRVLELEE---QLAAAKDQALRAVADLQNVRRRAEQD 57

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
            + A  +++ KF+ D+L V D+L  AL  +  +        +  +K + EG+E+T +   
Sbjct: 58  VEKAHKFALEKFSSDLLPVIDSLELALAHSSAE--------DEHVKQIREGVELTLKMFQ 109

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
            TL+RY ++ +D   Q FNP  HQAM  + +  V  N+++ V Q GY +N R+LRPA+V 
Sbjct: 110 DTLKRYNLEAVDPHGQPFNPEHHQAMAMQENAEVEPNSVLNVFQKGYLLNGRLLRPAMVV 169

Query: 185 ISKGKTQNPTEEKKET 200
           +SK  +       ++ 
Sbjct: 170 VSKAPSAAQPSINEKA 185


>gi|52782987|sp|Q9PB04|GRPE_XYLFA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
          Length = 172

 Score =  128 bits (321), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 48/180 (26%), Positives = 84/180 (46%), Gaps = 11/180 (6%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
                E +      ++ E        E    +    +   LR  AE+EN R+R  R+ + 
Sbjct: 2   NQDHPECDSEELTQNSPETDPLKVEVETLRGEIASIKADVLRERAELENQRKRLIRDVEQ 61

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A+ ++  K   ++L V D+L   L ++  + +            L +G+E+T ++++   
Sbjct: 62  ARKFANEKLLGELLPVFDSLDAGLTASGSEPSP-----------LRDGLELTYKQLLKVA 110

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
              G+  +D   Q FNP  HQA+ +     V    +I+V Q GY +NER+LRPALV ++K
Sbjct: 111 TDNGLMLLDPVGQLFNPEHHQAISQTEVTDVEPGYVIQVFQKGYLLNERLLRPALVVVAK 170


>gi|255081368|ref|XP_002507906.1| predicted protein [Micromonas sp. RCC299]
 gi|226523182|gb|ACO69164.1| predicted protein [Micromonas sp. RCC299]
          Length = 335

 Score =  128 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 60/184 (32%), Positives = 99/184 (53%), Gaps = 4/184 (2%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
             +  +  ++ +    +  E +       E   Q ++  DK LR +A+MENLR RT R+ 
Sbjct: 149 ETEGAEDGEDVNEDEVADEEVQKLTAELSEKTAQVKDLNDKLLRTLADMENLRERTRRQA 208

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPL---DLANSEKKSESVLKSLIEGIEMTRRE 122
           + A+ ++I  F +D+L V+DNL+RA  +      +        ++VL SL EG+ M  ++
Sbjct: 209 ETAEKFAIQGFCKDLLDVADNLARASATVDPEALETETDAANIKNVLASLHEGVLMVEKQ 268

Query: 123 MMSTLERYGVKKIDA-KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           +MST  ++GV K D  +   FNPN H A+F  P     A T+  V + GY +++RV+RPA
Sbjct: 269 LMSTFGKHGVVKFDPAEGDPFNPNDHMALFNVPKGEKEAGTVAAVTKVGYKLHDRVIRPA 328

Query: 182 LVSI 185
            V +
Sbjct: 329 EVGV 332


>gi|73951739|ref|XP_545902.2| PREDICTED: similar to GrpE protein homolog 1, mitochondrial
           precursor (Mt-GrpE#1) (HMGE) [Canis familiaris]
          Length = 294

 Score =  128 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 51/178 (28%), Positives = 94/178 (52%), Gaps = 3/178 (1%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
            +          + + EK+ ++   +   Q +E  +KY R +A+ ENLR+R+ +  ++A+
Sbjct: 118 EEDVGQNEQKTDTPSTEKTLMDEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAK 177

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
            Y I  F +D+L V+D L +A  S P +    +      LK+L EG+ MT  ++     +
Sbjct: 178 LYGIQGFCKDLLEVADILEKATQSVPKEEVKDD---NPHLKNLYEGLVMTEVQIQKVFTK 234

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +G+ +++    +F+P  H+A+F  P +     T+  V + GY ++ R LRPALV + K
Sbjct: 235 HGLLRLNPVGARFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVK 292


>gi|85082684|ref|XP_956965.1| hypothetical protein NCU01516 [Neurospora crassa OR74A]
 gi|52782986|sp|Q9P5U4|GRPE_NEUCR RecName: Full=GrpE protein homolog, mitochondrial; Flags: Precursor
 gi|7801031|emb|CAB91427.1| probable heat shock protein MGE1 precursor [Neurospora crassa]
 gi|28918047|gb|EAA27729.1| conserved hypothetical protein [Neurospora crassa OR74A]
          Length = 238

 Score =  128 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 66/189 (34%), Positives = 106/189 (56%), Gaps = 2/189 (1%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
           +  +E     ++        T E  +     E    ++ E++DK LR +A+  NL+ RT 
Sbjct: 50  SAEAEGEKKADEGAEQKEGETDEVAALKKQLEAKDAEAREWKDKCLRTVADFRNLQERTA 109

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSE--SVLKSLIEGIEMTR 120
           R+ K A+ ++I KFA+D++   DN  RAL   P D   SE++SE    L +L EG++MT 
Sbjct: 110 RDVKQAKDFAIQKFAKDLVESVDNFERALSVVPQDKLKSEEQSEHLKDLVNLYEGLKMTE 169

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
             ++STL+++G+++I+ + + FNPN H+A F  P      N +  V Q G+ +N RVLRP
Sbjct: 170 SILLSTLKKHGLERIEPEGEVFNPNEHEATFMAPMPDKEHNVVFHVQQKGFKLNGRVLRP 229

Query: 181 ALVSISKGK 189
           A V + K K
Sbjct: 230 AQVGVVKNK 238


>gi|323335443|gb|EGA76729.1| Mge1p [Saccharomyces cerevisiae Vin13]
          Length = 228

 Score =  128 bits (320), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 54/184 (29%), Positives = 97/184 (52%), Gaps = 4/184 (2%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           K+ + ++N  +     +E K   +       ++ E +D+ LR +A+  NL++ T ++   
Sbjct: 49  KSEESKENNEDLTEEQSEIKKLESQLSAKTKEASELKDRLLRSVADFRNLQQVTKKDIXK 108

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A+ +++ KFA+D+L   DN   AL++   +           +  L  G+ MTR    +TL
Sbjct: 109 AKDFALQKFAKDLLESVDNFGHALNAFKEEDLQK----SKEISDLYTGVRMTRDVFENTL 164

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            ++G++K+D   + F+PN H+A FE P       T+  V Q G+ +N+RV+RPA V I K
Sbjct: 165 RKHGIEKLDPLGEPFDPNKHEATFELPQPDKEPGTVFHVQQLGFTLNDRVIRPAKVGIVK 224

Query: 188 GKTQ 191
           G+  
Sbjct: 225 GEEN 228


>gi|222081543|ref|YP_002540907.1| molecular chaperone heat shock protein (hsp-70) [Agrobacterium
           radiobacter K84]
 gi|221726222|gb|ACM29311.1| molecular chaperone heat shock protein (hsp-70) [Agrobacterium
           radiobacter K84]
          Length = 240

 Score =  128 bits (320), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 69/164 (42%), Positives = 108/164 (65%), Gaps = 4/164 (2%)

Query: 31  NIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRA 90
               +   ++ + +D+ LR +AE+EN+RRR DR+  D + Y++AKFA DML V+DN+ RA
Sbjct: 71  EAFAKLEAENADLKDRLLRALAEVENVRRRADRDLNDTRQYAVAKFAGDMLRVADNMERA 130

Query: 91  LDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM 150
           + S P +    E       K+LIEGIE+T +EM+ +LE++GVKK++   ++F+PN H+A+
Sbjct: 131 IASIPAEALKDE----GAFKTLIEGIELTEKEMLRSLEKHGVKKLNPMGERFDPNFHEAL 186

Query: 151 FEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPT 194
           FE P  +VP  T+ +VV+ GY +  R LRPA V I++G  Q+  
Sbjct: 187 FELPDPSVPNGTVTQVVEPGYVLGSRPLRPAKVGIARGGVQSQP 230


>gi|195124878|ref|XP_002006910.1| GI18336 [Drosophila mojavensis]
 gi|193911978|gb|EDW10845.1| GI18336 [Drosophila mojavensis]
          Length = 216

 Score =  128 bits (320), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 66/186 (35%), Positives = 104/186 (55%), Gaps = 4/186 (2%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E        D           + E +        +  Q+ E  DKY R +A+ EN+R R 
Sbjct: 35  EKKEQAVAEDATAADQKKVPESLEIERLTQELAAAKEQNNELLDKYKRALADSENMRTRL 94

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           +++  DA+ + I  F +D+L V+D L  A  + P +  N      S LK+L EG+ MTR 
Sbjct: 95  NKQISDAKIFGIQSFCKDLLEVADTLGHATQAVPKEKLND----NSDLKNLFEGLSMTRA 150

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
            ++   +R+G++ ID  ++KFNPNMH+A+F++   TV ANT+I+V + GY ++ER +RPA
Sbjct: 151 SLLQVFKRHGLEPIDPINEKFNPNMHEALFQKEDSTVEANTVIEVTKLGYKLHERCIRPA 210

Query: 182 LVSISK 187
           LV +SK
Sbjct: 211 LVGVSK 216


>gi|225439145|ref|XP_002267243.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 338

 Score =  128 bits (320), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 42/216 (19%), Positives = 86/216 (39%), Gaps = 8/216 (3%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E  +S       +  +       E+            +    +++ LR+ A+ +N R+RT
Sbjct: 125 EALVSNDESKAAEIEAFIKFIEDEKIDLEKKVAALSEELSSDKERILRISADFDNFRKRT 184

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           DRE+    + +  +   ++L V DN  RA     ++    E         +    +   +
Sbjct: 185 DRERLSLVTNAQGEVLENLLPVLDNFERAKAQIKVETEGEE--------KINNSYQSIYK 236

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           + +  L   GV  ++     F+P  H+A+  E       + II+  + G+ + +R+LRP+
Sbjct: 237 QFVEILGSLGVTPVETIGNPFDPLFHEAIMREDSTEFEEDVIIQEFRKGFKLGDRLLRPS 296

Query: 182 LVSISKGKTQNPTEEKKETIEQPSPLDIEERNKTQT 217
           +V +S G      E    + E+   +   E +   T
Sbjct: 297 MVKVSAGPGPAKAEAVGSSEEEAVRVTETETSGEGT 332


>gi|87200075|ref|YP_497332.1| GrpE protein [Novosphingobium aromaticivorans DSM 12444]
 gi|123763471|sp|Q2G6M5|GRPE_NOVAD RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|87135756|gb|ABD26498.1| GrpE protein [Novosphingobium aromaticivorans DSM 12444]
          Length = 186

 Score =  128 bits (320), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 64/190 (33%), Positives = 100/190 (52%), Gaps = 10/190 (5%)

Query: 5   MSEKNIDKEKNPSNAN-----SSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRR 59
           MS+ +         A          +  S+ +   +   + E  R   L   AE +N+RR
Sbjct: 1   MSDNDTRPTDAEVEAELKGVPEDMIDRTSDNDELAKLREELETARQDVLYAKAETQNVRR 60

Query: 60  RTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMT 119
           R +++  DA++Y+   FARD+LSV+DNLSRAL+S P DL           K+L+ G+E T
Sbjct: 61  RMEKDVADARAYAATGFARDILSVADNLSRALESIPADLRED-----DKFKNLVAGLEAT 115

Query: 120 RREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
            RE+      +G+ +I A     +P+ HQAM E P       T+I+ +Q GY I +R+LR
Sbjct: 116 GREIEKVFSSHGIVRIAAMGLPLDPHQHQAMIEMPSADAEPGTVIQELQAGYMIKDRLLR 175

Query: 180 PALVSISKGK 189
           PA+V+++K  
Sbjct: 176 PAMVAVAKKP 185


>gi|209544120|ref|YP_002276349.1| GrpE protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|209531797|gb|ACI51734.1| GrpE protein [Gluconacetobacter diazotrophicus PAl 5]
          Length = 210

 Score =  128 bits (320), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 67/184 (36%), Positives = 97/184 (52%), Gaps = 4/184 (2%)

Query: 33  PEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALD 92
            +E     EE R+K+LR  AEM+NLR RT RE +DA+ Y+  KFARD++  ++NL RAL 
Sbjct: 30  IQELEAALEEMREKWLRSEAEMQNLRTRTKRELEDARQYATQKFARDVVEAAENLKRALA 89

Query: 93  SAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFE 152
           S P      ++     +  + EGIE T R  M  LER+G+   D     F+ N HQAM E
Sbjct: 90  SLPHATEGEDRL----IARMREGIESTERSFMGILERHGISAADPAGTPFDANHHQAMAE 145

Query: 153 EPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQPSPLDIEER 212
           +  D  P  T+I+     + ++ R+L+PA+V +SKG          +  E  +  D    
Sbjct: 146 QHSDEHPHGTVIQAWTPAWTLHGRLLKPAMVVVSKGAAAGTQPAAAQATESGTYSDPTYG 205

Query: 213 NKTQ 216
           NK  
Sbjct: 206 NKAD 209


>gi|6324806|ref|NP_014875.1| Mge1p [Saccharomyces cerevisiae S288c]
 gi|585221|sp|P38523|GRPE_YEAST RecName: Full=GrpE protein homolog, mitochondrial; Flags: Precursor
 gi|457594|dbj|BAA05058.1| GrpE homologue [Saccharomyces cerevisiae]
 gi|468512|emb|CAA55145.1| GRPE [Saccharomyces cerevisiae]
 gi|493576|gb|AAA19253.1| Mge1p [Saccharomyces cerevisiae]
 gi|1420533|emb|CAA99452.1| MGE1 [Saccharomyces cerevisiae]
 gi|151945320|gb|EDN63563.1| mitochondrial grpe [Saccharomyces cerevisiae YJM789]
 gi|190407540|gb|EDV10807.1| hypothetical protein SCRG_01618 [Saccharomyces cerevisiae RM11-1a]
 gi|207341003|gb|EDZ69181.1| YOR232Wp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|285815109|tpg|DAA11002.1| TPA: Mge1p [Saccharomyces cerevisiae S288c]
 gi|323352157|gb|EGA84694.1| Mge1p [Saccharomyces cerevisiae VL3]
          Length = 228

 Score =  128 bits (320), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 54/184 (29%), Positives = 98/184 (53%), Gaps = 4/184 (2%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           K+ + ++N  +     +E K   +       ++ E +D+ LR +A+  NL++ T ++ + 
Sbjct: 49  KSEESKENNEDLTEEQSEIKKLESQLSAKTKEASELKDRLLRSVADFRNLQQVTKKDIQK 108

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A+ +++ KFA+D+L   DN   AL++   +           +  L  G+ MTR    +TL
Sbjct: 109 AKDFALQKFAKDLLESVDNFGHALNAFKEEDLQK----SKEISDLYTGVRMTRDVFENTL 164

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            ++G++K+D   + F+PN H+A FE P       T+  V Q G+ +N+RV+RPA V I K
Sbjct: 165 RKHGIEKLDPLGEPFDPNKHEATFELPQPDKEPGTVFHVQQLGFTLNDRVIRPAKVGIVK 224

Query: 188 GKTQ 191
           G+  
Sbjct: 225 GEEN 228


>gi|257482277|ref|ZP_05636318.1| heat shock protein GrpE [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|331011482|gb|EGH91538.1| heat shock protein GrpE [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 187

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 55/174 (31%), Positives = 96/174 (55%), Gaps = 8/174 (4%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
           +      +    Q    +D+ LRV A+++N+RRR +++ + A  +++ KFA D+L + D+
Sbjct: 22  EELTTRVQVLEEQLAAAQDQSLRVAADLQNVRRRAEQDVEKAHKFALEKFAGDLLPIIDS 81

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNM 146
           L R LD +  +        +  ++ + EGIE+T +    TL+RY ++ ID   Q F+ + 
Sbjct: 82  LERGLDLSNPE--------DESIRPMREGIELTLKMFQDTLKRYQLEAIDPHGQPFSADQ 133

Query: 147 HQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKET 200
           HQAM  +    V  NT++KV Q GY +N R+LRPA+V +SK  +       ++ 
Sbjct: 134 HQAMAMQESADVEPNTVLKVFQKGYQLNGRLLRPAMVVVSKAPSPATPSINEQA 187


>gi|242044212|ref|XP_002459977.1| hypothetical protein SORBIDRAFT_02g019590 [Sorghum bicolor]
 gi|241923354|gb|EER96498.1| hypothetical protein SORBIDRAFT_02g019590 [Sorghum bicolor]
          Length = 305

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 62/183 (33%), Positives = 112/183 (61%), Gaps = 6/183 (3%)

Query: 28  SEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNL 87
            +  + +   ++ ++ +DK LR  AEMEN+  RT RE ++++ Y++  FA+ +L V+DNL
Sbjct: 122 EKDGLLKSKDDEIKDMKDKVLRSYAEMENIIARTKRESENSKKYAVQNFAKSLLDVADNL 181

Query: 88  SRALDSAPLDLANSEKKSESV-----LKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKF 142
           SRA        +  +   +S      LK+L+EG++MT +++    +++GV+K D  ++KF
Sbjct: 182 SRASSVVKESFSKIDASKDSAGAIPLLKTLLEGVDMTEKQLAEVFKKFGVEKFDPLNEKF 241

Query: 143 NPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIE 202
           +PN H A+F+ P  + P+ T+  VV+ GY +++RVLRPA V ++ G     TEE ++  E
Sbjct: 242 DPNRHCAVFQIPDPSKPSGTVASVVKVGYMLHDRVLRPAEVGVTAGGADA-TEEAEQPEE 300

Query: 203 QPS 205
           + +
Sbjct: 301 KTA 303


>gi|104780011|ref|YP_606509.1| heat shock protein GrpE [Pseudomonas entomophila L48]
 gi|122985962|sp|Q1IF60|GRPE_PSEE4 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|95108998|emb|CAK13694.1| heat shock protein GrpE [Pseudomonas entomophila L48]
          Length = 184

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 58/191 (30%), Positives = 102/191 (53%), Gaps = 8/191 (4%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
            D++ +  N NS  A   +     +E   Q    +D+ LR  A+++N+RRR +++ + A 
Sbjct: 2   ADEQLDEKNLNSEEAGAVNGDARVQELEEQLAAAKDQSLRAAADLQNIRRRAEQDVEKAH 61

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
            +++ KFA D+L + D+L R L+ +  D        +  +K + EGIE+T +    TL+R
Sbjct: 62  KFALEKFAGDLLPIIDSLERGLELSNAD--------DDTIKPMREGIELTLKMFHDTLKR 113

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
           Y ++ ++   + FN   HQAM  +    V  N+++KV Q GY +N R+LRPA+V +SK  
Sbjct: 114 YNLEALEPHGEPFNAEHHQAMAMQESADVEPNSVLKVFQKGYLLNGRLLRPAMVVVSKSP 173

Query: 190 TQNPTEEKKET 200
                   ++ 
Sbjct: 174 APAQPSIDEKA 184


>gi|319406452|emb|CBI80092.1| heat shock protein GrpE [Bartonella sp. 1-1C]
          Length = 220

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 91/182 (50%), Positives = 127/182 (69%), Gaps = 4/182 (2%)

Query: 17  SNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKF 76
            +  ++  EE    +      +++++ +DK LR+ A+MENLRRRT R+  DA++YSIA F
Sbjct: 41  ESDPNAEVEEIQSADPLVILQDENKQLKDKILRLAADMENLRRRTARDVADAKAYSIANF 100

Query: 77  ARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID 136
           ARDMLSVSD+L RAL + P D       + S LK+L+EG+EMT R MM+ LER+GVKKID
Sbjct: 101 ARDMLSVSDDLHRALAAIPKDAGE----NNSGLKTLVEGVEMTERAMMTALERHGVKKID 156

Query: 137 AKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEE 196
            + QKF+P+ HQAMFE P+  VP NT+ +VVQ GY I ERVLRPA+V ++KG+ +  + E
Sbjct: 157 PEGQKFDPHFHQAMFEIPNAEVPENTVQQVVQAGYIIGERVLRPAIVGVTKGEVKEVSVE 216

Query: 197 KK 198
            +
Sbjct: 217 SE 218


>gi|116782351|gb|ABK22476.1| unknown [Picea sitchensis]
          Length = 338

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 38/214 (17%), Positives = 84/214 (39%), Gaps = 8/214 (3%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   +  +           +   E+ +   +      ++   +DK LR+ A+ +N R+R 
Sbjct: 115 EAIANSDDTRVSDIEVQLQAIEDEKNALSKLVAALTEEASRGKDKLLRLNADFDNFRKRA 174

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           ++E+    S         +L + D+  RA                   + + +  +   +
Sbjct: 175 EKERLSLASNIQGDVIESLLPMVDDFERAKTQIK--------IQTEGEEKIDKSYQGIYK 226

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           + +  ++   V  +D   + F+P +H+A+  E   +     II+  + G+ + +++LRPA
Sbjct: 227 QFVEIMKGLHVNVVDTVGKPFDPMLHEAILHEDSTSFEEGIIIEEFRRGFILGDKLLRPA 286

Query: 182 LVSISKGKTQNPTEEKKETIEQPSPLDIEERNKT 215
           +V +S G       E      + S    EE  +T
Sbjct: 287 MVKVSAGPGPAKDAEDSANDAEHSANPAEECKET 320


>gi|56754108|gb|AAW25243.1| SJCHGC04910 protein [Schistosoma japonicum]
          Length = 217

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 52/179 (29%), Positives = 91/179 (50%), Gaps = 4/179 (2%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           + +  +  S    S  E +S     ++   + ++  DKY R +AE EN+R+R  ++  +A
Sbjct: 38  STETSEQSSTPKESDKELESLKTEMQKLTQKYDDLDDKYKRALAESENMRKRLMKQIDEA 97

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL- 127
           + + I  F +D+L V+D L+ A+ SAP D             +L  G+ MT  EM+    
Sbjct: 98  KLFGIQSFCKDLLEVADVLTTAIASAPQDQLKD--GVNPPFANLYNGLVMTEMEMLKVFS 155

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHD-TVPANTIIKVVQDGYAINERVLRPALVSI 185
               V+      ++F+PN+H+A+F+ P +     NT+  V + GY ++ R LRPA V +
Sbjct: 156 HYNLVRISPEVGERFDPNIHEAIFQAPLEAGKEKNTVAVVTKIGYQLHGRPLRPAFVGV 214


>gi|297170564|gb|ADI21591.1| molecular chaperone GrpE (heat shock protein) [uncultured
           Oceanospirillales bacterium HF0130_06B06]
          Length = 205

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 58/184 (31%), Positives = 97/184 (52%), Gaps = 7/184 (3%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
            SE         + A +  +          E+   +E  +D  LRV AEM+NLRRRT+++
Sbjct: 29  SSEGQSGDAPLDAQAEAEISTTDGLSKRLAEAELVAERAKDDLLRVQAEMQNLRRRTEQD 88

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
            + A  Y I KF+ ++L V DNL RAL SA           +  +K++ +G+ +T +   
Sbjct: 89  VEKAHKYGIEKFSAELLVVMDNLERALTSASESK-------DESVKAIQDGVSLTLKSFN 141

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
               ++ +  +D   + F+P +HQA+  +       N++I+V+Q GY +N RV+RPA+V 
Sbjct: 142 DCFAKFSIVAVDPLGEPFDPQLHQAIATQESPDSEPNSVIEVIQKGYTLNGRVIRPAMVM 201

Query: 185 ISKG 188
           +SKG
Sbjct: 202 VSKG 205


>gi|285018454|ref|YP_003376165.1| protein grpe (hsp-70 cofactor) [Xanthomonas albilineans GPE PC73]
 gi|283473672|emb|CBA16175.1| probable protein grpe (hsp-70 cofactor) [Xanthomonas albilineans]
          Length = 173

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 46/168 (27%), Positives = 82/168 (48%), Gaps = 11/168 (6%)

Query: 20  NSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARD 79
            +            E   ++    +   LR  A++EN R+R  R+ + A+ ++  +   D
Sbjct: 15  EAQQPATDPLQAELETLRSELALVKADALRERADLENQRKRIARDVEQARKFANERLLGD 74

Query: 80  MLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKD 139
           +L V D+L   L +A  + +            L +G+E+T ++++      G+  +D   
Sbjct: 75  LLPVFDSLDAGLTAAGSEPSP-----------LRDGLELTYKQLLKVAADNGLTLLDPAG 123

Query: 140 QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           Q F+P  HQA+ E   + V    +I+V Q GY +NER+LRPALV ++K
Sbjct: 124 QPFDPEHHQAISEAELEGVAPGYVIQVFQKGYLLNERLLRPALVVVAK 171


>gi|319898245|ref|YP_004158338.1| heat shock protein GrpE [Bartonella clarridgeiae 73]
 gi|319402209|emb|CBI75740.1| heat shock protein GrpE [Bartonella clarridgeiae 73]
          Length = 220

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 94/187 (50%), Positives = 127/187 (67%), Gaps = 4/187 (2%)

Query: 12  KEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
           K         +  EE    +      ++++E RD+ LR+ AEMENLRRRT R+  DA++Y
Sbjct: 36  KMNEEEIFPDAEREESEPADPLVVLQDENKELRDQILRLAAEMENLRRRTARDVADAKAY 95

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
           SIA FARDMLSVSD+L RAL++ P D       ++S LK+L+EG+EMT R MM+ LER+G
Sbjct: 96  SIANFARDMLSVSDDLHRALEAIPKDEGE----NDSGLKTLVEGVEMTERAMMAALERHG 151

Query: 132 VKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQ 191
           VKKID + QKF+P+ HQAMFE P+  VP NT+ +VVQ GY I ERVLRPA+V ++KG  +
Sbjct: 152 VKKIDPEGQKFDPHFHQAMFEIPNADVPENTVQQVVQAGYIIGERVLRPAIVGVTKGGVK 211

Query: 192 NPTEEKK 198
             + E +
Sbjct: 212 EASVESE 218


>gi|226498360|ref|NP_001140622.1| hypothetical protein LOC100272696 [Zea mays]
 gi|194700212|gb|ACF84190.1| unknown [Zea mays]
          Length = 309

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 60/183 (32%), Positives = 104/183 (56%), Gaps = 5/183 (2%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +  D E    +          +    +    + ++ +DK LR  AEMEN+  RT RE ++
Sbjct: 115 QEADSEDLDLSKEDLVKLLLEKDESLKSKDEEFKDMKDKVLRSYAEMENVLARTKRESEN 174

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESV-----LKSLIEGIEMTRRE 122
            + Y+I  F++ +L V+DNLSRA        +  +  ++S      LK+L+EG+EMT ++
Sbjct: 175 TKKYAIQSFSKSLLDVADNLSRASSVVKASFSKIDSSNDSDEAVTLLKTLLEGVEMTEKQ 234

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           +    +++GV+K D  ++KF+PN H A+F+ P  + P+ T+  VV+ GY +++RVLRPA 
Sbjct: 235 LGEVFKKFGVEKFDPLNEKFDPNRHYAIFQIPDPSKPSGTVAAVVKVGYMLHDRVLRPAE 294

Query: 183 VSI 185
           V +
Sbjct: 295 VGV 297


>gi|283780797|ref|YP_003371552.1| GrpE protein [Pirellula staleyi DSM 6068]
 gi|283439250|gb|ADB17692.1| GrpE protein [Pirellula staleyi DSM 6068]
          Length = 177

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 56/177 (31%), Positives = 94/177 (53%), Gaps = 9/177 (5%)

Query: 16  PSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAK 75
            ++A  +   E +      +   + +E  ++ LR  AE+EN R+R+ RE +D + Y+   
Sbjct: 10  SADATEAAIGETAFQQQLAKLEAEVKEANERVLRGQAELENYRKRSRRELEDDRKYAALP 69

Query: 76  FARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI 135
            ARD+LSV DNL RALD+A    ++ +         L+ G++M   ++   L ++    I
Sbjct: 70  LARDLLSVIDNLQRALDAAAKAESSGD---------LLLGVKMVLGQLQGILAQHQCVPI 120

Query: 136 DAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQN 192
           +   Q F+PN HQA+ +EP D   A  + +  Q GY +++RV+RPA V +S G    
Sbjct: 121 ETVGQAFDPNFHQAIAQEPSDEHAAGVVTRAAQVGYKLHDRVIRPAQVFVSTGPASA 177


>gi|297181545|gb|ADI17731.1| molecular chaperone grpe (heat shock protein) [uncultured
           Oceanospirillales bacterium HF0130_25G24]
          Length = 205

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 58/184 (31%), Positives = 97/184 (52%), Gaps = 7/184 (3%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
            SE         + A +  +          E+   +E  +D  LRV AEM+NLRRRT+++
Sbjct: 29  SSEGQSGDAPLDAQAEAEISTTDGLSKRLAEAELVAERAKDDLLRVQAEMQNLRRRTEQD 88

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
            + A  Y I KF+ ++L V DNL RAL SA           +  +K++ +G+ +T +   
Sbjct: 89  VEKAHKYGIEKFSVELLVVMDNLERALTSASESK-------DESVKAIQDGVSLTLKSFN 141

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
               ++ +  +D   + F+P +HQA+  +       N++I+V+Q GY +N RV+RPA+V 
Sbjct: 142 DCFAKFSIVAVDPLGEPFDPQLHQAIATQESPDSEPNSVIEVIQKGYTLNGRVIRPAMVM 201

Query: 185 ISKG 188
           +SKG
Sbjct: 202 VSKG 205


>gi|74137770|dbj|BAE24062.1| unnamed protein product [Mus musculus]
          Length = 217

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 53/171 (30%), Positives = 91/171 (53%), Gaps = 3/171 (1%)

Query: 17  SNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKF 76
                  + +K+ +    +   Q  E  +KY R +A+ ENLR+R+ +  ++A+ Y I  F
Sbjct: 48  EPKTDPPSADKTLLEEKAKLEEQLRETMEKYKRALADTENLRQRSQKLVQEAKLYGIQGF 107

Query: 77  ARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID 136
            +D+L V+D L +A  S P +  +    +   LKSL EG+ MT  ++     ++G+ ++D
Sbjct: 108 CKDLLEVADILEKATQSVPKEEISD---NNPHLKSLYEGLVMTEVQIQKVFTKHGLLRLD 164

Query: 137 AKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
               KF+P  H+A+F  P +     T+  V + GY ++ R LRPALV + K
Sbjct: 165 PIGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVK 215


>gi|322705210|gb|EFY96797.1| mitochondrial co-chaperone GrpE [Metarhizium anisopliae ARSEF 23]
          Length = 241

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 57/182 (31%), Positives = 98/182 (53%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           E    ++         T          E    ++ +++DK +R +A+  NL+ RT RE K
Sbjct: 59  EGEKAEKSEAKEEAGETDAVAELKKSLEAKDAEARDWKDKCMRTVADFRNLQDRTQREVK 118

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
            A+ ++I KFA+D++   DNL RAL   P +   ++ ++   L +L +G++MT   +M T
Sbjct: 119 TAREFAIQKFAKDLVESVDNLDRALTMVPSEKLVAKDEASQDLVNLYDGLKMTENILMQT 178

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           L ++G+++++ + +KFNPN H+A F  P      N +  V Q G+ +N RVLR A V + 
Sbjct: 179 LAKHGLERLNPEGEKFNPNEHEATFMAPQPDKDNNHVFHVQQKGFKLNGRVLRAAKVGVV 238

Query: 187 KG 188
           K 
Sbjct: 239 KN 240


>gi|289741947|gb|ADD19721.1| molecular chaperone [Glossina morsitans morsitans]
          Length = 237

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 58/175 (33%), Positives = 97/175 (55%), Gaps = 3/175 (1%)

Query: 13  EKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYS 72
                       + +      E    Q+ +  DKY R +AE ENLR R  ++  DA+ + 
Sbjct: 66  NNPADQIKKLAQDLEVLGKEVESLKEQNIQLLDKYRRSLAESENLRSRLSKQIADAKLFG 125

Query: 73  IAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGV 132
           I  F +++L V+D L  A +S P +    +      LKSL EG+ MT+  +    +R+G+
Sbjct: 126 IQGFCKELLDVADILGHATNSVPQEELTDK---NPHLKSLYEGLSMTQASLFQVFKRHGL 182

Query: 133 KKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           + ++   +KF+PN+H+A+F++   +V  NTII+V + GY ++ RV+RPALV +SK
Sbjct: 183 ETMNPLKEKFDPNLHEALFQKEDSSVDPNTIIEVTKLGYKLHNRVIRPALVGVSK 237


>gi|322788377|gb|EFZ14048.1| hypothetical protein SINV_00910 [Solenopsis invicta]
          Length = 235

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 63/192 (32%), Positives = 107/192 (55%), Gaps = 9/192 (4%)

Query: 3   TFMSEKNIDKEKNP--SNANSSTAEEKSEINIPEESLNQSEE----FRDKYLRVIAEMEN 56
           T   EK  D    P  S A  +  + K+E+ +  + L + +E      DKY R +AE EN
Sbjct: 47  TITEEKKPDSTNVPPMSEATENEKKLKTELELINKELAELKESKDTLEDKYKRALAEGEN 106

Query: 57  LRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGI 116
           +R R  ++  DA+ + I  F +D+L V+D L +A +S P D           LK L EG+
Sbjct: 107 IRVRLTKQINDAKLFGIQGFCKDLLDVADVLGKATESVPKDEITE---RNPHLKGLYEGL 163

Query: 117 EMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINER 176
            MT  ++    +++G+  ++  ++KF+PN H+A+F++  +     TI+ V + GY ++ER
Sbjct: 164 VMTEAQLHKVFKKHGLVSLNPVNEKFDPNEHEALFQQEVEGKEPGTIVVVSKVGYKLHER 223

Query: 177 VLRPALVSISKG 188
           ++RPALV ++KG
Sbjct: 224 IVRPALVGVAKG 235


>gi|170087268|ref|XP_001874857.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164650057|gb|EDR14298.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 242

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 51/193 (26%), Positives = 85/193 (44%), Gaps = 15/193 (7%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           +  +     +               +    +  +   +   + A+  NL+R   REK+  
Sbjct: 46  STSEGDKAKDPQGEKGSTSDLEEKIKAKDAEVVDLTGRLRYLQADFLNLQRNAAREKEQT 105

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLD---------------LANSEKKSESVLKSLI 113
           + ++I +FA D+L   D L+ AL S P                   +  K  E+ L+ L 
Sbjct: 106 RDFAITRFASDLLETVDVLAIALKSVPATALSTHESSQTSTTPPPESLPKSHEAYLRELH 165

Query: 114 EGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAI 173
            G+EMT R ++ TL +Y VK  D    KF+PN H+A+++ P       T+I   + GY I
Sbjct: 166 TGVEMTHRLLLQTLFKYHVKPFDPTGDKFDPNQHEALYQAPIPGKEPGTVIDCQKTGYTI 225

Query: 174 NERVLRPALVSIS 186
            +RVLR A V ++
Sbjct: 226 KDRVLRAAQVGVA 238


>gi|156536983|ref|XP_001608280.1| PREDICTED: similar to conserved hypothetical protein [Nasonia
           vitripennis]
          Length = 231

 Score =  126 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 60/187 (32%), Positives = 108/187 (57%), Gaps = 7/187 (3%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEE----FRDKYLRVIAEMENLRRRT 61
           + +    E    + + +  + KSEI +  + L + +E      DKY R +A+ ENLR R 
Sbjct: 48  TAEEPKSESAEQSLSENEKKLKSEIELLNKDLTELKEKYSQLDDKYKRALADSENLRVRL 107

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
            ++ +DA+ + I  F +D+L V+D L +A +S P D  +        LKSL EG+ MT  
Sbjct: 108 MKQIEDAKLFGIQGFCKDLLDVADILGKATESVPKDEISE---RNPHLKSLYEGLIMTEA 164

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           ++    +++G+  ++  D+KF+PN H+A+F++  +     T++ V + GY ++ER++RPA
Sbjct: 165 QLHKVFKKHGLISLNPLDEKFDPNQHEALFQQEVEGKKPGTVVVVSKVGYKLHERIVRPA 224

Query: 182 LVSISKG 188
           LV ++KG
Sbjct: 225 LVGVAKG 231


>gi|322694889|gb|EFY86707.1| mitochondrial co-chaperone GrpE [Metarhizium acridum CQMa 102]
          Length = 241

 Score =  126 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 55/167 (32%), Positives = 94/167 (56%)

Query: 22  STAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDML 81
            T               ++ +++DK +R +A+  NL+ RT RE K A+ ++I KFA+D++
Sbjct: 74  ETDAVAELKKSLAAKDAEARDWKDKCMRAVADFRNLQDRTQREVKTAREFAIQKFAKDLV 133

Query: 82  SVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQK 141
              DNL RAL   P +   ++ ++   L +L +G++MT   +M TL ++G+++++ + +K
Sbjct: 134 ESVDNLDRALTMVPSEKLAAKDEACQDLINLYDGLKMTENILMQTLAKHGLERLNPEGEK 193

Query: 142 FNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           FNPN H+A F  P      N +  V Q G+ +N RVLR A V + K 
Sbjct: 194 FNPNEHEATFMAPQPDKENNLVFHVQQKGFKLNGRVLRAAKVGVVKN 240


>gi|328952821|ref|YP_004370155.1| Protein grpE [Desulfobacca acetoxidans DSM 11109]
 gi|328453145|gb|AEB08974.1| Protein grpE [Desulfobacca acetoxidans DSM 11109]
          Length = 190

 Score =  126 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 53/186 (28%), Positives = 98/186 (52%), Gaps = 9/186 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           ET   E     E   + +     E ++ I    +   +++E  D++LR+ AEMEN +RR 
Sbjct: 10  ETVNPEVVESSEMEAAESVIEETETEALIRQLAQKTQEAQEIHDRWLRLAAEMENFKRRQ 69

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           ++E+ D + ++     +++L + DNL  A++        S         +L EG+E   +
Sbjct: 70  EKERADLRQFANESLIKELLPIVDNLELAINHGRQQEPGS---------ALQEGVENVLK 120

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
             ++ L ++GV  I A   KF+P  H A+ ++  D+V   TII+ +Q GY ++ R+LRPA
Sbjct: 121 GFLAALTKFGVTPIQALGDKFDPTFHNAVMQQEDDSVEDQTIIQELQKGYLLHNRLLRPA 180

Query: 182 LVSISK 187
           +V +++
Sbjct: 181 MVVVAR 186


>gi|57530061|ref|NP_001006458.1| grpE protein homolog 1, mitochondrial [Gallus gallus]
 gi|53136716|emb|CAG32687.1| hypothetical protein RCJMB04_32n8 [Gallus gallus]
          Length = 222

 Score =  126 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 56/180 (31%), Positives = 95/180 (52%), Gaps = 3/180 (1%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +    + +       TA E+       +   Q +E  DKY R +A+ EN+R+R+ +  ++
Sbjct: 44  EEDQGQSHNEQKAEPTAAERMLTEEKAKLEEQLKEVTDKYKRALADAENVRQRSQKLVEE 103

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A+ Y I  F +D+L V+D L +A +S P +    E      LKSL EG+ MT  ++    
Sbjct: 104 AKLYGIQSFCKDLLEVADILEKATESVPKEEIKDE---NPHLKSLYEGLVMTEVQIQKVF 160

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +++G+ +++    KF+P  H+A+F  P +     TI  V + GY ++ R LRPALV + K
Sbjct: 161 KKHGLLRLNPVGAKFDPYEHEALFHAPMEGKEPGTIALVSKIGYKLHGRTLRPALVGVVK 220


>gi|226504642|ref|NP_001151179.1| protein grpE [Zea mays]
 gi|195644842|gb|ACG41889.1| protein grpE [Zea mays]
          Length = 328

 Score =  126 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 44/204 (21%), Positives = 85/204 (41%), Gaps = 8/204 (3%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E  +++      +  S   S   E+ S +N       +    R++ LR+ A+ +N R+RT
Sbjct: 113 EALINDDEAKAAEIESLLLSIEDEKNSLLNKITALDAELATQRERILRISADFDNFRKRT 172

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           + EK +       +     L V DN  RA     ++    E         +    +   +
Sbjct: 173 ENEKLNMMENVQGELIESFLPVLDNFERAKVQIKVETEGEE--------KINNSYQSIYK 224

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           + +  L   GV+ ++   + F+P +H+A+  E         I++  + G+ + ER+LRPA
Sbjct: 225 QFIEILNSLGVEDVETVGKPFDPMLHEAIMREESSEFEEGIILQEFRKGFKLGERLLRPA 284

Query: 182 LVSISKGKTQNPTEEKKETIEQPS 205
           +V +S G       +   T  + S
Sbjct: 285 MVKVSAGPGPEKFGDDDPTAVEGS 308


>gi|148258936|ref|YP_001243521.1| putative heat shock protein (HSP-70 cofactor), grpE [Bradyrhizobium
           sp. BTAi1]
 gi|146411109|gb|ABQ39615.1| putative heat shock protein (HSP-70 COFACTOR), grpE [Bradyrhizobium
           sp. BTAi1]
          Length = 181

 Score =  126 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 60/172 (34%), Positives = 101/172 (58%), Gaps = 7/172 (4%)

Query: 22  STAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDML 81
                 +E       L+++   +D+ LR +A+ EN RR+ DR+ +D + +++A+FAR++L
Sbjct: 10  EDEAVATEATDVATLLSENASLKDRLLRALADAENARRQADRKAEDTRKFAVAEFARELL 69

Query: 82  SVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQK 141
            V DNL R +++             +   +L+EG+E T R  + TLER+GVKKI A  Q+
Sbjct: 70  PVIDNLQRVIEARKT-------VPSTQHDALLEGVETTLRLFLQTLERFGVKKIAASGQR 122

Query: 142 FNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNP 193
           F+P++H+A+ E    + P   I +V++DGY I++R+LRPA V +SK      
Sbjct: 123 FDPSLHEALMEAEDASHPPGIITRVLEDGYMIHDRLLRPARVVVSKKHPPTD 174


>gi|13277394|ref|NP_077798.1| grpE protein homolog 1, mitochondrial precursor [Mus musculus]
 gi|52782975|sp|Q99LP6|GRPE1_MOUSE RecName: Full=GrpE protein homolog 1, mitochondrial; AltName:
           Full=Mt-GrpE#1; Flags: Precursor
 gi|12805609|gb|AAH02284.1| GrpE-like 1, mitochondrial [Mus musculus]
 gi|26339532|dbj|BAC33437.1| unnamed protein product [Mus musculus]
 gi|26341190|dbj|BAC34257.1| unnamed protein product [Mus musculus]
 gi|26354260|dbj|BAC40758.1| unnamed protein product [Mus musculus]
 gi|74179956|dbj|BAE36532.1| unnamed protein product [Mus musculus]
 gi|148705558|gb|EDL37505.1| GrpE-like 1, mitochondrial [Mus musculus]
          Length = 217

 Score =  126 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 53/171 (30%), Positives = 91/171 (53%), Gaps = 3/171 (1%)

Query: 17  SNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKF 76
                  + +K+ +    +   Q  E  +KY R +A+ ENLR+R+ +  ++A+ Y I  F
Sbjct: 48  EPKTDPPSADKTLLEEKAKLEEQLRETMEKYKRALADTENLRQRSQKLVEEAKLYGIQGF 107

Query: 77  ARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID 136
            +D+L V+D L +A  S P +  +    +   LKSL EG+ MT  ++     ++G+ ++D
Sbjct: 108 CKDLLEVADILEKATQSVPKEEIS---NNNPHLKSLYEGLVMTEVQIQKVFTKHGLLRLD 164

Query: 137 AKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
               KF+P  H+A+F  P +     T+  V + GY ++ R LRPALV + K
Sbjct: 165 PIGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVK 215


>gi|255545570|ref|XP_002513845.1| Protein grpE, putative [Ricinus communis]
 gi|223546931|gb|EEF48428.1| Protein grpE, putative [Ricinus communis]
          Length = 315

 Score =  126 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 33/182 (18%), Positives = 77/182 (42%), Gaps = 8/182 (4%)

Query: 28  SEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNL 87
             +    +   +    ++KY+R+ A+ +N R+R+++E+   +S +  +    +L + D+ 
Sbjct: 141 ELVQKVSDLSTEITSGKEKYIRLQADFDNFRKRSEKERHTIRSDAQGEVIESLLPMVDSF 200

Query: 88  SRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMH 147
            RA      +            K +    +   ++ +  +    V  +    + F+P++H
Sbjct: 201 ERAKQQIKPETEME--------KKIDTSYQGIYKQFVEIMRSLQVAVVATVGKPFDPSLH 252

Query: 148 QAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQPSPL 207
           +A+  E         II+  + G+ +  R+LRPA+V +S G  +       E     + +
Sbjct: 253 EAIAREESQEYKEGIIIQEFRRGFLLGGRLLRPAMVKVSAGPGRKKAPVGAEQPATAAGV 312

Query: 208 DI 209
           D 
Sbjct: 313 DD 314


>gi|221505480|gb|EEE31125.1| co-chaperone GrpE, putative [Toxoplasma gondii VEG]
          Length = 347

 Score =  126 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 55/203 (27%), Positives = 101/203 (49%), Gaps = 12/203 (5%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
           T  +++   + +      +   + +  +   E    ++ E +DK LR  A+MEN R R  
Sbjct: 145 TESADREQPENEEGEMETALEDKYRQCVEEVESLKKKNRELQDKALRAFADMENARMRHQ 204

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESV------------LK 110
           +E    + Y+++ FA+ ML V+D ++ A +S    +                      L+
Sbjct: 205 KEMASLKDYAVSDFAKAMLEVADAMAYATNSLKEAVQTDALIGPEENGDLDVATLKARLQ 264

Query: 111 SLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDG 170
            + +G+++T   +  TL+R+GV++ + + +KFNP +H+A+FE  H       + +V+Q G
Sbjct: 265 QIYDGVKLTENLLHKTLDRFGVEQYNPEGEKFNPALHEALFELEHPEKAKGEVAQVIQRG 324

Query: 171 YAINERVLRPALVSISKGKTQNP 193
           Y I ERVLR A V +SKG   + 
Sbjct: 325 YKIKERVLRAAKVGVSKGAPNSA 347


>gi|119382765|ref|YP_913821.1| GrpE protein [Paracoccus denitrificans PD1222]
 gi|119372532|gb|ABL68125.1| GrpE protein [Paracoccus denitrificans PD1222]
          Length = 179

 Score =  126 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 61/187 (32%), Positives = 109/187 (58%), Gaps = 10/187 (5%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           M+ +N +            A+E       E  + + +E+RD+++R +A+ EN R+R +++
Sbjct: 1   MTNENPNGSPLDEEIIDPPADEVPSPE-VEALIAERDEYRDRFMRALADAENARKRAEKD 59

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
           ++DA+ Y  ++ ARD+L V D L+RAL++A  D   +         +LIEG+E+T RE+ 
Sbjct: 60  RRDAEQYGGSRLARDLLPVHDALTRALEAASEDQRAAA--------ALIEGVELTLRELN 111

Query: 125 STLERYGVKKIDA-KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
           +   ++G+K I     +KF+P  H+AMFE P     A +II+V+ +G+ +++R+LRPA V
Sbjct: 112 NVFAKHGIKVITPAPGEKFDPQQHEAMFEAPVPGTVAGSIIQVMDNGFMLHDRLLRPAKV 171

Query: 184 SISKGKT 190
            +S    
Sbjct: 172 GVSSTPA 178


>gi|87301570|ref|ZP_01084410.1| Heat shock protein GrpE [Synechococcus sp. WH 5701]
 gi|87283787|gb|EAQ75741.1| Heat shock protein GrpE [Synechococcus sp. WH 5701]
          Length = 238

 Score =  126 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 47/202 (23%), Positives = 84/202 (41%), Gaps = 8/202 (3%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           +   E             +      E    + E  R +Y+R+ A+ +N R+R  R++ D 
Sbjct: 43  DPPAEAVAGGEADGEPLAQRLSAELETLRREHETLRGQYMRIAADFDNFRKRQSRDQDDL 102

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
           +         ++L V DN  RA                    SL    +   ++++   +
Sbjct: 103 RLQIACSTLSEILPVVDNFDRARQQLD--------PQSEEALSLHRSYQGLYKQLVDAFK 154

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           + GV  +  + + F+PN+H+A+  EP D V  + +I+ +Q GY +N RVLR ALV +S G
Sbjct: 155 QLGVAPMRVEGEPFDPNLHEAVLREPSDLVREDMVIEELQRGYQLNGRVLRHALVKVSMG 214

Query: 189 KTQNPTEEKKETIEQPSPLDIE 210
                +E      +  +    E
Sbjct: 215 PGPGASEGVAPLAQDGTVGGEE 236


>gi|120556270|ref|YP_960621.1| GrpE protein [Marinobacter aquaeolei VT8]
 gi|120326119|gb|ABM20434.1| GrpE protein [Marinobacter aquaeolei VT8]
          Length = 245

 Score =  126 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 50/179 (27%), Positives = 104/179 (58%), Gaps = 5/179 (2%)

Query: 20  NSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARD 79
           N    + + + +  +    + +E++++ LR  AEM+N+RRR + + + A  +++ KF ++
Sbjct: 72  NQDAEQSREQGSELDVLQQKLQEYQEQALRAQAEMQNVRRRAEIDVEKAHKFALEKFVKE 131

Query: 80  MLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKD 139
           +L V+D+L +A++S              ++ S+ EG+EMT    M++L+++ V++++   
Sbjct: 132 LLPVADSLEKAVESTEGHENAG-----ELVASIREGVEMTLTLFMNSLKKFNVEQLNPVG 186

Query: 140 QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKK 198
           + F+P  H+AM   P      N+++ VVQ GY +N RV+RPA+V ++K +     +E+ 
Sbjct: 187 EPFDPQQHEAMSMVPAPDAEPNSVVAVVQKGYLLNGRVVRPAMVVVAKAEDAPKIDEQA 245


>gi|332021654|gb|EGI62013.1| GrpE protein-like protein 1, mitochondrial [Acromyrmex echinatior]
          Length = 233

 Score =  126 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 64/192 (33%), Positives = 109/192 (56%), Gaps = 9/192 (4%)

Query: 3   TFMSEKNIDKEKNP--SNANSSTAEEKSEINIPEESLNQSEE----FRDKYLRVIAEMEN 56
           T   EK  D    P  S A  +  + K+E+ +  + L + +E      DKY R +AE EN
Sbjct: 45  TITEEKKPDATDVPPMSEATENEKKLKTELELINKELGELKESKDTLEDKYKRALAEGEN 104

Query: 57  LRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGI 116
           +R R  ++  DA+ + I  F +D+L V+D L +A +S P D    +      LKSL EG+
Sbjct: 105 IRIRLTKQINDAKLFGIQGFCKDLLDVADILGKATESVPKDEITEQ---NPHLKSLYEGL 161

Query: 117 EMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINER 176
            MT  ++    +++G+  ++  ++KF+PN H+A+F++  +     TI+ V + GY ++ER
Sbjct: 162 VMTEAQLHKVFKKHGLVSLNPVNEKFDPNEHEALFQQEVEGKNPGTIVVVSKVGYKLHER 221

Query: 177 VLRPALVSISKG 188
           ++RPALV ++KG
Sbjct: 222 IVRPALVGVAKG 233


>gi|213408729|ref|XP_002175135.1| grpE [Schizosaccharomyces japonicus yFS275]
 gi|212003182|gb|EEB08842.1| grpE [Schizosaccharomyces japonicus yFS275]
          Length = 216

 Score =  126 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 58/177 (32%), Positives = 97/177 (54%), Gaps = 1/177 (0%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
              + + +S +E +       +   +  E +D++LR +A+  NL +R +RE K A+ +++
Sbjct: 41  DGSATSAASGSEVEVLKEQVAKKDKEISELKDQFLRQVADYRNLEKRVERETKQARDFAL 100

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
            K A+D+L   DNL RAL+  P ++ N  K     L  L +G+ MT   +M TL ++G+K
Sbjct: 101 QKLAKDLLESLDNLERALEIVPEEMRNDTKNHSE-LAELYKGLSMTEEILMKTLNKHGLK 159

Query: 134 KIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           + D   + FNPN+H+A+F  P      NT+      G+ +N RV+RPA V + KG  
Sbjct: 160 RYDGVGEHFNPNLHEAVFFVPVPDKEPNTVFHCESKGFDLNGRVIRPAKVGVVKGPE 216


>gi|255580248|ref|XP_002530954.1| Protein grpE, putative [Ricinus communis]
 gi|223529469|gb|EEF31426.1| Protein grpE, putative [Ricinus communis]
          Length = 356

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 43/218 (19%), Positives = 90/218 (41%), Gaps = 8/218 (3%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   S       +  +   S   E+          + +    +D+ LR+ A+ +N R+RT
Sbjct: 145 EALASNDEARIAEIEAFLKSVEDEKNDLGRKVASLIEELSTEKDRVLRISADFDNFRKRT 204

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           DRE+    S +  +   ++L V DN  RA     L+    E         +    +   +
Sbjct: 205 DRERLSLVSNAQGEVVENLLPVLDNFERAKAQIKLETEGEE--------KINNSYQSIYK 256

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           + +  L   GV  ++     F+P +H+A+  E         I++  + G+ + +R+LRP+
Sbjct: 257 QFVEILGSLGVVPVETIGNPFDPLLHEAIMREDSTEFEEGIILQEFRKGFKLGDRLLRPS 316

Query: 182 LVSISKGKTQNPTEEKKETIEQPSPLDIEERNKTQTKN 219
           +V +S G      E+ + + E  +  +  +    + ++
Sbjct: 317 MVKVSAGPGPAKPEQAESSAEVETAGETSQEGSPEPES 354


>gi|159486567|ref|XP_001701310.1| mitochondrial grpE-type co-chaperone of the HSP70 system
           [Chlamydomonas reinhardtii]
 gi|158271793|gb|EDO97605.1| mitochondrial grpE-type co-chaperone of the HSP70 system
           [Chlamydomonas reinhardtii]
          Length = 264

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 60/180 (33%), Positives = 96/180 (53%), Gaps = 5/180 (2%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
               +A    ++ K++ +   +   Q E   D   R +AEMENLR RT RE   ++ ++I
Sbjct: 82  DGEPSAQELMSQLKAKEDHATKLTQQVETLTDSLKRTLAEMENLRARTAREVDVSKKFAI 141

Query: 74  AKFARDMLSVSDNLSRAL-----DSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
             F + +L V DNL RA      ++   D     +K  ++L  L+EG+  T   +   L+
Sbjct: 142 QGFVKSLLDVPDNLERAASVVPSEALKEDGGVPPEKLRNLLAGLLEGVRATESILHKVLK 201

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           + GV++ DA  Q F+PN+H A+F+ P  T   NTI  V + GY +N+RV+RPA V + + 
Sbjct: 202 QNGVERYDAAGQPFDPNLHNALFDIPDPTKENNTIAVVTKKGYKLNDRVIRPAEVGVVRN 261


>gi|148554174|ref|YP_001261756.1| GrpE protein [Sphingomonas wittichii RW1]
 gi|254799610|sp|A5V5Q2|GRPE_SPHWW RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|148499364|gb|ABQ67618.1| GrpE protein [Sphingomonas wittichii RW1]
          Length = 181

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 73/186 (39%), Positives = 109/186 (58%), Gaps = 6/186 (3%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           MSE+NI  E       +  + E    +   +   + E+ R++ L   AE +N+RRR ++E
Sbjct: 1   MSEENIG-ENEVETPETEPSAEAEVESPFAKLEGELEKLRNEVLYAQAETQNVRRRLEKE 59

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
           K DA +Y+   FARDMLSV+DNL RAL + P +L   ++     + SL+ GIEMT +E+ 
Sbjct: 60  KADASAYAATGFARDMLSVADNLGRALAAIPAELREDDR-----IGSLLTGIEMTAKELE 114

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
           +  +R G+ KI+A   K +PN HQAM E P       T+I+ +Q GY I +R+LRPALV 
Sbjct: 115 NVFQRNGISKIEALGAKLDPNRHQAMVELPSADAEPGTVIQEMQAGYMIKDRLLRPALVG 174

Query: 185 ISKGKT 190
           ++K   
Sbjct: 175 VAKTPE 180


>gi|226946322|ref|YP_002801395.1| heat shock protein GrpE [Azotobacter vinelandii DJ]
 gi|259647650|sp|C1DFM4|GRPE_AZOVD RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226721249|gb|ACO80420.1| GrpE protein [Azotobacter vinelandii DJ]
          Length = 187

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 56/195 (28%), Positives = 104/195 (53%), Gaps = 9/195 (4%)

Query: 4   FMSEKNIDK-EKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
              E+N+D      + A   T+  +      +    Q    +D+ LR  AE++N+RRR +
Sbjct: 1   MADEQNLDNRAPEETPAAEGTSAGEDLAARVQALEEQLAAAQDQALRAAAELQNVRRRAE 60

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           ++ + A  +++ +FA+D+L V D+L R ++ +           +  ++ + EG+E+T + 
Sbjct: 61  QDVEKAHKFALERFAQDLLGVVDSLERGIELSDPA--------DESIRPMREGMELTLKM 112

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
               L RY ++++D   + FNP  HQAM  E  D+    +++KV Q GY ++ R+LRPA+
Sbjct: 113 FHDVLRRYQLEQLDPHGEPFNPEHHQAMAMEESDSAEPGSVLKVFQKGYLLSGRLLRPAM 172

Query: 183 VSISKGKTQNPTEEK 197
           V +SK  T +  E+ 
Sbjct: 173 VVVSKAPTPSNDEQA 187


>gi|326919445|ref|XP_003205991.1| PREDICTED: grpE protein homolog 1, mitochondrial-like isoform 1
           [Meleagris gallopavo]
 gi|326919447|ref|XP_003205992.1| PREDICTED: grpE protein homolog 1, mitochondrial-like isoform 2
           [Meleagris gallopavo]
          Length = 222

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 55/180 (30%), Positives = 95/180 (52%), Gaps = 3/180 (1%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +    + +       +A E+       +   Q +E  DKY R +A+ EN+R+R+ +  ++
Sbjct: 44  EEDQGQSHNEQKTEPSAAERMLTEEKAKLEEQLKEVTDKYKRALADAENVRQRSQKLVEE 103

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A+ Y I  F +D+L V+D L +A +S P +    E      LKSL EG+ MT  ++    
Sbjct: 104 AKLYGIQGFCKDLLEVADILEKATESVPKEEIKDE---NPHLKSLYEGLVMTEVQIQKVF 160

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +++G+ +++    KF+P  H+A+F  P +     TI  V + GY ++ R LRPALV + K
Sbjct: 161 KKHGLLRLNPVGAKFDPYEHEALFHAPMEGKEPGTIALVSKIGYKLHGRTLRPALVGVVK 220


>gi|310817154|ref|YP_003965118.1| GrpE protein HSP-70 cofactor, putative [Ketogulonicigenium vulgare
           Y25]
 gi|308755889|gb|ADO43818.1| GrpE protein HSP-70 cofactor, putative [Ketogulonicigenium vulgare
           Y25]
          Length = 183

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 65/190 (34%), Positives = 108/190 (56%), Gaps = 11/190 (5%)

Query: 5   MSEKNIDKEK---NPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           M + N D +        A +   E +      E +L + +E +D+ LR  A+ EN+R+R 
Sbjct: 1   MQDDNKDLQSLDEMLEEAEAEELEAEDLAATLEATLAERDELKDRLLRAFADSENMRKRA 60

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           DR++++A++Y  +K ARDML V DNL+RAL++   +             +LIEGI++T R
Sbjct: 61  DRDRREAENYGGSKLARDMLPVYDNLTRALEAITDEQR-------EANAALIEGIDLTMR 113

Query: 122 EMMSTLERYGVKKIDA-KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           E+++   R+G+K+I      KF+P  H+AMFE P     +  II+V+Q G+ +++R+LR 
Sbjct: 114 ELVAVFARHGIKQIAPAAGDKFDPQQHEAMFEAPVPGTKSGEIIQVMQVGFMLHDRLLRA 173

Query: 181 ALVSISKGKT 190
           A V +S    
Sbjct: 174 AKVGVSSTPA 183


>gi|156843906|ref|XP_001645018.1| hypothetical protein Kpol_1072p30 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156115673|gb|EDO17160.1| hypothetical protein Kpol_1072p30 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 233

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 55/186 (29%), Positives = 96/186 (51%), Gaps = 4/186 (2%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +    E +  N      + K           ++ E +D+ LR +A+  NL+  T ++ + 
Sbjct: 52  ETEKTEASEENLTEEQKKIKELETKLNTKTKEAVELKDRLLRSVADFRNLQEVTKKDVQK 111

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A+ +++ KFA+D+L   DN   AL++   D    + K    +  L  G++MTR     TL
Sbjct: 112 ARDFALQKFAKDLLESVDNFGHALNAFQED----DIKGNKEIHDLYTGVKMTRDIFEKTL 167

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +++G++K+D   + F+PN H+A FE  H      T+  V Q G+ +N+RV+RPA V I K
Sbjct: 168 KKHGIEKLDPMGEAFDPNKHEATFELAHPDKEPGTVFHVQQIGFTLNDRVIRPAKVGIVK 227

Query: 188 GKTQNP 193
           G  ++ 
Sbjct: 228 GNEEDK 233


>gi|219362707|ref|NP_001137005.1| hypothetical protein LOC100217168 [Zea mays]
 gi|194697938|gb|ACF83053.1| unknown [Zea mays]
          Length = 328

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 43/211 (20%), Positives = 89/211 (42%), Gaps = 8/211 (3%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
           ++ +    +  S   S   E+ S +N       +    R++ LR+ A+ +N R+RT+ EK
Sbjct: 117 NDDDAKAAEIESFLLSIEDEKNSLLNKITALDVELATQRERILRISADFDNFRKRTENEK 176

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
            +       +     L V DN  RA     ++    E         +    +   ++ + 
Sbjct: 177 LNMMENVQGELIESFLPVLDNFERAKMQIKVETEGEE--------KINNSYQSINKQFIE 228

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
            L   GV+ ++   + F+P +H+A+  E         I++  + G+ + ER+LRPA+V +
Sbjct: 229 ILNSLGVEDVETVGKPFDPMLHEAIMREESSEYEEGIILQEFRKGFKLGERLLRPAMVKV 288

Query: 186 SKGKTQNPTEEKKETIEQPSPLDIEERNKTQ 216
           S G     + +   T+ + S    +  +  +
Sbjct: 289 SAGPGPENSGDDDPTVVEDSVAPQKVEDVEE 319


>gi|50306825|ref|XP_453388.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|52782859|sp|Q6CRQ1|GRPE_KLULA RecName: Full=GrpE protein homolog, mitochondrial; Flags: Precursor
 gi|49642522|emb|CAH00484.1| KLLA0D07326p [Kluyveromyces lactis]
          Length = 243

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 54/190 (28%), Positives = 95/190 (50%), Gaps = 4/190 (2%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E    E +    +  +N      + K      +    ++ EF+D+ LR +A+  NL+  T
Sbjct: 58  EEPKDENDAAAAEEDANLTEEQKKIKDLETKLDAKTKEASEFKDRLLRSVADFRNLQEVT 117

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
            ++ + A+ +++ KFA+D+L   DN   AL++   +           L  L  G++MTR 
Sbjct: 118 KKDIQKAKDFALQKFAKDLLESVDNFGHALNAFKPETLE----QSQELSDLYTGVKMTRD 173

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
               TL+++G+++++   + F+PN H+A FE P       T+  V Q GY +N+RV+RPA
Sbjct: 174 VFEKTLKKHGIEQLNPIGESFDPNKHEATFELPQPDKEPGTVFHVQQIGYTLNDRVIRPA 233

Query: 182 LVSISKGKTQ 191
            V I K    
Sbjct: 234 KVGIVKDNEN 243


>gi|114797336|ref|YP_761991.1| co-chaperone GrpE [Hyphomonas neptunium ATCC 15444]
 gi|123027612|sp|Q0BX02|GRPE_HYPNA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|114737510|gb|ABI75635.1| co-chaperone GrpE [Hyphomonas neptunium ATCC 15444]
          Length = 188

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 67/192 (34%), Positives = 107/192 (55%), Gaps = 9/192 (4%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEES----LNQSEEFRDKYLRVIAEMENLRRR 60
           MS++N   E    +A  +   +       EE       +  +   + LR++A+++N R+R
Sbjct: 1   MSDENKPGEAAELDAGVAPEAQPETELTVEELIIRLEAEKADMNGQILRLLADLDNTRKR 60

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
            DR+  +A+ Y+I KFA D+LSVSDNLSRALD+ P     +        K+L+ GIEMT 
Sbjct: 61  ADRQVSEARIYAIEKFAADLLSVSDNLSRALDALPDSERENL---TDAGKNLLGGIEMTA 117

Query: 121 REMMSTLERYGVKKID-AKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
           +E+ + L R+GV  +       F+PN+HQA+ + P    P+ TI ++ Q G+ I +R LR
Sbjct: 118 KELNTALSRHGVVPVPAEPGAVFDPNVHQAVAQIPSPQ-PSGTIAQLFQPGWKIGDRTLR 176

Query: 180 PALVSISKGKTQ 191
            A+V++S G   
Sbjct: 177 AAMVAVSTGPAN 188


>gi|167534495|ref|XP_001748923.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163772603|gb|EDQ86253.1| predicted protein [Monosiga brevicollis MX1]
          Length = 246

 Score =  125 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 60/173 (34%), Positives = 98/173 (56%), Gaps = 2/173 (1%)

Query: 16  PSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAK 75
            + A  + AE +      E +     + +DKYLR +A+MENLR R+ RE +DA  Y++ K
Sbjct: 75  DAAATMNPAEIEQLKTELEAAKAAEADLKDKYLRALADMENLRHRSKREVQDASDYAMQK 134

Query: 76  FARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI 135
           FA+D+L  +DNL RAL   P +   +E    + LK+L EG+E T+R++     RY +  +
Sbjct: 135 FAKDLLEFADNLERALAYVPEEARTAEG--NTDLKNLYEGVEGTQRQLQHVFARYELLPV 192

Query: 136 DAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           +   +KF+P +H+A+F+ P       T+ +V+  GY +  R+LR A V +   
Sbjct: 193 NPLGEKFDPELHEALFQVPDPNQAPGTVAQVMHTGYTLKGRLLRAAGVGVVVK 245


>gi|116748477|ref|YP_845164.1| GrpE protein [Syntrophobacter fumaroxidans MPOB]
 gi|254799619|sp|A0LH27|GRPE_SYNFM RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|116697541|gb|ABK16729.1| GrpE protein [Syntrophobacter fumaroxidans MPOB]
          Length = 189

 Score =  125 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 52/184 (28%), Positives = 92/184 (50%), Gaps = 9/184 (4%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
              +        +    E     +      + ++ +D+ LR+ AE++N R+R +REK + 
Sbjct: 15  ENSEMSGSEELVAVEPGEPDYRELLARKEEELKQSQDRLLRMAAELDNTRKRLEREKSEG 74

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
            +Y+     +D+L V DNL RAL+ +  +         +   SL+EG+ MT +  + +L 
Sbjct: 75  IAYANEGLMKDLLPVLDNLERALEHSENE---------ADCGSLVEGVRMTLKGFLDSLA 125

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           R+G    ++    F+PN H+A+ +E     P  T+I+  Q GY + ER+LRPA+V +SK 
Sbjct: 126 RFGCTPFESVGNAFDPNFHEAVMQEEVADYPERTVIREFQKGYTLKERLLRPAMVVVSKA 185

Query: 189 KTQN 192
               
Sbjct: 186 AGDT 189


>gi|148238358|ref|YP_001223745.1| molecular chaperone GrpE, heat shock protein [Synechococcus sp. WH
           7803]
 gi|226737232|sp|A5GHN3|GRPE_SYNPW RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|147846897|emb|CAK22448.1| Molecular chaperone GrpE, heat shock protein [Synechococcus sp. WH
           7803]
          Length = 240

 Score =  125 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 46/205 (22%), Positives = 89/205 (43%), Gaps = 15/205 (7%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRD-------KYLRVIAE 53
           +ET           +P +A   + +  +     E+   +    RD       +Y+R+ A+
Sbjct: 23  VETPNDPVETPSASDPGSAAEVSPQTGNNEARLEQLEREHTTLRDEHDVLRGQYMRIAAD 82

Query: 54  MENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLI 113
            +N R+R  R++ D +         ++L V DN  RA                   ++L 
Sbjct: 83  FDNFRKRQSRDQDDLKIQLTCSTLSEILPVVDNFERARQQLD--------PQGEEAQALH 134

Query: 114 EGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAI 173
              +   ++++  L++ GV  +    Q+F+P +H+A+  EP D  P + +I+ +Q GY +
Sbjct: 135 RSYQGLYKQLVDVLKQLGVAPMRVVGQEFDPTLHEAVLREPSDAHPEDVVIEELQRGYHL 194

Query: 174 NERVLRPALVSISKGKTQNPTEEKK 198
           N +VLR A+V +S G         +
Sbjct: 195 NGKVLRHAMVKVSMGPGPQDGASSQ 219


>gi|255580752|ref|XP_002531197.1| Protein grpE, putative [Ricinus communis]
 gi|223529199|gb|EEF31174.1| Protein grpE, putative [Ricinus communis]
          Length = 308

 Score =  125 bits (313), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 63/209 (30%), Positives = 110/209 (52%), Gaps = 13/209 (6%)

Query: 2   ETFMSEKNIDKEKNPSNANSS----TAEEKSEINIPEESLN----QSEEFRDKYLRVIAE 53
           ET   +     E    ++++       +    +   EE L     + E+ +DK LR  AE
Sbjct: 100 ETSNGDTKPSNETREPDSDTEGDLSMDDLVKLVAEKEELLKLKHKEIEKMQDKVLRTYAE 159

Query: 54  MENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPL-----DLANSEKKSESV 108
           MEN+  RT RE ++++ ++I  FA+ +L V+DNL RA           D +     +  +
Sbjct: 160 MENVMERTKREAENSRKFAIQNFAKGLLDVADNLGRASSVVKDSYSKIDTSTDTAGAVPL 219

Query: 109 LKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQ 168
           LK+L+EG+EMT +++     + GV+K D +D+ F+P+ H A+FE P  + P  T+  V++
Sbjct: 220 LKTLLEGVEMTEKQLAEVFRKSGVEKYDPRDEPFDPHRHNAVFEVPDSSKPPGTVAVVLK 279

Query: 169 DGYAINERVLRPALVSISKGKTQNPTEEK 197
            GY +++RV+RPA V ++K    +     
Sbjct: 280 AGYLLHDRVIRPAEVGVTKEVENDTASNN 308


>gi|328770994|gb|EGF81035.1| hypothetical protein BATDEDRAFT_24663 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 199

 Score =  125 bits (313), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 62/177 (35%), Positives = 106/177 (59%), Gaps = 1/177 (0%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           N  +  +P+ +  ++  E + I    E   Q  + +D Y R +A+ EN+R+RT +E  + 
Sbjct: 20  NAAESNDPNPSTETSTPEDAHIKALAEKDAQIAQLQDMYRRALADAENVRQRTRKEIDEK 79

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
           QSY+I KFA+++L+ +D L+ ALDS P    + EK + S LK L  G+ MTR E++ T +
Sbjct: 80  QSYAIQKFAKELLNTADILTMALDSVPAAERS-EKSTNSHLKDLYTGVSMTRVELLKTFK 138

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
           ++GV+  +   +KF+ N+HQA+F+          + +V + GY +++RVLRPA V +
Sbjct: 139 QFGVESYNPDGEKFDHNLHQALFQASVPGKEPGVVFQVTKVGYKLHDRVLRPAQVGV 195


>gi|83313595|ref|YP_423859.1| molecular chaperone GrpE [Magnetospirillum magneticum AMB-1]
 gi|123767878|sp|Q2VYM5|GRPE_MAGSA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|82948436|dbj|BAE53300.1| Molecular chaperone GrpE [Magnetospirillum magneticum AMB-1]
          Length = 203

 Score =  125 bits (313), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 68/197 (34%), Positives = 112/197 (56%), Gaps = 4/197 (2%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   + ++ D+  +   A  S A    +    +E   +  + ++  L   AE EN RRR 
Sbjct: 8   EQMPAAESADQSADQGPAAESAAPPAVDSERIKELEAEIAKLKNDVLYAKAETENTRRRL 67

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           +++ +D   Y+I+  A+D+LSV+DNL RALDS P             L +L  G+EMT R
Sbjct: 68  EQQAEDRGRYAISNIAKDVLSVADNLRRALDSVPASAREG----NESLTALTTGVEMTER 123

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           E+++T ERYG+K + A+ ++F+PN+HQAM E    +    T++ V+Q GY +++R+LRPA
Sbjct: 124 ELLATFERYGIKLVAAQGERFDPNLHQAMMEMEDPSQIEGTVVLVMQAGYTLHDRLLRPA 183

Query: 182 LVSISKGKTQNPTEEKK 198
           LV ++KG  ++      
Sbjct: 184 LVGVAKGGPKSGGNNVD 200


>gi|13324704|ref|NP_077813.1| grpE protein homolog 1, mitochondrial precursor [Rattus norvegicus]
 gi|6226823|sp|P97576|GRPE1_RAT RecName: Full=GrpE protein homolog 1, mitochondrial; AltName:
           Full=Mt-GrpE#1; Flags: Precursor
 gi|2804584|gb|AAC53534.1| mt-GrpE#1 precursor [Rattus norvegicus]
 gi|67678103|gb|AAH97312.1| GrpE-like 1, mitochondrial [Rattus norvegicus]
 gi|149047377|gb|EDM00047.1| GrpE-like 1, mitochondrial [Rattus norvegicus]
          Length = 217

 Score =  124 bits (312), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 53/171 (30%), Positives = 93/171 (54%), Gaps = 3/171 (1%)

Query: 17  SNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKF 76
                 ++ +K+ +    +   Q +E  +KY R +A+ ENLR+R+ +  ++A+ Y I  F
Sbjct: 48  EPKTDPSSADKTLLEEKVKLEEQLKETMEKYKRALADTENLRQRSQKLVEEAKLYGIQGF 107

Query: 77  ARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID 136
            +D+L V+D L +A  S P +  +    +   LKSL EG+ MT  ++     ++G+ ++D
Sbjct: 108 CKDLLEVADILEKATQSVPKEEVS---NNNPHLKSLYEGLVMTEVQIQKVFTKHGLLRLD 164

Query: 137 AKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
               KF+P  H+A+F  P +     T+  V + GY ++ R LRPALV + K
Sbjct: 165 PIGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVK 215


>gi|218547868|ref|YP_002381659.1| heat shock protein HSP70 cofactor [Escherichia fergusonii ATCC
           35469]
 gi|218355409|emb|CAQ88018.2| heat shock protein HSP70 cofactor [Escherichia fergusonii ATCC
           35469]
          Length = 350

 Score =  124 bits (312), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 58/190 (30%), Positives = 100/190 (52%), Gaps = 9/190 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSE-EFRDKYLRVIAEMENLRRR 60
           E  M +    +   P  +         +I   E  L +++   RD  LRV AEMENLRRR
Sbjct: 169 EIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQIRERDGILRVKAEMENLRRR 228

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+ + + A  +++ KF  ++L V D+L RAL+ A              + +++EGIE+T 
Sbjct: 229 TELDIEKAHKFALEKFINELLPVIDSLDRALEVADKA--------NPDMSAMVEGIELTL 280

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + M+  + ++GV+ I   +   +PN+HQA+     D V    ++ ++Q GY +N R +R 
Sbjct: 281 KSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRA 340

Query: 181 ALVSISKGKT 190
           A+V+++K K 
Sbjct: 341 AMVTVAKAKA 350


>gi|220934147|ref|YP_002513046.1| GrpE protein [Thioalkalivibrio sp. HL-EbGR7]
 gi|254799621|sp|B8GNX0|GRPE_THISH RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|219995457|gb|ACL72059.1| GrpE protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 187

 Score =  124 bits (312), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 62/196 (31%), Positives = 110/196 (56%), Gaps = 16/196 (8%)

Query: 4   FMSEKNIDKEKNPSNANSSTAEEKS-------EINIPEESLNQSEEFRDKYLRVIAEMEN 56
             +E+             +  E  +        +   EE+  Q++E  DK LR  AEMEN
Sbjct: 1   MSNEEQQQPNPAAQAPEGAVTEGAAPEFNPAVLLKQLEEAQAQAQEHFDKALRTQAEMEN 60

Query: 57  LRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGI 116
           LR+RT R+ ++A+ +++ KFA ++L+V D+L   LD+A  +           ++ + EG 
Sbjct: 61  LRKRTARDVENARKFALEKFAGELLAVRDSLEMGLDAARGET---------DVEKIREGT 111

Query: 117 EMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINER 176
           E+T + +   +E++GV+ +D + Q+F+P+ HQAM  +P+  +  NT++ V+Q GY +N+R
Sbjct: 112 ELTLKMLAQVMEKFGVEAVDPQGQRFDPDRHQAMSMQPNAELEPNTVMAVLQKGYLLNDR 171

Query: 177 VLRPALVSISKGKTQN 192
           +LRPA+V +SK     
Sbjct: 172 LLRPAMVVVSKAPEGE 187


>gi|195400557|ref|XP_002058883.1| GJ19762 [Drosophila virilis]
 gi|194156234|gb|EDW71418.1| GJ19762 [Drosophila virilis]
          Length = 202

 Score =  124 bits (312), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 61/185 (32%), Positives = 106/185 (57%), Gaps = 4/185 (2%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
               +   D+        + + E +        +  Q+ E  DKY R +A+ EN+R R +
Sbjct: 21  EKQQQAVSDETAAAEQKKTLSPEVERLTQELAAAKEQNSELLDKYKRALADSENMRTRLN 80

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           ++  DA+ + I  F +D+L V+D L  A  + P +  N      + LK+L EG+ MTR  
Sbjct: 81  KQINDAKIFGIQSFCKDLLEVADTLGHATQAVPKEKLNG----NADLKNLYEGLTMTRAA 136

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           ++   +R+G++ +D  +QKF+PN+H+A+F++   TV ANT+++V + GY ++ER +RPAL
Sbjct: 137 LLQVFKRHGLEPLDPINQKFDPNLHEALFQKDDATVEANTVVEVTKLGYKLHERCIRPAL 196

Query: 183 VSISK 187
           V +SK
Sbjct: 197 VGVSK 201


>gi|49082586|gb|AAT50693.1| PA4762 [synthetic construct]
          Length = 187

 Score =  124 bits (312), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 54/192 (28%), Positives = 102/192 (53%), Gaps = 8/192 (4%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           +  +  +       T   +      +E   Q    +D+ LR++A+++N+RRR +++ + A
Sbjct: 3   DEQQTLDQQTPEQPTGAAEDLTARVQELEEQLAAAQDQALRMVADLQNVRRRAEQDVEKA 62

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
             +++ KFA D+L+V D L R L+ +          ++  +K + EG+E+T +    TL 
Sbjct: 63  HKFALEKFAGDLLAVVDTLERGLEMSD--------PNDEAIKPMREGMELTLKMFDDTLR 114

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           RY V+ ++ + + FNP  HQAM  +   +    +++KV Q GY +N R+LRPA+V +SK 
Sbjct: 115 RYQVEALNPEGEPFNPEQHQAMAMQESASAEPGSVLKVFQKGYLLNGRLLRPAMVVVSKA 174

Query: 189 KTQNPTEEKKET 200
             + P    ++ 
Sbjct: 175 PAETPPSIDEQA 186


>gi|77456989|ref|YP_346494.1| GrpE protein [Pseudomonas fluorescens Pf0-1]
 gi|123606015|sp|Q3KIA1|GRPE_PSEPF RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|77380992|gb|ABA72505.1| protein GrpE (HSP-70 cofactor) [Pseudomonas fluorescens Pf0-1]
          Length = 189

 Score =  124 bits (311), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 57/197 (28%), Positives = 99/197 (50%), Gaps = 9/197 (4%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           M+++     +NP    +  A         +    Q    +D+ LRV A+++N+RRR +++
Sbjct: 1   MADEQTVDTQNPEANQAPEASGDDLATRVQVLEEQLAAAQDQSLRVAADLQNVRRRAEQD 60

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
            + A  +++ KFA D+L + D+L R L+ +  D        +  ++ + EGIE+T +   
Sbjct: 61  VEKAHKFALEKFAGDLLPIVDSLERGLELSSPD--------DESIRPMREGIELTLKMFH 112

Query: 125 STLERYG-VKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
            TL RY  V     + + FN   HQAM  +    +  N+I+KV Q GY +N R+LRPA+V
Sbjct: 113 DTLTRYQLVAVSPQEGEPFNAVEHQAMAMQESADLEPNSILKVFQKGYQLNGRLLRPAMV 172

Query: 184 SISKGKTQNPTEEKKET 200
            +SK          ++ 
Sbjct: 173 VVSKAPAPVSPSIDEKA 189


>gi|162448273|ref|YP_001610640.1| chloroplast GrpE protein [Sorangium cellulosum 'So ce 56']
 gi|226737206|sp|A9GHU4|GRPE_SORC5 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|161158855|emb|CAN90160.1| chloroplast GrpE protein [Sorangium cellulosum 'So ce 56']
          Length = 194

 Score =  124 bits (311), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 50/169 (29%), Positives = 87/169 (51%), Gaps = 9/169 (5%)

Query: 30  INIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSR 89
            +   E+  ++   R++ LR  A+ +N R+R+ RE ++AQ        +D+L V DNL R
Sbjct: 35  EDKLGEAQAEAARMREQLLRTAADFDNFRKRSRREVEEAQRRGREAILKDLLPVFDNLER 94

Query: 90  ALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQA 149
           A   A               KS+ EG+ +  ++ + TL+R G+K+I A  + F+P++H+A
Sbjct: 95  AASHAES---------APDAKSVAEGVRIVTKQFVDTLDRMGIKRIAAVGKPFDPSVHEA 145

Query: 150 MFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKK 198
           + +      PA  +I  VQ GY + + ++R A+V +SKG    P     
Sbjct: 146 IQQLDSTEHPAGVVIAEVQPGYMLGDYLIRAAMVVVSKGSPVEPAPAAN 194


>gi|77735951|ref|NP_001029673.1| grpE protein homolog 1, mitochondrial precursor [Bos taurus]
 gi|110278995|sp|Q3SZC1|GRPE1_BOVIN RecName: Full=GrpE protein homolog 1, mitochondrial; AltName:
           Full=Mt-GrpE#1; Short=mt-GrpE; Flags: Precursor
 gi|74267846|gb|AAI02965.1| GrpE-like 1, mitochondrial (E. coli) [Bos taurus]
 gi|296486263|gb|DAA28376.1| grpE protein homolog 1, mitochondrial precursor [Bos taurus]
          Length = 217

 Score =  124 bits (311), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 54/186 (29%), Positives = 100/186 (53%), Gaps = 4/186 (2%)

Query: 4   FMSEKNIDKEKNPSNANSS-TAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
             + +N++++   +   +   + EK+ +    +   Q +E  +KY R +A+ ENLR+R+ 
Sbjct: 34  KNNGQNLEEDAGQNEQKTDLPSTEKTLMEEKVKLEEQLKETMEKYKRALADTENLRQRSQ 93

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           +  ++A+ Y I  F +D+L V+D L +A    P +    +      LKSL EG+ MT  +
Sbjct: 94  KLVEEAKLYGIQGFCKDLLEVADILEKATQCVPQEEIRDD---NPHLKSLYEGLVMTEVQ 150

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           +     ++G+ +++    KF+P  H+A+F  P +     T+  V + GY ++ R LRPAL
Sbjct: 151 IQKVFTKHGLLRLNPLGAKFDPYEHEALFHTPVEGKEPGTVALVNKVGYKLHGRTLRPAL 210

Query: 183 VSISKG 188
           V + KG
Sbjct: 211 VGVVKG 216


>gi|167035720|ref|YP_001670951.1| heat shock protein GrpE [Pseudomonas putida GB-1]
 gi|189041746|sp|B0KIS6|GRPE_PSEPG RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|166862208|gb|ABZ00616.1| GrpE protein [Pseudomonas putida GB-1]
          Length = 184

 Score =  124 bits (311), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 60/191 (31%), Positives = 98/191 (51%), Gaps = 8/191 (4%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
            D + N  + N+  A         +E   Q    +D+ LRV AE +N  RR ++E   A+
Sbjct: 2   ADDQLNEKDLNAEEAAAVDNGARVQELEEQLAAAKDQSLRVAAEAQNSIRRAEQEVDKAR 61

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
            +++ KF+ D+L V D+L  AL  +  D        +  +K + EG+E+T +    TL+R
Sbjct: 62  KFALEKFSSDLLPVIDSLELALAHSSAD--------DEHVKQIREGVELTLKMFQDTLKR 113

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
           Y ++ +D   Q FNP  HQAM  + +  V  N+++ V Q GY +N R+LRPA+V +SK  
Sbjct: 114 YNLEAVDPHGQPFNPEHHQAMAMQENAEVEPNSVLNVFQKGYLLNGRLLRPAMVVVSKAP 173

Query: 190 TQNPTEEKKET 200
                   ++ 
Sbjct: 174 AAPQPSIDEKA 184


>gi|307824249|ref|ZP_07654475.1| GrpE protein [Methylobacter tundripaludum SV96]
 gi|307734629|gb|EFO05480.1| GrpE protein [Methylobacter tundripaludum SV96]
          Length = 203

 Score =  124 bits (311), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 59/189 (31%), Positives = 99/189 (52%), Gaps = 8/189 (4%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           E     E+  +         +       ++ ++++E  DK +R  AEMENL+RRT ++ +
Sbjct: 15  ENGTANEQPHTELAEHELTIEELQQALAQAEHKAQENWDKAVRAQAEMENLKRRTQKDLE 74

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
           DA  +++  FA+++L V D+L   L +A  D           +K   EG E+T ++  S 
Sbjct: 75  DAHKFALTGFAKELLPVLDSLVLGLQAATGD--------SEEVKKFREGSELTIKQFESV 126

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
             ++ ++ ID   Q FN   HQAM  +  D V  NT++ V Q GY +N R+LRPA+V ++
Sbjct: 127 FAKFKIETIDPIGQPFNAEQHQAMAMQAVDGVEPNTVVNVFQKGYMLNGRLLRPAMVLVA 186

Query: 187 KGKTQNPTE 195
           K   + PT+
Sbjct: 187 KAAEKKPTD 195


>gi|317968402|ref|ZP_07969792.1| heat shock protein GrpE [Synechococcus sp. CB0205]
          Length = 224

 Score =  124 bits (311), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 41/202 (20%), Positives = 86/202 (42%), Gaps = 8/202 (3%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
            +   E     +       +           + E  R +Y+R+ A+ +N R+R  R+++D
Sbjct: 30  DSAPAEVAAEPSADPEQRVRDLEAELTALKAEHESVRSQYMRIAADFDNFRKRQSRDQED 89

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
            ++        ++L V DN  RA                   +++    +   ++++   
Sbjct: 90  QRTLIACSTLSEILPVVDNFERARQQLD--------PQAEEAQAIHRSYQGLYKQLVDVF 141

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           ++ GV  +  + + F+P +H+A+  EP D    + +I  +Q GY +N+RVLR ALV +S 
Sbjct: 142 KQLGVSPMRVEGEPFDPTLHEAVLREPSDEHAEDLVIAELQRGYHLNDRVLRHALVKVSM 201

Query: 188 GKTQNPTEEKKETIEQPSPLDI 209
           G   +       + +  +P + 
Sbjct: 202 GPGPSGDAAPASSTDDAAPSEE 223


>gi|60549562|gb|AAX24094.1| GrpE [Pseudomonas putida]
          Length = 184

 Score =  124 bits (311), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 58/191 (30%), Positives = 100/191 (52%), Gaps = 8/191 (4%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
            D++ N  + N              E   Q    +D+ LR +A+++N+RRR +++ + A 
Sbjct: 2   ADEQLNEKDLNVEETGAADVGARVLELEEQLAAAKDQSLRAVADLQNVRRRAEQDVEKAH 61

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
            +++ KFA D+L V D+L R L+ +  D        +  +K + EGI++T +    TL+R
Sbjct: 62  KFALEKFAGDLLPVIDSLERGLELSNAD--------DESIKPMREGIKLTLKMFQDTLKR 113

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
           Y ++ +D   + FN   HQAM  E    V  N+++KV Q GY +N R+LRPA+V +SK  
Sbjct: 114 YNLEAVDPHGEPFNAEHHQAMAMEESAEVEPNSVLKVFQKGYLLNGRLLRPAMVVVSKAP 173

Query: 190 TQNPTEEKKET 200
           +       ++ 
Sbjct: 174 SAAQPSINEKA 184


>gi|144897370|emb|CAM74234.1| GrpE protein [Magnetospirillum gryphiswaldense MSR-1]
          Length = 196

 Score =  124 bits (311), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 70/199 (35%), Positives = 123/199 (61%), Gaps = 6/199 (3%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEK--SEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
           MSE+   ++   + A  + A  +  +      E   +  + + + L   A+ EN+RRR +
Sbjct: 1   MSEEQTTEQSAEAPAPETPAPAEVVAPEARIAELEAEVAKLKSEVLYARADTENVRRRLE 60

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           ++ +D   ++++ FA+D+LSV+DNL RALD+ P     + ++   +  +L  G+E+T RE
Sbjct: 61  QQAEDRGKFAVSNFAKDVLSVADNLRRALDAVP----PTAREGNDIANTLTVGVELTERE 116

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           M++ LERYG+++I A  Q+F+PN+HQAM E    + P  T++ V+Q GY ++ER+LRPAL
Sbjct: 117 MLAALERYGIRQIQALGQRFDPNLHQAMMEMEDASQPEGTVVMVMQQGYQLHERLLRPAL 176

Query: 183 VSISKGKTQNPTEEKKETI 201
           V+++KG  + P  E+ +T 
Sbjct: 177 VAVAKGGPKTPPGEQVDTS 195


>gi|237838707|ref|XP_002368651.1| co-chaperone GrpE, putative [Toxoplasma gondii ME49]
 gi|211966315|gb|EEB01511.1| co-chaperone GrpE, putative [Toxoplasma gondii ME49]
          Length = 347

 Score =  124 bits (310), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 54/202 (26%), Positives = 100/202 (49%), Gaps = 12/202 (5%)

Query: 4   FMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDR 63
             +++   + +      +   + +  +   E    ++ E +DK LR  A+MEN R R  +
Sbjct: 146 ESADREQPENEEGEMETALEDKYRQCVEEVESLKKKNRELQDKALRAFADMENARMRHQK 205

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESV------------LKS 111
           E    + Y+++ FA+ ML V+D ++ A +S    +                      L+ 
Sbjct: 206 EMASLKDYAVSDFAKAMLEVADAMAYATNSLKEAVQTDALIGPEENGDLDVATLKARLQQ 265

Query: 112 LIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGY 171
           + +G+++T   +  TL+R+GV++ + + +KFNP +H+A+FE  H       + +V+Q GY
Sbjct: 266 IYDGVKLTENLLHKTLDRFGVEQYNPEGEKFNPALHEALFELEHPEKAKGEVAQVIQRGY 325

Query: 172 AINERVLRPALVSISKGKTQNP 193
            I ERVLR A V +SKG   + 
Sbjct: 326 KIKERVLRAAKVGVSKGAPNSA 347


>gi|242062294|ref|XP_002452436.1| hypothetical protein SORBIDRAFT_04g025770 [Sorghum bicolor]
 gi|241932267|gb|EES05412.1| hypothetical protein SORBIDRAFT_04g025770 [Sorghum bicolor]
          Length = 335

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 46/218 (21%), Positives = 89/218 (40%), Gaps = 15/218 (6%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E  +++      +  S   S   E+ S +N       +    R++ LR+ A+ +N R+RT
Sbjct: 113 EALINDDEAKAAEIESFLLSIEDEKNSLLNKITALNAELATQRERILRISADFDNFRKRT 172

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           + EK +       +     L V DN  RA     ++    E         +    +   +
Sbjct: 173 ENEKLNMMENVQGELIESFLPVLDNFERAKMQIKVETEGEE--------KINNSYQSIYK 224

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           + +  L   GV+ ++   + F+P +H+A+  E         I++  + G+ + ER+LRPA
Sbjct: 225 QFIEILNSLGVEDVETVGKPFDPMLHEAIMREDSSEYEEGIILQEFRKGFKLGERLLRPA 284

Query: 182 LVSISKGKTQNPTEEKKETIEQPSPLDIEERNKTQTKN 219
           +V +S G          E    P P    + + T  ++
Sbjct: 285 MVKVSAGPGP-------EVSAGPGPEVSRDDDPTVVED 315


>gi|229592653|ref|YP_002874772.1| heat shock protein GrpE [Pseudomonas fluorescens SBW25]
 gi|259647655|sp|C3K276|GRPE_PSEFS RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|229364519|emb|CAY52374.1| protein GrpE (HSP-70 cofactor) [Pseudomonas fluorescens SBW25]
          Length = 186

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 58/197 (29%), Positives = 106/197 (53%), Gaps = 12/197 (6%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           M+++     + P   ++   E  + + + EE   Q    +D+ LRV A+++N+RRR +++
Sbjct: 1   MADEQTQDTQTPDANSAVGDELATRVQVLEE---QLAAAQDQSLRVAADLQNVRRRAEQD 57

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
            + A  +++ KFA D+L + D+L R L+ +  D        +  ++ + EGIE+T +   
Sbjct: 58  VEKAHKFALEKFASDLLPIIDSLERGLELSNPD--------DENIRPMREGIELTLKMFQ 109

Query: 125 STLERYGVKKIDAKD-QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
            TL+RY ++ ID    + FN   HQAM  +    +  N+++KV Q GY +N R+LRPA+V
Sbjct: 110 DTLKRYQLEAIDPVGGEPFNAEHHQAMAMQESHDLEPNSVLKVFQKGYQLNGRLLRPAMV 169

Query: 184 SISKGKTQNPTEEKKET 200
            +SK          ++ 
Sbjct: 170 VVSKAPAPVSPSIDEQA 186


>gi|328858918|gb|EGG08029.1| hypothetical protein MELLADRAFT_85253 [Melampsora larici-populina
           98AG31]
          Length = 239

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 59/198 (29%), Positives = 96/198 (48%), Gaps = 11/198 (5%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E+  + +        +  ++  A +        +   Q  E++D Y+R  A+ ENL++ +
Sbjct: 40  ESQNASETPLPASENTTTSNPEASQPKSDEQLAKKDAQIAEYKDLYIRARADYENLQKIS 99

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSE-----------SVLK 110
            REK  A+ Y+I  FA+D++S  D L  ALDS P D        E             L 
Sbjct: 100 TREKSQAKDYAIQSFAKDLVSNIDVLKLALDSVPEDFRKQPGSEEAGTSSNQTDSRKHLA 159

Query: 111 SLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDG 170
            L  G+  T+  +  TL R+GV   D   +KF+PN H+AMF+ P      N+++   + G
Sbjct: 160 DLWTGVSSTKTLLEKTLSRFGVTPFDPTGEKFDPNKHEAMFQAPVPGKDPNSVLSCSKVG 219

Query: 171 YAINERVLRPALVSISKG 188
           + + +RVLRPA V + +G
Sbjct: 220 WMLRDRVLRPAQVGVVQG 237


>gi|315121867|ref|YP_004062356.1| heat shock protein [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495269|gb|ADR51868.1| heat shock protein [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 212

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 140/212 (66%), Positives = 172/212 (81%), Gaps = 7/212 (3%)

Query: 11  DKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQS 70
           +KE N SN N  + EEK   N  EE+  ++EEFR+KYLRV+A+MEN+RRRTDRE +DAQS
Sbjct: 3   EKENNHSNTNEDSVEEKINNNPLEEAQAKAEEFREKYLRVLADMENIRRRTDREIQDAQS 62

Query: 71  YSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERY 130
           YSIA FARDMLSVSDNLSRAL+S P+D   +    +S +KSLI+GIEMTRREMMSTLE+Y
Sbjct: 63  YSIAAFARDMLSVSDNLSRALNSVPIDKTQNS---DSEIKSLIDGIEMTRREMMSTLEKY 119

Query: 131 GVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           GVKKIDAK+QKFNPN+HQAMFEE ++T+P+NT+IKVVQDGYAI ER+LRPALV ISKGK 
Sbjct: 120 GVKKIDAKNQKFNPNIHQAMFEESNETIPSNTVIKVVQDGYAIGERILRPALVGISKGKN 179

Query: 191 QNPTE----EKKETIEQPSPLDIEERNKTQTK 218
           +NP E    ++ E  E+ S ++ EE N+TQTK
Sbjct: 180 KNPVEQIPSQENENKEKSSTINKEENNETQTK 211


>gi|53803854|ref|YP_114294.1| GrpE protein [Methylococcus capsulatus str. Bath]
 gi|81681775|sp|Q607A4|GRPE_METCA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|53757615|gb|AAU91906.1| GrpE protein [Methylococcus capsulatus str. Bath]
          Length = 185

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 59/165 (35%), Positives = 94/165 (56%), Gaps = 8/165 (4%)

Query: 22  STAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDML 81
             A          E+  Q+ E  D+++R  AEMENLRRR +++ ++A  Y++ KFA+++L
Sbjct: 27  EAAPAGEPDKALLEAQQQASENWDRFVRAQAEMENLRRRLEKDIQNAHKYALEKFAKELL 86

Query: 82  SVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQK 141
            V D+L   + ++  D           +  L EG E+T ++  S  E++G+  +D   +K
Sbjct: 87  PVMDSLELGIAASTGD--------APDVAKLREGAELTLKQFKSVFEKFGIAVVDPLGEK 138

Query: 142 FNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           FNP  HQAM  EP      NT++KV Q GY +N+R+LRPALV ++
Sbjct: 139 FNPEQHQAMAMEPAGEAEPNTVVKVFQKGYLLNDRLLRPALVVVA 183


>gi|312963099|ref|ZP_07777584.1| Protein grpE [Pseudomonas fluorescens WH6]
 gi|311282610|gb|EFQ61206.1| Protein grpE [Pseudomonas fluorescens WH6]
          Length = 186

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 57/197 (28%), Positives = 107/197 (54%), Gaps = 12/197 (6%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           M+++     + P    ++  E  + + + EE   Q    +D+ LRV A+++N+RRR +++
Sbjct: 1   MADEQTQDTQTPEANQAAGDELATRVQVLEE---QLAAAQDQSLRVAADLQNVRRRAEQD 57

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
            + A  +++ KFA D+L + D+L R L+ +  D        +  ++ + EGIE+T +   
Sbjct: 58  VEKAHKFALEKFANDLLPIIDSLERGLELSNPD--------DENIRPMREGIELTLKMFQ 109

Query: 125 STLERYGVKKIDAKD-QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
            TL+RY ++ ID +  + FN   HQAM  +    +  N+++KV Q GY ++ R+LRPA+V
Sbjct: 110 DTLKRYQLETIDPQGGEPFNAEHHQAMAMQESHDLEPNSVLKVFQKGYLLHGRLLRPAMV 169

Query: 184 SISKGKTQNPTEEKKET 200
            +SK          ++ 
Sbjct: 170 VVSKAPAPVAPSIDEQA 186


>gi|18418410|ref|NP_568356.1| EMB1241 (embryo defective 1241); adenyl-nucleotide exchange factor/
           chaperone binding / protein binding / protein
           homodimerization [Arabidopsis thaliana]
 gi|13878047|gb|AAK44101.1|AF370286_1 putative chloroplast GrpE protein [Arabidopsis thaliana]
 gi|17104679|gb|AAL34228.1| putative chloroplast GrpE protein [Arabidopsis thaliana]
 gi|332005075|gb|AED92458.1| molecular chaperone GrpE [Arabidopsis thaliana]
          Length = 324

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 42/205 (20%), Positives = 89/205 (43%), Gaps = 9/205 (4%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEK-SEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
             +++ N  K      +  S  +EK    +      N+    RD+ +R+ A+ +N R+RT
Sbjct: 119 EALADNNEGKIAEIEASLKSIEDEKFLLADKVASLSNELSVERDRLIRISADFDNFRKRT 178

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           +RE+ +  S +  +   ++L+V DN  RA     ++    E         +    +   +
Sbjct: 179 ERERLNLVSNAQGEVVENLLAVLDNFERAKSQIKVETEGEE--------KVTNSYQSIYK 230

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           + +  L   GV  ++   ++F+P +H+A+  E         +++  + G+ + ER+LRP+
Sbjct: 231 QFVEILGSLGVIHVETVGKQFDPMLHEAIMREDSAEYEEGIVLEEYRKGFLLGERLLRPS 290

Query: 182 LVSISKGKTQNPTEEKKETIEQPSP 206
           +V +S G       E +        
Sbjct: 291 MVKVSAGPGPEKPLEAEGEEATAQG 315


>gi|312213136|emb|CBX93218.1| similar to mitochondrial co-chaperone GrpE [Leptosphaeria maculans]
          Length = 237

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 62/189 (32%), Positives = 103/189 (54%), Gaps = 5/189 (2%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E    ++    EK     +++  E        E+   +  E +DKYLR +A+  NL+ RT
Sbjct: 51  EAAEKKEGETAEKKEDAPSAANDEAAKLKEQIEKKDKEIIELKDKYLRSVADFRNLQERT 110

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
            RE K A+ ++I +FARD++   DNL RAL + P +   S+    + L +L +GI+MT  
Sbjct: 111 ARETKAAKDFAIQRFARDLVESVDNLDRALGTVPAEKLKSD---NADLIALHDGIKMTDT 167

Query: 122 EMMSTLERYGVKKIDA--KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
            +++TL+++G+++ D      KF+PN+H+A+F+ P             Q G+ +N RVLR
Sbjct: 168 ILINTLKKHGLERFDPSETGDKFDPNIHEAVFQAPQPDKEDGCCFHTQQKGFMLNGRVLR 227

Query: 180 PALVSISKG 188
           PA V + K 
Sbjct: 228 PAKVGVVKN 236


>gi|307176632|gb|EFN66100.1| GrpE protein-like protein, mitochondrial [Camponotus floridanus]
          Length = 234

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 62/191 (32%), Positives = 107/191 (56%), Gaps = 8/191 (4%)

Query: 3   TFMSEKNIDKEKNPS-NANSSTAEEKSEINIPEESLNQSEE----FRDKYLRVIAEMENL 57
           T   EK  D    P      +T + K+E+ +  + L + +E      DKY R +AE EN+
Sbjct: 47  TITEEKKPDAANVPPRVEQEATEKIKTELELINKELAELKESKDVLEDKYKRALAEGENI 106

Query: 58  RRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIE 117
           R R  ++  DA+ + I  F +D+L V+D L +A +S P      +      LKSL EG+ 
Sbjct: 107 RIRLTKQIHDAKLFGIQGFCKDLLDVADILGKATESVPKAELTEK---NPHLKSLYEGLI 163

Query: 118 MTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERV 177
           MT  ++    +++G+  ++  ++KF+PN H+A+F++  +     TI+ V + GY ++ER+
Sbjct: 164 MTEAQLHKVFKKHGLISLNPINEKFDPNEHEALFQQEVEGKEPGTIVVVSKIGYKLHERI 223

Query: 178 LRPALVSISKG 188
           +RPALV ++KG
Sbjct: 224 VRPALVGVAKG 234


>gi|221481522|gb|EEE19908.1| co-chaperone GrpE, putative [Toxoplasma gondii GT1]
          Length = 347

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 54/202 (26%), Positives = 100/202 (49%), Gaps = 12/202 (5%)

Query: 4   FMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDR 63
             +++   + +      +   + +  +   E    ++ E +DK LR  A+MEN R R  +
Sbjct: 146 ESADREQPENEEGEMETALEDKYRQCVEEVESLKKKNRELQDKALRAFADMENARMRHQK 205

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESV------------LKS 111
           E    + Y+++ FA+ ML V+D ++ A +S    +                      L+ 
Sbjct: 206 EMASLKDYAVSDFAKAMLEVADAMAYATNSLKEAVQTDALIGPEENGDLDVATLKARLQQ 265

Query: 112 LIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGY 171
           + +G+++T   +  TL+R+GV++ + + +KFNP +H+A+FE  H       + +V+Q GY
Sbjct: 266 IYDGVKLTENLLHKTLDRFGVEQYNPEGEKFNPALHEALFELEHPEKAKGEVAQVIQRGY 325

Query: 172 AINERVLRPALVSISKGKTQNP 193
            I ERVLR A V +SKG   + 
Sbjct: 326 KIKERVLRAAKVGVSKGAPNSA 347


>gi|83945051|ref|ZP_00957417.1| hypothetical protein OA2633_10489 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851833|gb|EAP89688.1| hypothetical protein OA2633_10489 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 205

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 74/200 (37%), Positives = 113/200 (56%), Gaps = 10/200 (5%)

Query: 5   MSEKNIDKEKNPSNANSSTAEE-----KSEINIPEESLNQSEEFRDKYLRVIAEMENLRR 59
           MS +N   E   ++ N+  A+       +  +   +   ++ + RD+ LR +AEMEN ++
Sbjct: 1   MSNENQTPETEDADLNAEEAQAAEVEQDAPASDEADPAAEAAKLRDQLLRALAEMENTKK 60

Query: 60  RTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMT 119
           R +RE KD ++Y+++ FARDML V+DNLSRAL S   +           L++L+EG+EMT
Sbjct: 61  RAEREVKDTRAYAVSGFARDMLDVADNLSRALSSISDEAKAQAG---EALQTLLEGVEMT 117

Query: 120 RREMMSTLERYGVKKIDA-KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVL 178
            R + STLER+GVKK++       +PN+HQA  + P    P   I  V+Q GY I +R L
Sbjct: 118 ERRLHSTLERHGVKKVEPAPGDPLDPNLHQAAAQIP-ADQPKGAIAHVMQPGYKIGDRTL 176

Query: 179 RPALVSISKGKTQNPTEEKK 198
           R A+V +S G    P    +
Sbjct: 177 RAAMVVVSAGPAAPPESGGE 196


>gi|304392744|ref|ZP_07374684.1| co-chaperone GrpE [Ahrensia sp. R2A130]
 gi|303295374|gb|EFL89734.1| co-chaperone GrpE [Ahrensia sp. R2A130]
          Length = 232

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 79/202 (39%), Positives = 126/202 (62%), Gaps = 6/202 (2%)

Query: 9   NIDKEKNPS---NANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
           N ++E NP+      +   + +  ++I ++   ++EE +D+ LR +AEM+NLR+RT RE 
Sbjct: 34  NAEEEANPTPRRERAADPNDPEQILSILDKLKAENEELKDRTLRTVAEMDNLRKRTAREI 93

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
            +A+SY++A FARD+L V DNL RA+ + P D  +S        K+LIEG+E+T RE++ 
Sbjct: 94  TEARSYAVANFARDLLGVGDNLQRAIQAVPDDKRDS---GSDEFKALIEGVELTERELLK 150

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
            +    ++K D   +KF+PN HQAMFE P+  +P N++ +VVQ+GY I ERVLR A+V +
Sbjct: 151 AMNNAKIEKFDPTGEKFDPNFHQAMFEIPNPELPNNSVAQVVQEGYRIGERVLRAAMVGV 210

Query: 186 SKGKTQNPTEEKKETIEQPSPL 207
           +KG  +     + E +E     
Sbjct: 211 AKGGPKFEDVVQPEPVETQEGE 232


>gi|11344585|dbj|BAB18515.1| GrpE [Aphis gossypii]
          Length = 222

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 59/186 (31%), Positives = 105/186 (56%), Gaps = 3/186 (1%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
           S+   D  K P   +    + ++ +   E+ L +++   DK  R +AE EN+R+RT +E 
Sbjct: 40  SDAAADNAKEPLKESKEKIDIEALVKQNEDLLEENKNLTDKVRRYLAETENIRKRTIKET 99

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
            DA+ Y+I  F +D+L V+D+LS+A +  P +  +        LK L EG+  T  ++ +
Sbjct: 100 ADAKIYAIQGFCKDLLDVADSLSKATECVPKEEVSDS---NPHLKHLYEGLVTTESQLQT 156

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
             +R+G+  I+  ++KF+PN H+A+FE+  +      ++ V Q GY +++R++R A V I
Sbjct: 157 IFQRHGLMSINPLNEKFDPNSHKALFEQVVEGKEGGIVVVVSQIGYKLHDRIVRAAAVGI 216

Query: 186 SKGKTQ 191
           SK   Q
Sbjct: 217 SKDPNQ 222


>gi|30686476|ref|NP_850840.1| EMB1241 (embryo defective 1241); adenyl-nucleotide exchange factor/
           chaperone binding / protein binding / protein
           homodimerization [Arabidopsis thaliana]
 gi|4583546|emb|CAB40381.1| GrpE protein [Arabidopsis thaliana]
 gi|9759048|dbj|BAB09570.1| GrpE protein [Arabidopsis thaliana]
 gi|332005076|gb|AED92459.1| molecular chaperone GrpE [Arabidopsis thaliana]
          Length = 326

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 42/205 (20%), Positives = 89/205 (43%), Gaps = 9/205 (4%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEK-SEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
             +++ N  K      +  S  +EK    +      N+    RD+ +R+ A+ +N R+RT
Sbjct: 121 EALADNNEGKIAEIEASLKSIEDEKFLLADKVASLSNELSVERDRLIRISADFDNFRKRT 180

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           +RE+ +  S +  +   ++L+V DN  RA     ++    E         +    +   +
Sbjct: 181 ERERLNLVSNAQGEVVENLLAVLDNFERAKSQIKVETEGEE--------KVTNSYQSIYK 232

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           + +  L   GV  ++   ++F+P +H+A+  E         +++  + G+ + ER+LRP+
Sbjct: 233 QFVEILGSLGVIHVETVGKQFDPMLHEAIMREDSAEYEEGIVLEEYRKGFLLGERLLRPS 292

Query: 182 LVSISKGKTQNPTEEKKETIEQPSP 206
           +V +S G       E +        
Sbjct: 293 MVKVSAGPGPEKPLEAEGEEATAQG 317


>gi|195999908|ref|XP_002109822.1| hypothetical protein TRIADDRAFT_21754 [Trichoplax adhaerens]
 gi|190587946|gb|EDV27988.1| hypothetical protein TRIADDRAFT_21754 [Trichoplax adhaerens]
          Length = 191

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 57/182 (31%), Positives = 100/182 (54%), Gaps = 1/182 (0%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
             +          SS  +         +   +  E RDKYLR +AE+EN+R RT R+  D
Sbjct: 11  TKLTNTSTNPEDQSSKKDSAEADANIAQIQEELRETRDKYLRTLAEIENMRERTVRQIND 70

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A+ Y+I  F++D+++V+D L +A +S P     +   +    KSL EG+++T  ++    
Sbjct: 71  AKMYAIQNFSKDIIAVADILEKATESVPQ-QEIASAAANQHFKSLYEGLKLTESQLQKVF 129

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
             +G++KI   ++KF+PN H+A+F+  +   P  +I +V + GY ++ R LRPA+V ++K
Sbjct: 130 SAHGLRKIYPINEKFDPNFHEALFQVENGEKPDGSIAQVSKAGYLLHGRTLRPAMVGVTK 189

Query: 188 GK 189
             
Sbjct: 190 AP 191


>gi|237809002|ref|YP_002893442.1| heat shock protein GrpE [Tolumonas auensis DSM 9187]
 gi|237501263|gb|ACQ93856.1| GrpE protein [Tolumonas auensis DSM 9187]
          Length = 197

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 62/196 (31%), Positives = 101/196 (51%), Gaps = 11/196 (5%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEK---SEINIPEESLNQSEEFRDKYLRVIAEMENLR 58
           E    E     ++          +           E++ + + E +D+ LR +AEMENLR
Sbjct: 9   EPINQETQTADQQETVAIEGVAIDSAYVVELEQKLEQASSIAAEEKDRALRTVAEMENLR 68

Query: 59  RRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEM 118
           RRT  + + A  +++ KF  ++L V DNL R +  A              +K L+EG+E+
Sbjct: 69  RRTALDVEKAHKFALEKFVTELLPVLDNLERTIQVADK--------QNDAVKPLLEGVEL 120

Query: 119 TRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVL 178
           T + M +++ ++GV  +D + Q F+PN HQAM    +  V  NT+I V+Q GY +N RV+
Sbjct: 121 TLKSMANSVAKFGVIALDPQGQAFDPNQHQAMSMIENGDVAPNTVIAVMQKGYELNGRVI 180

Query: 179 RPALVSISKGKTQNPT 194
           RPA+V +SK    +  
Sbjct: 181 RPAMVMVSKAPAASAE 196


>gi|308800618|ref|XP_003075090.1| Molecular chaperone of the GrpE family (ISS) [Ostreococcus tauri]
 gi|116061644|emb|CAL52362.1| Molecular chaperone of the GrpE family (ISS) [Ostreococcus tauri]
          Length = 420

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 56/158 (35%), Positives = 95/158 (60%), Gaps = 4/158 (2%)

Query: 32  IPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRAL 91
             EE      + +D+ LR +AEMENLR RT R+ +DA+ +++  F +D+L V+DNL RA+
Sbjct: 261 ELEEKDAAVADLKDRILRTMAEMENLRERTRRQAEDAKKFAVQGFCKDLLDVADNLDRAI 320

Query: 92  DSAPLDL-ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM 150
            + P +      +K ++ LKS  EG+ +T +++ ST  ++GV K + + ++F+ N+H A+
Sbjct: 321 STVPEEEIETDVEKIKAKLKSFREGVVLTEKQLSSTFNKHGVAKFNPEGEEFDANLHMAL 380

Query: 151 FEEPHD---TVPANTIIKVVQDGYAINERVLRPALVSI 185
           F  P        A T+  V + GY ++ERV+R A V +
Sbjct: 381 FNVPIPEGSDAKAGTVAAVTKTGYTLHERVIRAAEVGV 418


>gi|15599956|ref|NP_253450.1| heat shock protein GrpE [Pseudomonas aeruginosa PAO1]
 gi|107103859|ref|ZP_01367777.1| hypothetical protein PaerPA_01004930 [Pseudomonas aeruginosa PACS2]
 gi|116052909|ref|YP_793226.1| heat shock protein GrpE [Pseudomonas aeruginosa UCBPP-PA14]
 gi|254238503|ref|ZP_04931826.1| heat shock protein GrpE [Pseudomonas aeruginosa C3719]
 gi|254244337|ref|ZP_04937659.1| heat shock protein GrpE [Pseudomonas aeruginosa 2192]
 gi|296391589|ref|ZP_06881064.1| heat shock protein GrpE [Pseudomonas aeruginosa PAb1]
 gi|313109743|ref|ZP_07795683.1| heat shock protein GrpE [Pseudomonas aeruginosa 39016]
 gi|52782978|sp|Q9HV42|GRPE_PSEAE RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|122257080|sp|Q02FR0|GRPE_PSEAB RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|9951026|gb|AAG08148.1|AE004890_1 heat shock protein GrpE [Pseudomonas aeruginosa PAO1]
 gi|115588130|gb|ABJ14145.1| heat shock protein GrpE [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126170434|gb|EAZ55945.1| heat shock protein GrpE [Pseudomonas aeruginosa C3719]
 gi|126197715|gb|EAZ61778.1| heat shock protein GrpE [Pseudomonas aeruginosa 2192]
 gi|310882185|gb|EFQ40779.1| heat shock protein GrpE [Pseudomonas aeruginosa 39016]
          Length = 186

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 54/192 (28%), Positives = 102/192 (53%), Gaps = 8/192 (4%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           +  +  +       T   +      +E   Q    +D+ LR++A+++N+RRR +++ + A
Sbjct: 3   DEQQTLDQQTPEQPTGAAEDLTARVQELEEQLAAAQDQALRMVADLQNVRRRAEQDVEKA 62

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
             +++ KFA D+L+V D L R L+ +          ++  +K + EG+E+T +    TL 
Sbjct: 63  HKFALEKFAGDLLAVVDTLERGLEMSD--------PNDEAIKPMREGMELTLKMFDDTLR 114

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           RY V+ ++ + + FNP  HQAM  +   +    +++KV Q GY +N R+LRPA+V +SK 
Sbjct: 115 RYQVEALNPEGEPFNPEQHQAMAMQESASAEPGSVLKVFQKGYLLNGRLLRPAMVVVSKA 174

Query: 189 KTQNPTEEKKET 200
             + P    ++ 
Sbjct: 175 PAETPPSIDEQA 186


>gi|326428454|gb|EGD74024.1| hypothetical protein PTSG_05721 [Salpingoeca sp. ATCC 50818]
          Length = 263

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 57/175 (32%), Positives = 97/175 (55%), Gaps = 3/175 (1%)

Query: 16  PSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAK 75
              A+ +           + +  ++++ ++KYLR +AEMEN+R R   + +DA+ Y I K
Sbjct: 91  QDAASEADPHVTELEQQLKTAQEEAKDLKEKYLRALAEMENVRERARHQVEDAKHYGIQK 150

Query: 76  FARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI 135
           FA+DML ++D L  ALD+ P D    E      L+ L +G++ T + + +  ER+ +  +
Sbjct: 151 FAKDMLEIADVLQLALDNVPQD--AKEHGDAQALRDLNDGLQTTNKLLHNIFERHQLHLL 208

Query: 136 DAKDQKFNPNMHQAMFEEPH-DTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
           +   +KF+PN H A+FE P  D   + T+  V + GY++N R +RPA V +   K
Sbjct: 209 NPVGEKFDPNHHDALFEVPPSDDATSGTVAVVTKAGYSLNGRTIRPAQVGVVAKK 263


>gi|312375535|gb|EFR22892.1| hypothetical protein AND_14051 [Anopheles darlingi]
          Length = 160

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 56/162 (34%), Positives = 99/162 (61%), Gaps = 3/162 (1%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
           +       E   + +   DKY R +AE EN+RRR  ++ +DA+ + I  F +D+L V+D 
Sbjct: 2   EELRKEATELTEKVKTLDDKYKRALAESENIRRRLTKQIEDAKQFGIQGFCKDLLEVADI 61

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNM 146
           L  A ++ P +  +        LK+L EG+ MTR ++ S   R+G++ ++  ++KFNPN+
Sbjct: 62  LGHATEAVPKEEVSD---RNPHLKNLFEGLSMTRAQLNSVFRRHGLEPVNPLNEKFNPNL 118

Query: 147 HQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           H+A+F++  + V  NT++ V + GY +++R +RPALV ++KG
Sbjct: 119 HEALFQQEVENVEPNTVVVVSKIGYKLHDRCIRPALVGVAKG 160


>gi|113952817|ref|YP_729261.1| heat shock protein GrpE [Synechococcus sp. CC9311]
 gi|113880168|gb|ABI45126.1| co-chaperone GrpE [Synechococcus sp. CC9311]
          Length = 269

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 44/201 (21%), Positives = 90/201 (44%), Gaps = 8/201 (3%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           ET  +  +    +   +A  + A  +           + E    +Y+R+ A+ +N R+R 
Sbjct: 56  ETPAAASSDSASEGVPSAQDNEARLEQLEREHSTLRQEHETLSAQYVRIAADFDNFRKRQ 115

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
            R++ D +         ++L V DN  RA                   +SL    +   +
Sbjct: 116 SRDQDDLKLQITCSTLTEILPVVDNFERARQQLD--------PQGEEAQSLHRSYQGLYK 167

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           +++  L++ GV  +    Q+F+P++H+A+  EP +  P + +++ +Q GY ++ +VLR A
Sbjct: 168 QLVDVLKQLGVAPMRVVGQEFDPSLHEAVLREPSNEHPEDVVVEELQRGYHLSGKVLRHA 227

Query: 182 LVSISKGKTQNPTEEKKETIE 202
           LV +S G     ++   +  E
Sbjct: 228 LVKVSMGPGPQQSDAAVQATE 248


>gi|297737494|emb|CBI26695.3| unnamed protein product [Vitis vinifera]
          Length = 298

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 63/197 (31%), Positives = 112/197 (56%), Gaps = 9/197 (4%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLN----QSEEFRDKYLRVIAEMENLRRRTDR 63
           K    E++ S A+ S  +    +   EE L     + E+ +DK LR  AEMEN+  R  R
Sbjct: 101 KTNQAEESDSEADLSMDDLMKLVLEKEELLKMKNKEIEKMQDKVLRSYAEMENVMERARR 160

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPL-----DLANSEKKSESVLKSLIEGIEM 118
           E ++++ ++I  FA+ +L V+DNL RA           D +     +  +LK+L+EG+EM
Sbjct: 161 EAENSKKFAIQNFAKSLLDVADNLGRASLVVKESFSKIDESKDTAGAVPLLKTLLEGVEM 220

Query: 119 TRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVL 178
           T +++     ++G++K D  +++F+P+ H A F+ P  + P+ T+  V++ GY +++RV+
Sbjct: 221 TEKQLGEVFRKFGMEKFDPTNEQFDPHRHNAAFQIPDPSKPSGTVAVVLKAGYMLHDRVI 280

Query: 179 RPALVSISKGKTQNPTE 195
           RPA V +++    N TE
Sbjct: 281 RPAEVGVTQAVDNNETE 297


>gi|39942268|ref|XP_360671.1| hypothetical protein MGG_03214 [Magnaporthe oryzae 70-15]
 gi|145015794|gb|EDK00284.1| hypothetical protein MGG_03214 [Magnaporthe oryzae 70-15]
          Length = 252

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 57/173 (32%), Positives = 93/173 (53%), Gaps = 10/173 (5%)

Query: 26  EKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSD 85
           E +     +    ++ E++D+YLR +A+  NL+ R  RE K  + ++I KFARD++   D
Sbjct: 79  EVALKKELDTKTKEALEWKDRYLRSVADFRNLQDRQAREMKSTRDFAIQKFARDLVDSVD 138

Query: 86  NLSRALDSAPLDLANSEKKSESV----------LKSLIEGIEMTRREMMSTLERYGVKKI 135
           NL RAL   P D   +   +             L +L EG++MT   ++ST+ ++G+++ 
Sbjct: 139 NLERALAMVPADKIKAASDAAKDSETKPEFLQDLVNLYEGLKMTENILVSTVAKHGLERF 198

Query: 136 DAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           +   +KFNPN H+A F  P      NT+    Q G+ +N RV+RPA V + K 
Sbjct: 199 NPNGEKFNPNEHEATFMTPQPDKDDNTVFFTQQTGFKLNGRVIRPAKVGVVKN 251


>gi|281202874|gb|EFA77076.1| molecular chaperone [Polysphondylium pallidum PN500]
          Length = 232

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 55/186 (29%), Positives = 91/186 (48%), Gaps = 7/186 (3%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEE---SLNQSEEFRDKYLRVIAEMENLRRRTD 62
           S +N   E+ P+   +   +  +E  + E+      Q E+   + L   AE EN+RR   
Sbjct: 51  STENKAAEEKPATEQAEGEKSAAEPTLEEQIADLKKQLEDKHTQLLYTAAERENVRRWGK 110

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
            E   A+ +      +D+L V D L  AL     +   +       L +L EG++MT   
Sbjct: 111 EEVDKAKKFGAQSLTKDLLEVVDQLELALAQFTPEQLQA----NKELSNLYEGVKMTENL 166

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
            +  +   GV + D   +KF+PN+H A+F+ P  +  A TI  VV+ G+ +N+R++RPA 
Sbjct: 167 FLKVMGNNGVVRFDPIGEKFDPNVHHALFQVPDASCDAGTIKTVVKKGFKLNDRLVRPAQ 226

Query: 183 VSISKG 188
           V +SK 
Sbjct: 227 VGVSKK 232


>gi|283484355|gb|ADB23407.1| chloroplast CGE1 [Physcomitrella patens]
          Length = 315

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 39/207 (18%), Positives = 85/207 (41%), Gaps = 8/207 (3%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   ++         S   +   E  S        + +    +D+YLR+ A+ +N R+R+
Sbjct: 117 EAVAADDEGAISDVESQLEAIANERDSLGLKVNSLIEEISTNKDRYLRLNADFDNYRKRS 176

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           +R++         +    +L + DN  RA  S   +            + +    +   +
Sbjct: 177 ERDRLATAGNVRGEVIESLLPMVDNFERAKTSIKTETEAE--------QKIDXAYQGIYK 228

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           + +  ++  GV  ++   + F+PN+H+A+  E       + + +  + G+ I +R+LRPA
Sbjct: 229 QFVEIMKSLGVVAVETVGKPFDPNLHEAIMREDSTEFAEDVVSQEFRRGFRIGDRLLRPA 288

Query: 182 LVSISKGKTQNPTEEKKETIEQPSPLD 208
           +V +S G       +    IE+    +
Sbjct: 289 MVKVSSGPGPAAATDTDLPIEEALANE 315


>gi|152984079|ref|YP_001350804.1| heat shock protein GrpE [Pseudomonas aeruginosa PA7]
 gi|254799606|sp|A6VCL9|GRPE_PSEA7 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|150959237|gb|ABR81262.1| heat shock protein GrpE [Pseudomonas aeruginosa PA7]
          Length = 189

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 58/197 (29%), Positives = 102/197 (51%), Gaps = 8/197 (4%)

Query: 4   FMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDR 63
              E+    +        +    K      +E   Q    +D+ LR++A+++N+RRR ++
Sbjct: 1   MADEQQQTLDPQAPEQTDAPEAAKDLTARVQELEEQLAAAQDQSLRLVADLQNVRRRAEQ 60

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           + + A  +++ KFA D+L+V D L R L  +  D        +  ++ + EG+E+T +  
Sbjct: 61  DVEKAHKFALEKFAGDLLAVVDTLERGLQMSNPD--------DEAIRPMREGMELTLKMF 112

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
             TL RY V+ I+ + + FNP  HQAM  E   T    +++KV Q GY I+ R+LRPA+V
Sbjct: 113 DDTLRRYQVEAINPEGEPFNPEQHQAMVMEESATAEPGSVLKVFQKGYLISGRLLRPAMV 172

Query: 184 SISKGKTQNPTEEKKET 200
            +SK  ++ P    ++ 
Sbjct: 173 VVSKAPSETPPSIDEQA 189


>gi|330920035|ref|XP_003298864.1| hypothetical protein PTT_09692 [Pyrenophora teres f. teres 0-1]
 gi|311327765|gb|EFQ93051.1| hypothetical protein PTT_09692 [Pyrenophora teres f. teres 0-1]
          Length = 231

 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 60/168 (35%), Positives = 98/168 (58%), Gaps = 5/168 (2%)

Query: 23  TAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLS 82
            +E        E+   +  + +DKYLR +A+  NL+ RT RE K A+ ++I +FARD++ 
Sbjct: 66  NSEVTQLKEALEKKDKEIIDLKDKYLRSVADFRNLQERTQREIKAAKDFAIQRFARDLVE 125

Query: 83  VSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQ-- 140
             DNL RAL +   D   S+    + L +L +GI+MT   +++TL+++G+++ D  +Q  
Sbjct: 126 SVDNLDRALGTVSEDKLKSD---NTDLIALHDGIKMTDSILINTLKKHGLERFDPSEQAE 182

Query: 141 KFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           KF+PN+H+A+F+ P       T     Q G+ +N RVLRPA V + K 
Sbjct: 183 KFDPNVHEAVFQAPQPDKEDGTCFHTQQKGFRLNGRVLRPAKVGVVKN 230


>gi|298244655|ref|ZP_06968461.1| GrpE protein [Ktedonobacter racemifer DSM 44963]
 gi|297552136|gb|EFH86001.1| GrpE protein [Ktedonobacter racemifer DSM 44963]
          Length = 225

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 52/194 (26%), Positives = 96/194 (49%), Gaps = 9/194 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   S++   ++  P N      +  +      E+  Q+ E+     R+ A+  N +RR 
Sbjct: 38  EAVNSQQVQAQQAMPGNGGGIDTDVATLERELTEAQRQAGEYLSMTQRLQADFINYKRRV 97

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
            +E+ + +  + A+    +L V D+L RAL + P +LA              +GI++T R
Sbjct: 98  TQEQSEGRLQAQAQIIEHILPVLDDLGRALMAVPPELAQHPWA---------QGIQLTSR 148

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           +++S L++ GV++I    + FNP  H+A+ +EP   +P  T+ +V + GY   ERV+RPA
Sbjct: 149 QLISALQQLGVRQIGNPGELFNPQWHEALMKEPRPDLPEGTVAQVYRPGYVFGERVIRPA 208

Query: 182 LVSISKGKTQNPTE 195
            V+++         
Sbjct: 209 QVTVAGPAPSGEQN 222


>gi|58039286|ref|YP_191250.1| GrpE protein (HSP-70 cofactor) [Gluconobacter oxydans 621H]
 gi|58001700|gb|AAW60594.1| GrpE protein (HSP-70 cofactor) [Gluconobacter oxydans 621H]
          Length = 221

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 61/194 (31%), Positives = 102/194 (52%), Gaps = 4/194 (2%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           E +  +    +     T EE +     E    Q  E +D+++R  AE +N+R R  R+ +
Sbjct: 31  ETSGHETPGMNETGGETLEETTPEARIEALEAQVAELKDRWVRSEAESQNIRARAKRDIE 90

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
           DA+ Y+I KFARD++  ++NL R L S P      +      +  L EGIE T R  ++ 
Sbjct: 91  DARQYAIQKFARDVVEAAENLQRGLASLPAKTEGEDVL----ITKLREGIEGTERSFINI 146

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           LER+G+   D   + F+ N+HQAM E+P D  P+  +++     + +  R+L+PA+V ++
Sbjct: 147 LERHGITCEDPTGKPFDANLHQAMAEQPSDQHPSGHVMQSWTPAWLLKGRLLKPAMVVVA 206

Query: 187 KGKTQNPTEEKKET 200
           KG  Q   +   +T
Sbjct: 207 KGGAQAAPQGVDKT 220


>gi|124514674|gb|EAY56186.1| putative GrpE protein [Leptospirillum rubarum]
          Length = 189

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 53/187 (28%), Positives = 100/187 (53%), Gaps = 7/187 (3%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEE--FRDKYLRVIAEMENLRRRTDREK 65
           K  +  +  + A        S     EE+  + EE  +R+KY+R++A+ +N R+R  RE+
Sbjct: 5   KKPESFEEEAEAFQEDPAPPSPEGEVEEAAKEGEENPWREKYIRLLADFDNYRKRVAREQ 64

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
           ++++ ++     +  L + DNL RAL       +         LK+L +G+++T ++ + 
Sbjct: 65  EESRKFANESLLKAFLPILDNLERALFHFGKVSSP-----SPELKALADGVKLTEKQFLE 119

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
            LE+  V ++ A+   F+PN+H+AM   P +      I+ V Q GY +  R+LRPALV++
Sbjct: 120 LLEKNHVTRVPAQGSVFDPNVHEAMGFSPSEGFEEGAIVDVYQQGYMMQGRLLRPALVTV 179

Query: 186 SKGKTQN 192
           ++ K + 
Sbjct: 180 AQKKEEQ 186


>gi|254517094|ref|ZP_05129152.1| co-chaperone GrpE [gamma proteobacterium NOR5-3]
 gi|219674599|gb|EED30967.1| co-chaperone GrpE [gamma proteobacterium NOR5-3]
          Length = 207

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 52/170 (30%), Positives = 95/170 (55%), Gaps = 8/170 (4%)

Query: 23  TAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLS 82
           +  E S          + E+ RD+ LR  A+ +N +RR +++ + A+ +++ +F  ++L 
Sbjct: 46  SESELSVDAQLALLQEELEKARDQALRSQADAQNAQRRAEQDVEKARKFALERFCSELLP 105

Query: 83  VSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKF 142
           V DNL RAL++   D        +  LKS+ EG+E+T +  +  L ++ ++++D   + F
Sbjct: 106 VVDNLERALEAIDGD--------DPALKSITEGVELTLKSFVDALRKFQIEQLDPVGEPF 157

Query: 143 NPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQN 192
           +P  HQAM    +     NT++ V+Q GY +N R++RPA+V +SK  T  
Sbjct: 158 DPQHHQAMSMIENPDAEPNTVLAVMQKGYTLNGRLVRPAMVMVSKAPTAE 207


>gi|149634876|ref|XP_001508203.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus]
          Length = 195

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 45/180 (25%), Positives = 94/180 (52%), Gaps = 2/180 (1%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           ++    +   S+    +   ++  +   +   +  +  ++Y R +A+ EN+RRRT +  +
Sbjct: 13  DECSSDDPPTSDEPDPSLALQTLEHRAVKLEAEVRDLTERYQRALADSENVRRRTQKFVE 72

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
           DA+ + I  F +D++ V+D L +A DS   D A  ++K    L+ + EG+ +   ++ S 
Sbjct: 73  DAKLFGIQSFCKDLVEVADILEKASDSISRDAAPGDQKPT--LEKISEGLSLLEAKLQSV 130

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
             ++G++K+     K++P  H+ +   P + V   T+  V QDGY ++ R +R A V ++
Sbjct: 131 FAKHGLQKMAPIGGKYDPYDHEIICHVPAEGVQPGTVTLVTQDGYKLHGRTIRHAQVGVA 190


>gi|281346083|gb|EFB21667.1| hypothetical protein PANDA_015953 [Ailuropoda melanoleuca]
          Length = 209

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 54/185 (29%), Positives = 100/185 (54%), Gaps = 4/185 (2%)

Query: 4   FMSEKNIDKEKNPSNANSST-AEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
             + +N++++   +     T + EK  ++   +   Q +E  DKY R +A+ ENLR+R+ 
Sbjct: 26  KNNGQNLEEDVGQNEQKPDTPSPEKILMDEKVKLEEQLKETVDKYKRALADTENLRQRSQ 85

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           +  ++A+ Y I  F +D+L V+D L +A  S P +    +      LK+L EG+ MT  +
Sbjct: 86  KLVEEAKLYGIQGFCKDLLEVADILEKATQSVPKEEVKDD---NPHLKNLYEGLIMTEVQ 142

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           +     ++G+ +++    +F+P  H+A+F  P +     T+  V + GY ++ R LRPAL
Sbjct: 143 IQKVFTKHGLLRLNPVGARFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPAL 202

Query: 183 VSISK 187
           V + K
Sbjct: 203 VGVVK 207


>gi|206602524|gb|EDZ39005.1| Putative GrpE protein [Leptospirillum sp. Group II '5-way CG']
          Length = 189

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 52/190 (27%), Positives = 100/190 (52%), Gaps = 7/190 (3%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEE--FRDKYLRVIAEMENLRRRTDREK 65
           K  +  +  + A        +     EE+  + EE  +R+KY+R++A+ +N R+R  RE+
Sbjct: 5   KKPESFEEEAEAFQEDPAPPTPEGDVEEAGKEGEENPWREKYIRLLADFDNYRKRMAREQ 64

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
           ++++ ++     +  L + DNL RAL       +         LK+L +G+++T ++ + 
Sbjct: 65  EESRKFANESLLKAFLPILDNLERALFHFGKVSSP-----SPELKALADGVKLTEKQFLE 119

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
            LE+  V ++ A+   F+PN+H+AM   P +      I+ V Q GY +  R+LRPALV++
Sbjct: 120 LLEKNHVTRVPAQGSVFDPNVHEAMGFSPSEGFEEGAIVDVYQQGYMMQGRLLRPALVTV 179

Query: 186 SKGKTQNPTE 195
           ++ K +    
Sbjct: 180 AQKKEEQSGS 189


>gi|260942283|ref|XP_002615440.1| hypothetical protein CLUG_04323 [Clavispora lusitaniae ATCC 42720]
 gi|238850730|gb|EEQ40194.1| hypothetical protein CLUG_04323 [Clavispora lusitaniae ATCC 42720]
          Length = 241

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 53/181 (29%), Positives = 91/181 (50%), Gaps = 4/181 (2%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +  +     +   +             +   +  + ++ Y R +A+  NL+  T +E + 
Sbjct: 62  QKSENGAEEAKQQAEDPVVAELREALSKKDKELADMKNHYARAVADFRNLQETTKKEMQK 121

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A+ +++ KFA+D+L   DN + AL+S   +   +       +K+L +G+ MT+     TL
Sbjct: 122 ARDFALQKFAKDLLESLDNFTLALNSVKEETLET----NEEVKNLFDGVSMTKNVFEKTL 177

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            R+G++KI    + F+PN H+A FE P       TI  V Q GY +N+RVLRPA V + K
Sbjct: 178 ARHGIEKIHPMGEPFDPNQHEATFEIPQPDKEPGTIFHVQQPGYTLNKRVLRPAKVGLVK 237

Query: 188 G 188
           G
Sbjct: 238 G 238


>gi|302412933|ref|XP_003004299.1| grpE [Verticillium albo-atrum VaMs.102]
 gi|261356875|gb|EEY19303.1| grpE [Verticillium albo-atrum VaMs.102]
          Length = 247

 Score =  122 bits (307), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 63/190 (33%), Positives = 98/190 (51%), Gaps = 3/190 (1%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E         KE + +   S+  E  +     E    ++ +++DK LR +A+  NL+ RT
Sbjct: 57  EPDSKADAKAKEGDAAAPESANPELDALKKQLEAKEKEALDWKDKCLRSVADFRNLQDRT 116

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSES---VLKSLIEGIEM 118
            RE K A+ ++I KFA+D++   DNL RAL   P    +    +      L +L EG+ M
Sbjct: 117 TREMKSARDFAIQKFAKDLVDSIDNLDRALGMVPESKLSPAADASEAAKDLANLHEGLRM 176

Query: 119 TRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVL 178
           T   +M+TLE++G+++   +  KFNPN H+A F  P      NT+  V   G+ +N RVL
Sbjct: 177 TETVLMNTLEKHGLERFSPEADKFNPNEHEATFMTPQPGKEDNTVFHVQSKGFKLNGRVL 236

Query: 179 RPALVSISKG 188
           R A V + K 
Sbjct: 237 RAAKVGVVKN 246


>gi|258544376|ref|ZP_05704610.1| heat shock protein GrpE [Cardiobacterium hominis ATCC 15826]
 gi|258520380|gb|EEV89239.1| heat shock protein GrpE [Cardiobacterium hominis ATCC 15826]
          Length = 196

 Score =  122 bits (307), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 58/170 (34%), Positives = 89/170 (52%), Gaps = 4/170 (2%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
            +     E    Q  E ++  LR  A+ +NLR+R +REK+ A  Y   K  RD+L V D+
Sbjct: 31  DTREAEIEALTAQVAELKNAVLRERADQDNLRKRFEREKESALKYGSEKLVRDLLPVLDS 90

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNM 146
           L+  LD+A    A  +      L+  I G  MT + ++ TLE+ G+ +I+   +K +P  
Sbjct: 91  LTLGLDAAKAHEAEGK----QALEQFIAGSAMTLKLLLETLEKNGITEINPVGEKLDPER 146

Query: 147 HQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEE 196
           HQA+   P      NTI+ V Q GY +N RV+R A V ++ G  +NP + 
Sbjct: 147 HQALSAIPSPDAEPNTILHVAQKGYLLNGRVIRAAQVIVADGAQKNPPQS 196


>gi|332534004|ref|ZP_08409855.1| heat shock protein GrpE [Pseudoalteromonas haloplanktis ANT/505]
 gi|332036553|gb|EGI73020.1| heat shock protein GrpE [Pseudoalteromonas haloplanktis ANT/505]
          Length = 183

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 57/188 (30%), Positives = 104/188 (55%), Gaps = 8/188 (4%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           M+  +       +++     S  AE        E +     + +D  +R  A+++N+RRR
Sbjct: 1   MQADVEAAVEAADQHAEEEQSPEAEIAMLYAELEAAKQTIADQKDGVVRAAADVDNIRRR 60

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
             ++ + A  +++ KFA ++L V DNL RA++ +  +           LK L+EGI+MT 
Sbjct: 61  AAQDVEKAHKFALEKFANELLPVIDNLERAIEFSDKE--------NETLKPLLEGIDMTV 112

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           +     + ++GV+ ++ + ++FNP+ HQAM  +P + V  NT++ V+Q GY +N R+LRP
Sbjct: 113 KSFNDAVAKFGVEIVNPQGEQFNPDFHQAMSIQPSNDVTPNTVLAVMQKGYTLNGRLLRP 172

Query: 181 ALVSISKG 188
           A+V +SK 
Sbjct: 173 AMVMVSKA 180


>gi|328780331|ref|XP_624159.2| PREDICTED: grpE protein homolog, mitochondrial [Apis mellifera]
          Length = 237

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 58/187 (31%), Positives = 104/187 (55%), Gaps = 3/187 (1%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   SE      +   N     A+ +       +  N   +  DKY R +A+ ENLR R 
Sbjct: 54  EEQKSESGEPVLELTENERKLKADIELINKELMDLKNHKNDLEDKYKRALADGENLRVRL 113

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           +++ +DA+ + I  F +D+L V+D L +A +S P +    +      LK+L EG++MT  
Sbjct: 114 NKQIQDAKMFGIQGFCKDLLEVADILGKATESVPKNELTEK---NPHLKTLYEGLKMTEA 170

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           ++    +++G+  ++  ++KF+PN H+A+F++  +     TI+ V + GY ++ERV+RPA
Sbjct: 171 QLHKVFKKHGLVSLNPLNEKFDPNQHEALFQQEVEGKEPGTIVVVSKLGYKLHERVVRPA 230

Query: 182 LVSISKG 188
           LV ++KG
Sbjct: 231 LVGVAKG 237


>gi|297811925|ref|XP_002873846.1| EMB1241 [Arabidopsis lyrata subsp. lyrata]
 gi|297319683|gb|EFH50105.1| EMB1241 [Arabidopsis lyrata subsp. lyrata]
          Length = 326

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 42/200 (21%), Positives = 91/200 (45%), Gaps = 9/200 (4%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEI-NIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
             +++ N  K      +  S  +EK+ + +      N+    RD+ +R+ A+ +N R+RT
Sbjct: 121 EALADNNEGKIAEIEASLKSIEDEKNLLADKVASLSNELSVERDRLIRISADFDNFRKRT 180

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           +RE+ +  S +  +   ++L+V DN  RA     ++    E         +    +   +
Sbjct: 181 ERERLNLVSNAQGEVVENLLAVLDNFERAKSQIKVETEGEE--------KVTNSYQSIYK 232

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           + +  L   GV  ++   ++F+P +H+A+  E         +++  + G+ + ER+LRP+
Sbjct: 233 QFVEILGSLGVIHVETVGKQFDPMLHEAIMREDSAEYEEGIVLEEYRKGFLLGERLLRPS 292

Query: 182 LVSISKGKTQNPTEEKKETI 201
           +V +S G       E +   
Sbjct: 293 MVKVSAGPGPEKPREAEVEE 312


>gi|332559693|ref|ZP_08414015.1| putative chaperone protein GrpE (heat shock protein) [Rhodobacter
           sphaeroides WS8N]
 gi|332277405|gb|EGJ22720.1| putative chaperone protein GrpE (heat shock protein) [Rhodobacter
           sphaeroides WS8N]
          Length = 178

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 64/180 (35%), Positives = 104/180 (57%), Gaps = 8/180 (4%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
            D+        +    E  EI+  E    + +E RD+++R +A+ EN R+R DR++++A+
Sbjct: 3   EDQAPREETVEAPELTEAPEIDELETLRAERDELRDRFMRALADAENSRKRADRDRREAE 62

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
            Y   + ARD+L V DNLSRAL+ A  +         +   +LIEG+E+T RE+ + + +
Sbjct: 63  QYGGTRLARDLLPVYDNLSRALEVATDEQR-------AAAAALIEGVELTLRELRNVMNK 115

Query: 130 YGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           +GV+ I  +    F+P  HQAMFE P     A  II+V+ +G+ I++R+LRPA V +S  
Sbjct: 116 HGVRPITPQVGDTFDPQQHQAMFEAPVPGTKAGQIIQVMTEGFMIHDRLLRPAQVGVSSN 175


>gi|296123167|ref|YP_003630945.1| GrpE protein [Planctomyces limnophilus DSM 3776]
 gi|296015507|gb|ADG68746.1| GrpE protein [Planctomyces limnophilus DSM 3776]
          Length = 173

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 49/178 (27%), Positives = 92/178 (51%), Gaps = 8/178 (4%)

Query: 13  EKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYS 72
                    +T E  + +N+ +    + ++F++K+ R +A++EN RRR  +E ++ + Y 
Sbjct: 2   NTENPENTENTTESSTSVNMVQALAEERDQFKEKWARSVADLENYRRRVQKEAEEERKYG 61

Query: 73  IAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGV 132
            A F R +L   DNL RA+ +A            + L+ L++G+EM  ++  +     G 
Sbjct: 62  AATFLRTVLPGFDNLQRAILAAKS--------PAAKLEDLVKGVEMVSQQFETLFAGMGA 113

Query: 133 KKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
             I    + F+PN H+A+ + P    P  T+I+ V+ G+ +++RV+RPA V +S    
Sbjct: 114 VVIKTVGEPFDPNRHEAITQVPSADYPPMTVIQEVERGFTLHDRVIRPAKVIVSAASA 171


>gi|18416821|ref|NP_567757.1| AR192; adenyl-nucleotide exchange factor/ chaperone binding /
           protein binding / protein homodimerization [Arabidopsis
           thaliana]
 gi|21593024|gb|AAM64973.1| grpE like protein [Arabidopsis thaliana]
 gi|26451456|dbj|BAC42827.1| putative grpE protein [Arabidopsis thaliana]
 gi|29824143|gb|AAP04032.1| putative grpE protein [Arabidopsis thaliana]
 gi|332659851|gb|AEE85251.1| molecular chaperone GrpE [Arabidopsis thaliana]
          Length = 327

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 53/166 (31%), Positives = 99/166 (59%), Gaps = 5/166 (3%)

Query: 40  SEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPL--- 96
            ++ +DK LR  AEMEN+  RT R+ ++ + Y++  FA+ +L V+DNL RA         
Sbjct: 162 IKQLKDKVLRTYAEMENVMDRTRRDAENTKKYAVQNFAKSLLDVADNLGRASSVVKESFS 221

Query: 97  --DLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEP 154
             D +     +  +LK+L+EG+EMT +++    +++G++K D  ++ F+PN H A+F+ P
Sbjct: 222 KLDTSEDSAGAAPLLKTLLEGVEMTEKQLAEVFKKFGMEKYDPINEPFDPNRHNAVFQVP 281

Query: 155 HDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKET 200
             + P  T+  V++ GY + +RV+RPA V +++G      +++ + 
Sbjct: 282 DASKPEGTVAHVLKSGYTLYDRVIRPAEVGVTQGGENQEEKKESDA 327


>gi|218658828|ref|ZP_03514758.1| molecular chaperone heat shock protein [Rhizobium etli IE4771]
          Length = 150

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 80/152 (52%), Positives = 109/152 (71%), Gaps = 3/152 (1%)

Query: 54  MENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLI 113
           M+NLRRRT+RE KDA+SYS+A FARDML+VSDNL RALD+   +   +    ++ L +LI
Sbjct: 1   MDNLRRRTEREVKDAKSYSVAGFARDMLAVSDNLRRALDAISPEAKATA---DAGLTTLI 57

Query: 114 EGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAI 173
           EG+EMT R M+S LER+GV+K++   QKF+PN HQAMFE P+  VP NT+++VVQ G+ I
Sbjct: 58  EGVEMTERAMLSALERHGVRKLEPVGQKFDPNFHQAMFEVPNPEVPNNTVVQVVQAGFTI 117

Query: 174 NERVLRPALVSISKGKTQNPTEEKKETIEQPS 205
            ERVLRPA+V ++KG  +    E     ++  
Sbjct: 118 GERVLRPAMVGVAKGGPKPAEAETNSVFDEKD 149


>gi|146283646|ref|YP_001173799.1| heat shock protein GrpE [Pseudomonas stutzeri A1501]
 gi|166215281|sp|A4VPQ6|GRPE_PSEU5 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|145571851|gb|ABP80957.1| heat shock protein GrpE [Pseudomonas stutzeri A1501]
 gi|327482041|gb|AEA85351.1| heat shock protein GrpE [Pseudomonas stutzeri DSM 4166]
          Length = 189

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 60/197 (30%), Positives = 107/197 (54%), Gaps = 8/197 (4%)

Query: 4   FMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDR 63
              E+N+D +   +   S     +      +    Q    +D+ LRV AE++N+RRR ++
Sbjct: 1   MADEQNLDNQNPETPEQSQADVAEDLAARVQSLEEQLAAAQDQSLRVAAELQNIRRRAEQ 60

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           + + A  +++ KFA D+L+V+D+L R L+ +  D        +  +K + EG+E+T + +
Sbjct: 61  DVEKAHKFALEKFAGDLLAVADSLERGLELSNPD--------DEAVKPMREGVELTLKLL 112

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
           + TL R+ ++++D   + FNP  HQAM  E    V   +++KV Q GY +N R+LRPA+V
Sbjct: 113 LDTLARHQLEQLDPHGEPFNPEHHQAMAMEESTHVEPGSVLKVFQKGYLLNGRLLRPAMV 172

Query: 184 SISKGKTQNPTEEKKET 200
            +SK     P    ++ 
Sbjct: 173 VVSKAPADAPPSIDEKA 189


>gi|88857852|ref|ZP_01132494.1| Hsp 24 DnaK nucleotide exchange factor; probable member of the
           DnaK/DnaJ/GrpE foldase complex [Pseudoalteromonas
           tunicata D2]
 gi|88819469|gb|EAR29282.1| Hsp 24 DnaK nucleotide exchange factor; probable member of the
           DnaK/DnaJ/GrpE foldase complex [Pseudoalteromonas
           tunicata D2]
          Length = 194

 Score =  122 bits (306), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 59/192 (30%), Positives = 105/192 (54%), Gaps = 11/192 (5%)

Query: 2   ETFMSEKNIDKE---KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLR 58
           E  ++E+ +D+    +N     S  AE        E +     + +D  +R  AE++N+R
Sbjct: 11  EAELNEQTVDQHVDGENVEQELSPEAEIALLSAELEAANQTIADQKDSVIRAAAEVDNVR 70

Query: 59  RRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEM 118
           RR  ++ + A  +++ KF+ ++L V DNL RA++ A              L  L+EGI+M
Sbjct: 71  RRAAQDIEKAHKFALEKFSNELLPVIDNLERAIEFADKS--------NDALTPLLEGIDM 122

Query: 119 TRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVL 178
           T +  ++ + ++GV+ ++ + + FNP  HQAM  +P   V  NT++ V+Q GY ++ R+L
Sbjct: 123 TVKSFVTAVAKFGVEVVNPQGESFNPEYHQAMALQPSAEVEPNTVLAVMQKGYTLHGRLL 182

Query: 179 RPALVSISKGKT 190
           RPA+V +SK   
Sbjct: 183 RPAMVMVSKAAE 194


>gi|198414812|ref|XP_002123689.1| PREDICTED: similar to GrpE protein homolog 1, mitochondrial
           precursor (Mt-GrpE#1) (HMGE) [Ciona intestinalis]
          Length = 211

 Score =  122 bits (305), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 57/182 (31%), Positives = 101/182 (55%), Gaps = 3/182 (1%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
             +  +  +      EE  E+   E+ + +  E  DKY R +AE EN+R R  +E +DA+
Sbjct: 32  TTEATSKKDNGKPENEETPEVAASEQEIKKLNETIDKYQRSLAETENVRSRLRKEIEDAK 91

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
            + I  F +D+++V+D +  A+ S P +   +E  +  V KS  EG+ +T +E+    +R
Sbjct: 92  LFGIQAFCKDLITVADVMKMAVTSIPENELENE--TNKVWKSFYEGVCLTDKELHKVFDR 149

Query: 130 YGVKKIDA-KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           +G+K ++  +  KF+P  H+A+FE P DT+   ++  V + GY +  R LRPA V +S+ 
Sbjct: 150 HGLKLLEPEQGDKFDPYDHEALFEVPIDTLEPGSVAHVERIGYKLKGRTLRPAQVGVSRK 209

Query: 189 KT 190
            +
Sbjct: 210 AS 211


>gi|3851638|gb|AAC72386.1| chaperone GrpE type 1 [Nicotiana tabacum]
          Length = 299

 Score =  122 bits (305), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 55/200 (27%), Positives = 103/200 (51%), Gaps = 9/200 (4%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLN----QSEEFRDKYLRVIAEMENLRRRTDR 63
           ++   E +    + S  +    +   EE L     +  + +DK+LR  AEMEN+  RT R
Sbjct: 99  QDEKDESDIDAEDLSRDDLVKLVVEKEELLKMKDDEFRKLQDKFLRSYAEMENVMERTKR 158

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPL-----DLANSEKKSESVLKSLIEGIEM 118
           E ++++ ++I  F + +L V DNL RA           D +     +  +LK+L+EG+EM
Sbjct: 159 EAENSKKFAIQNFVKALLDVPDNLGRASSVVKESFSKIDASKDTVGAMPLLKTLLEGVEM 218

Query: 119 TRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVL 178
           T +++    +++GV+K D  +++F+PN H A+F+ P        I   ++ GY +++R++
Sbjct: 219 TDKQLAEVFKKFGVEKYDPTNEQFDPNKHNAVFQVPDPEKAPGVIAVCLKPGYTLHDRII 278

Query: 179 RPALVSISKGKTQNPTEEKK 198
           RPA V ++        +   
Sbjct: 279 RPAEVGVTVAVETEADQSTN 298


>gi|22298857|ref|NP_682104.1| heat shock protein [Thermosynechococcus elongatus BP-1]
 gi|52782942|sp|Q8DJB3|GRPE_THEEB RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|22295038|dbj|BAC08866.1| heat shock protein [Thermosynechococcus elongatus BP-1]
          Length = 252

 Score =  122 bits (305), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 48/201 (23%), Positives = 89/201 (44%), Gaps = 8/201 (3%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E    E++   E   +NA     +  +            EE   +Y+R+ A+ EN R+RT
Sbjct: 56  EATPGEEDQASEATSANAADLLEQIAALEAAKASLSQVVEERNSQYIRLAADFENFRKRT 115

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
            REK++ +         D+L V D+   A      +    E         +    +   +
Sbjct: 116 QREKEELELQIKCSVIADLLPVVDSFELARTHIQTETEAEE--------KIHRSYQGVYK 167

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           +++  L+R GV  + AK + F+PN+H+A+  E  +  P  T+I+ ++ GY + +RVLR A
Sbjct: 168 QLVECLKRIGVSAMQAKGKPFDPNLHEAVLREATNEHPEGTVIEELKRGYMLGDRVLRHA 227

Query: 182 LVSISKGKTQNPTEEKKETIE 202
           +V ++    +        T +
Sbjct: 228 MVKVAAPPEEGSASNTNPTND 248


>gi|300112992|ref|YP_003759567.1| GrpE protein [Nitrosococcus watsonii C-113]
 gi|299538929|gb|ADJ27246.1| GrpE protein [Nitrosococcus watsonii C-113]
          Length = 210

 Score =  122 bits (305), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 59/197 (29%), Positives = 107/197 (54%), Gaps = 8/197 (4%)

Query: 4   FMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDR 63
             S+   +  +    A   TAE ++   + E++ ++++E  ++ LR  AE+EN RRR +R
Sbjct: 22  VESQTQAEGGEQIQEAAPETAELEAVQQLLEDARSKADEHWNELLRARAELENQRRRHER 81

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           E    + Y++ KFA+D+L V D+L   L +A  +        ++ + +L EG E+  +  
Sbjct: 82  ELDKGRKYALEKFAQDLLPVKDSLEMGLAAAQAE--------DANVTALREGTELILKMF 133

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
              + R+G++ ID + + FNP+ HQA+  +       +T++ VV+ GYA+N R+LRPA+V
Sbjct: 134 NEVVARFGIETIDPQGEAFNPDFHQAISTQESSEAAPDTVLTVVRKGYALNGRLLRPAMV 193

Query: 184 SISKGKTQNPTEEKKET 200
            +SK   Q       + 
Sbjct: 194 VVSKPGEQTTAGVDTQA 210


>gi|332993770|gb|AEF03825.1| heat shock protein GrpE [Alteromonas sp. SN2]
          Length = 206

 Score =  122 bits (305), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 64/197 (32%), Positives = 110/197 (55%), Gaps = 9/197 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINI-PEESLNQSEEFRDKYLRVIAEMENLRRR 60
           ET    + I +E++   A S   +   E+     E+    +E +D  LR  A++EN RRR
Sbjct: 18  ETVQDAEVIQEEQSSPEAGSDATQRIYELETALSEAQATIKEQQDSVLRARADVENARRR 77

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
            + E + A+ +++ +FA ++L V DNL RA++    +           +K L+EG+EMT 
Sbjct: 78  AEMEVEKARKFALERFAGELLPVVDNLERAIELTDGE--------NEAVKPLLEGVEMTH 129

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           +  +ST+E++G+  ID + + FNP++HQAM  +       NT++ V+Q GY IN R+LRP
Sbjct: 130 KSFLSTIEKFGLSLIDPQGETFNPDLHQAMSMQESADHAPNTVMAVMQKGYQINGRLLRP 189

Query: 181 ALVSISKGKTQNPTEEK 197
           A+V +S+  +     + 
Sbjct: 190 AMVMVSRAPSGGVDTQA 206


>gi|224126029|ref|XP_002319738.1| predicted protein [Populus trichocarpa]
 gi|222858114|gb|EEE95661.1| predicted protein [Populus trichocarpa]
          Length = 342

 Score =  122 bits (305), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 43/218 (19%), Positives = 89/218 (40%), Gaps = 8/218 (3%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   S       +  +   S   E+            +    +++ LR+ A+ +N R+RT
Sbjct: 131 EALASNDESIIAEIEAFLKSVEDEKIDNERKVASLTEELSIEKERVLRISADFDNFRKRT 190

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           +RE+    + +  +   ++LSV DN  RA           E         +    +   +
Sbjct: 191 ERERLSLVTNAQGEVVENLLSVLDNFERAKTQIKTATEGEE--------KINNSYQNIYK 242

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           + M  L   GV  ++   + F+P +H+A+  E  D     T+++  + G+ + +R+LRP+
Sbjct: 243 QFMEILVSLGVVPVETIGKPFDPMLHEAIMREDSDAFEEGTVLEEYRKGFKLGDRLLRPS 302

Query: 182 LVSISKGKTQNPTEEKKETIEQPSPLDIEERNKTQTKN 219
           +V +S G      E+ +E+ E+           +  + 
Sbjct: 303 MVKVSAGPGPVKPEQVEESQEEAEATSGTSEGGSTEEE 340


>gi|255713786|ref|XP_002553175.1| KLTH0D10692p [Lachancea thermotolerans]
 gi|238934555|emb|CAR22737.1| KLTH0D10692p [Lachancea thermotolerans]
          Length = 238

 Score =  122 bits (305), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 54/190 (28%), Positives = 97/190 (51%), Gaps = 4/190 (2%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   + +   +E     A+    + +           ++ E++D+ LR +A+  NL+  T
Sbjct: 53  EAAENAEGAQEESPKGPASEEQKKVQELEEKLAVKDKEAAEYKDRLLRSVADFRNLQEVT 112

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
            ++ + A+ Y++ KFA+D+L   DN   AL++   +      +  + L  L  G++MT+ 
Sbjct: 113 KKDIQKAKDYALQKFAKDLLDSVDNFGHALNAFKPEST----QQSTELSELYTGVKMTKD 168

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
               TL+++G++KID   + F+PN H+A FE P+      T+  V Q G+ +N RV+RPA
Sbjct: 169 IFEKTLKKHGIEKIDPMGETFDPNRHEATFELPNPEKQPGTVFHVQQVGFTLNNRVIRPA 228

Query: 182 LVSISKGKTQ 191
            V I K    
Sbjct: 229 KVGIVKDPAN 238


>gi|33862294|ref|NP_893854.1| heat shock protein GrpE [Prochlorococcus marinus str. MIT 9313]
 gi|52782913|sp|Q7V9C9|GRPE_PROMM RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|33640407|emb|CAE20196.1| Heat shock protein GrpE [Prochlorococcus marinus str. MIT 9313]
          Length = 237

 Score =  122 bits (305), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 49/204 (24%), Positives = 91/204 (44%), Gaps = 14/204 (6%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEE----SLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
              E   S  ++  A+ ++ +   E+       + E  R +Y+R+ A+ +N R+R  R++
Sbjct: 30  NSDEGQSSAQSAPLADNEARLQQLEQEHSSLREEHETLRSQYMRIAADFDNFRKRQSRDQ 89

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
            D +   I     ++L V DN  RA                   ++L    +   ++++ 
Sbjct: 90  DDLRFQLICTTLSEILPVVDNFERARQQLE--------PQGEEAQALHRSYQGLYKQLVD 141

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
            L++ GV  +    Q F+P +H+A+  EP +  P + + + +Q GY +N RVLR ALV +
Sbjct: 142 VLKQMGVASMRVVGQVFDPTLHEAVSREPSEEHPEDVVTEELQRGYHLNGRVLRHALVKV 201

Query: 186 SKGKTQNPTEEKKETIEQPSPLDI 209
           S G    P      +  QP+    
Sbjct: 202 SMGPG--PQSGASPSSAQPNDDST 223


>gi|89052699|ref|YP_508150.1| GrpE protein [Jannaschia sp. CCS1]
 gi|88862248|gb|ABD53125.1| GrpE protein [Jannaschia sp. CCS1]
          Length = 188

 Score =  122 bits (305), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 58/185 (31%), Positives = 103/185 (55%), Gaps = 8/185 (4%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           E      ++ ++ + +  +      + E    + +E RD+ LR +AE EN+R+R DR+++
Sbjct: 10  EDQTADAQDKADVSLAPEDMSGTDAVIEALEAERDELRDRMLRAMAEAENMRKRADRDRR 69

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
           +A+ Y  +K +RD+L V DN+ RALD+A                 L+EG+E+T RE++S 
Sbjct: 70  EAEQYGGSKLSRDLLPVYDNMRRALDAADDATR-------EAASGLVEGVELTMRELISI 122

Query: 127 LERYGVKK-IDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
             ++G+   +    ++FN   H+AMFE P     A  II+V+ +G+ +++R+LRPA V +
Sbjct: 123 FGKHGIVPVVPEVGERFNAQEHEAMFEAPVPGTKAGDIIQVMSEGFLLHDRLLRPAQVGV 182

Query: 186 SKGKT 190
           S    
Sbjct: 183 SSTPA 187


>gi|251796217|ref|YP_003010948.1| GrpE protein [Paenibacillus sp. JDR-2]
 gi|247543843|gb|ACT00862.1| GrpE protein [Paenibacillus sp. JDR-2]
          Length = 179

 Score =  122 bits (305), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 59/179 (32%), Positives = 90/179 (50%), Gaps = 9/179 (5%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           + ID+                E    EE    +EE + +YLR  A+ +N RRRT +EK+D
Sbjct: 9   ETIDEVIEEQQTEQQEESGAQEDPRIEELTKLAEENQQRYLRAQADFDNFRRRTQKEKED 68

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
              Y+  K    +L V DN  RA+ +A               ++L +G++M  R++  TL
Sbjct: 69  LAQYASMKLIGQLLPVVDNFERAVAAASA---------NQDFEALAKGVDMIFRQLEQTL 119

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           ++ G+K +DA  + FNP  HQA+     D      I++ VQ GY + ERVLRPA+V +S
Sbjct: 120 QQEGLKAMDAVGEPFNPEFHQAIMTVESDEHEEGIIVEEVQKGYILKERVLRPAMVKVS 178


>gi|90022379|ref|YP_528206.1| heat shock protein GrpE [Saccharophagus degradans 2-40]
 gi|123090257|sp|Q21H35|GRPE_SACD2 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|89951979|gb|ABD81994.1| GrpE protein [Saccharophagus degradans 2-40]
          Length = 194

 Score =  121 bits (304), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 52/180 (28%), Positives = 97/180 (53%), Gaps = 8/180 (4%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
              +  +      ++ +  +          + +  ++  LR  AE +N RRR +++ + A
Sbjct: 23  ESQQAADSGAEAPASDDVAALQAEIARLNEELQTTKENALRAAAEAQNARRRAEQDVEKA 82

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
             + + KF  D+L V+DNL RA+D+A  +         + L  ++EG+E+T + ++  L+
Sbjct: 83  HKFGLEKFVGDILPVADNLERAIDAAKAEG--------ADLGVVVEGVELTLKTLVDGLK 134

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           R+ V++ID + + F+P +HQAM       V  NT+I V Q GY ++ R++RPA+V +SK 
Sbjct: 135 RHKVEQIDPQGEPFDPQLHQAMTMIEQPDVEPNTVINVFQRGYTLHGRLVRPAMVVVSKA 194


>gi|332258995|ref|XP_003278574.1| PREDICTED: grpE protein homolog 1, mitochondrial-like [Nomascus
           leucogenys]
          Length = 217

 Score =  121 bits (304), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 54/178 (30%), Positives = 91/178 (51%), Gaps = 3/178 (1%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
            D            A EK+ +    +   Q +E  +KY R +A+ ENLR+R+ +  ++A+
Sbjct: 41  EDDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAK 100

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
            Y I  F +D+L V+D L +A    P +    +      LK+L EG+ MT  ++     +
Sbjct: 101 LYGIQAFCKDLLEVADVLEKATQCVPKEEIKDD---NPHLKNLYEGLVMTEVQIQKVFTK 157

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +G+ K++    KF+P  H+A+F  P +     T+  V + GY ++ R LRPALV + K
Sbjct: 158 HGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVK 215


>gi|118579829|ref|YP_901079.1| GrpE protein [Pelobacter propionicus DSM 2379]
 gi|166215273|sp|A1ANV1|GRPE_PELPD RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|118502539|gb|ABK99021.1| GrpE protein [Pelobacter propionicus DSM 2379]
          Length = 190

 Score =  121 bits (304), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 51/183 (27%), Positives = 93/183 (50%), Gaps = 10/183 (5%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +    E + + A +                 +  E  D+++R  A++EN R+R++REK++
Sbjct: 18  EQASPESSAAEAATPEERISRLEEQLAAKEAECRENWDRFVRERADLENFRKRSNREKEE 77

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
             +Y       ++L V DNL RAL  A  + +            L EG++M    +++ +
Sbjct: 78  LLNYGTKSLLEEILPVVDNLERALSHANENGST----------GLTEGVQMIHGLLLNAM 127

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +++GV  ++     F+P+ HQAM + P D  P NT+++  Q GY + ER+LRPA+VS++ 
Sbjct: 128 KKFGVTPLETSGAPFDPSFHQAMTQIPTDEHPPNTVVEEFQKGYLLKERLLRPAMVSVAT 187

Query: 188 GKT 190
              
Sbjct: 188 APK 190


>gi|258592994|emb|CBE69305.1| Protein grpE (HSP-70 cofactor) [NC10 bacterium 'Dutch sediment']
          Length = 214

 Score =  121 bits (304), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 54/205 (26%), Positives = 97/205 (47%), Gaps = 9/205 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           ET  S  +  +E   +      +         +E   + E   D+ LR+ AE EN ++R 
Sbjct: 8   ETKASTSDNVQESPVAPTTELESMIGRLQADLKERTTEIESLNDRLLRLHAEFENYKKRA 67

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
            RE+ +   ++      ++L V D+L  A+ +          +    ++ L EG+++  R
Sbjct: 68  SRERSEFVRFANEGLILELLPVVDSLEHAVATV---------RIGGDVQGLTEGVDIILR 118

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
              +TLE+ GVK I+A   +F+PN+HQA+ +        N  ++ V+ GY +  R+LRPA
Sbjct: 119 LFQTTLEKVGVKPIEAVGHEFDPNVHQAVAQVETTDGRDNIAVEEVRRGYLLEGRLLRPA 178

Query: 182 LVSISKGKTQNPTEEKKETIEQPSP 206
           +V +SK K  +     + + E  S 
Sbjct: 179 MVKVSKAKVLSHELGVQGSEEGQSE 203


>gi|195131301|ref|XP_002010089.1| GI14884 [Drosophila mojavensis]
 gi|193908539|gb|EDW07406.1| GI14884 [Drosophila mojavensis]
          Length = 250

 Score =  121 bits (304), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 60/183 (32%), Positives = 107/183 (58%), Gaps = 4/183 (2%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           +S +      + S   ++ +E             + ++  DKY R +A+ ENLRRR +R+
Sbjct: 71  LSPEQTPSHDDESKGGAAMSEVDWLTQELATIKVEHKQLLDKYKRALADGENLRRRLNRQ 130

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
             +A+ + I  F +D++ V+D L  A  S P D  ++     + LKSL EG+ +TR  + 
Sbjct: 131 IDEAKLFGIQGFCKDLIEVADVLGHATRSVPKDKLST----NAELKSLYEGLNLTRASLQ 186

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
              +R+GV+ +D  +QKF+PN+H+A+F+    +V A+T+++V + GY +++R +RPALV 
Sbjct: 187 QVFKRHGVEILDPINQKFDPNLHEALFQTVDKSVDADTVVQVNKLGYKLHKRCIRPALVG 246

Query: 185 ISK 187
           +SK
Sbjct: 247 VSK 249


>gi|195637076|gb|ACG38006.1| protein grpE [Zea mays]
          Length = 328

 Score =  121 bits (304), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 42/215 (19%), Positives = 89/215 (41%), Gaps = 8/215 (3%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E  +++      +  S   S   E+ S ++       +    R++ LR+ A+ +N R+RT
Sbjct: 113 EALINDDEAKAAEIESFLLSIEDEKNSLLSKITALDVELATQRERILRISADFDNFRKRT 172

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           + EK +       +     L V DN  RA     ++    E         +    +   +
Sbjct: 173 ENEKLNMMENVQGELIESFLPVLDNFERAKMQIKVETEGEE--------KINNSYQSINK 224

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           + +  L    V+ ++   + F+P +H+A+  E         I++  + G+ + ER+LRPA
Sbjct: 225 QFIEILNSLSVEDVETVGKPFDPMLHEAIMREESSEYEEGIILQEFRKGFKLGERLLRPA 284

Query: 182 LVSISKGKTQNPTEEKKETIEQPSPLDIEERNKTQ 216
           +V +S G     + +   T+ + S    +  +  +
Sbjct: 285 MVKVSAGPGPENSGDDDPTVVEDSVAPQKVEDVEE 319


>gi|225460859|ref|XP_002277588.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 324

 Score =  121 bits (304), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 55/192 (28%), Positives = 106/192 (55%), Gaps = 5/192 (2%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           +    +   + +        +  + +    + E+ +DK LR  AEMEN+  R  RE +++
Sbjct: 132 SDSDSEADLSMDDLMKLVLEKEELLKMKNKEIEKMQDKVLRSYAEMENVMERARREAENS 191

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPL-----DLANSEKKSESVLKSLIEGIEMTRREM 123
           + ++I  FA+ +L V+DNL RA           D +     +  +LK+L+EG+EMT +++
Sbjct: 192 KKFAIQNFAKSLLDVADNLGRASLVVKESFSKIDESKDTAGAVPLLKTLLEGVEMTEKQL 251

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
                ++G++K D  +++F+P+ H A F+ P  + P+ T+  V++ GY +++RV+RPA V
Sbjct: 252 GEVFRKFGMEKFDPTNEQFDPHRHNAAFQIPDPSKPSGTVAVVLKAGYMLHDRVIRPAEV 311

Query: 184 SISKGKTQNPTE 195
            +++    N TE
Sbjct: 312 GVTQAVDNNETE 323


>gi|325181744|emb|CCA16200.1| Mitochondrial Protein Translocase (MPT) Family puta [Albugo
           laibachii Nc14]
          Length = 221

 Score =  121 bits (304), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 56/183 (30%), Positives = 107/183 (58%), Gaps = 1/183 (0%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
           + +  +  + P+ +       +S     EE  + S++  D  LR +A+ EN+RR + ++ 
Sbjct: 33  NSEKEETSETPTESVKEEETLESLKKKVEELESDSKKINDHLLRALADAENVRRISRQDV 92

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
           ++A+ ++I+KFAR++L V+DNL RA +S  ++  + ++     +KSL EG+ MT +++  
Sbjct: 93  QNARDFAISKFARNLLDVADNLQRAHESIKIEELHPDRTL-EAIKSLHEGVVMTDQQLQK 151

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
             + + +  +     +F+PNMH A+FE   DT    TI ++++ GY +N R++RPA V +
Sbjct: 152 VFQEFNINPVGQVGDRFDPNMHDALFEYEDDTKEPGTIGQLMKRGYLLNSRIIRPAQVGV 211

Query: 186 SKG 188
            KG
Sbjct: 212 IKG 214


>gi|218893857|ref|YP_002442726.1| heat shock protein GrpE [Pseudomonas aeruginosa LESB58]
 gi|254799607|sp|B7V1H4|GRPE_PSEA8 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|218774085|emb|CAW29901.1| heat shock protein GrpE [Pseudomonas aeruginosa LESB58]
          Length = 186

 Score =  121 bits (304), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 53/192 (27%), Positives = 102/192 (53%), Gaps = 8/192 (4%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           +  +  +       T   +      +E   Q    +D+ LR++A+++N+RRR +++ + A
Sbjct: 3   DEQQTLDQQTPEQPTGAAEDLTARVQELEEQLAAAQDQALRMVADLQNVRRRAEQDVEKA 62

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
             +++ KFA D+L+V D L R L+ +          ++  +K + EG+E+T +    TL 
Sbjct: 63  HKFALEKFAGDLLAVVDTLERGLEMSD--------PNDEAIKPMREGMELTLKMFDDTLR 114

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           RY V+ ++ + + FNP  +QAM  +   +    +++KV Q GY +N R+LRPA+V +SK 
Sbjct: 115 RYQVEALNPEGEPFNPEQYQAMAMQESASAEPGSVLKVFQKGYLLNGRLLRPAMVVVSKA 174

Query: 189 KTQNPTEEKKET 200
             + P    ++ 
Sbjct: 175 PAETPPSIDEQA 186


>gi|195455354|ref|XP_002074684.1| GK23032 [Drosophila willistoni]
 gi|194170769|gb|EDW85670.1| GK23032 [Drosophila willistoni]
          Length = 170

 Score =  121 bits (304), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 60/171 (35%), Positives = 103/171 (60%), Gaps = 4/171 (2%)

Query: 17  SNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKF 76
           + A +S+ E +       E+  Q  E  DKY R +A+ EN+R R +++  DA+++ I  F
Sbjct: 4   TAAPTSSPEIERLTKELAEAKEQHSELLDKYKRSLADSENMRTRLNKQIADAKTFGIQSF 63

Query: 77  ARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID 136
            +D L V+D L  A  + P +         + LK+L EG+ MT+  ++   + +G++ +D
Sbjct: 64  CKDFLEVADTLGHATQAVPKEKLAD----NADLKNLFEGLSMTKASLLQVFKCHGLEPLD 119

Query: 137 AKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
             +QKFNPN+H+A+F++   TV ANT+++V +  Y ++ER +RPALV +SK
Sbjct: 120 PINQKFNPNLHEALFQKEDKTVDANTVVEVTKLDYTLHERCIRPALVGVSK 170


>gi|168041950|ref|XP_001773453.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162675329|gb|EDQ61826.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 302

 Score =  121 bits (304), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 56/195 (28%), Positives = 98/195 (50%), Gaps = 6/195 (3%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E         +  N   A+           + +E     +E +DK LR  AE+EN+  R 
Sbjct: 108 EGTSESVQHAERSNDIKADDLARMVAERDALLQEKDKTIKELQDKVLRGYAEVENVMARA 167

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPL------DLANSEKKSESVLKSLIEG 115
            RE +  + +++  FA+ +L V+DNL RA  + P               +  VL +L++G
Sbjct: 168 RREAESTRKFALQGFAKGLLDVADNLGRATGAVPENLRKLDSTLEDSSGAAKVLITLLQG 227

Query: 116 IEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINE 175
           +EMT +++     + G++K +++ ++F+PN H AMFE   +T    T+  V + GY +++
Sbjct: 228 VEMTEKQLQQVFRQNGLEKFESEGKEFDPNYHSAMFELEDETKTPGTVAIVTKVGYLLHD 287

Query: 176 RVLRPALVSISKGKT 190
           RV+RPA V + K K 
Sbjct: 288 RVIRPAEVGVIKAKE 302


>gi|296412896|ref|XP_002836155.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295629962|emb|CAZ80346.1| unnamed protein product [Tuber melanosporum]
          Length = 255

 Score =  121 bits (304), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 59/175 (33%), Positives = 105/175 (60%), Gaps = 3/175 (1%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
             +   D++++P +AN  T E ++     EE   ++ +++D++ R  A+  NL+ RT+RE
Sbjct: 72  EPQTKTDQQRSPEDANELTKEVETLKKDVEERAKEARDYKDRFQRAAADFRNLQDRTERE 131

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
           KK A+ ++I KFA+D++   DNL RAL + P +    E      L +L  G++MT   ++
Sbjct: 132 KKIARDFAIQKFAKDLVESVDNLDRALSAVPAESRTEE---NKDLMNLYNGLKMTEEILL 188

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
           +TL+R+G++K+D   + F+PN H+A+F+ P       T+  V Q G+A+N R +R
Sbjct: 189 NTLKRHGLEKVDPMGEAFDPNKHEAVFQVPMPDKEPGTVFNVQQTGFALNGRTIR 243


>gi|218191152|gb|EEC73579.1| hypothetical protein OsI_08039 [Oryza sativa Indica Group]
          Length = 332

 Score =  121 bits (303), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 42/220 (19%), Positives = 90/220 (40%), Gaps = 10/220 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E  +++      +      S   E+ S ++       +    RD+ LR+ A+ +N R+R 
Sbjct: 117 EALINDDETKVAEIEDFLFSIEEEKNSLLSKISTLGAELTTERDRILRISADFDNYRKRV 176

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           +REK    +    +    +L V DN  RA     ++              + +  +   +
Sbjct: 177 EREKLSLMTNVQGEVIESLLPVLDNFERAKTQIKVETEQET--------KINDSYQSIYK 228

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           + +  L   GV+ ++   + F+P +H+A+  E         I++  + G+ + ER+LRPA
Sbjct: 229 QFIDILNSLGVEDVETVGKPFDPMLHEAIMREESVEYEEGVILQEFRKGFKLGERLLRPA 288

Query: 182 LVSISKGKTQNPT--EEKKETIEQPSPLDIEERNKTQTKN 219
           +V +S G        ++     +  +P  ++E       +
Sbjct: 289 MVKVSAGPGPEKPVYDDPAMVEDSVAPQKVKEAEDDGFDD 328


>gi|189199616|ref|XP_001936145.1| mitochondrial co-chaperone GrpE [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187983244|gb|EDU48732.1| mitochondrial co-chaperone GrpE [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 229

 Score =  121 bits (303), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 61/168 (36%), Positives = 98/168 (58%), Gaps = 5/168 (2%)

Query: 23  TAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLS 82
            +E        E+   +  + +DKYLR +AE  NL+ RT RE K A+ ++I +FARD++ 
Sbjct: 64  NSEVTQLKEALEKKDKEVIDLKDKYLRSVAEFRNLQERTQREIKAAKDFAIQRFARDLVE 123

Query: 83  VSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQ-- 140
             DNL RAL +   D   S+    + L +L +GI+MT   +++TL+++G+++ D  +Q  
Sbjct: 124 SVDNLDRALGTVSEDKLKSD---NTDLIALHDGIKMTDSILINTLKKHGLERFDPSEQAE 180

Query: 141 KFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           KF+PN+H+A+F+ P       T     Q G+ +N RVLRPA V + K 
Sbjct: 181 KFDPNVHEAVFQAPQPDKEDGTCFHTQQKGFRLNGRVLRPAKVGVVKN 228


>gi|156744298|ref|YP_001434427.1| GrpE protein [Roseiflexus castenholzii DSM 13941]
 gi|156235626|gb|ABU60409.1| GrpE protein [Roseiflexus castenholzii DSM 13941]
          Length = 204

 Score =  121 bits (303), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 52/197 (26%), Positives = 95/197 (48%), Gaps = 9/197 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           ET    + +   + P+  + +            E   ++ E RD +LR +A+ +N +RRT
Sbjct: 15  ETPPDGQEVVATETPATESGAPPSVDDLQARIAELERENAELRDNWLRAVADYKNFKRRT 74

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           ++E+ D    + A     +L V D+L RA+ +   D+A +             G ++  +
Sbjct: 75  EQERADLIRNASAALLLKLLPVMDDLERAMANVTPDIAETPW---------YNGFKLIPQ 125

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           ++ + LE  GV  +    + F+PN H+A+  EP +      +I  +Q GY + +RVLRPA
Sbjct: 126 KLQTILESEGVSPMQTVGEAFDPNRHEAIIYEPSEDGEDGRVIAELQRGYLLRDRVLRPA 185

Query: 182 LVSISKGKTQNPTEEKK 198
           +V +S+G+ Q    E  
Sbjct: 186 MVKVSQGRKQPSGSETT 202


>gi|85708634|ref|ZP_01039700.1| molecular chaperone GrpE [Erythrobacter sp. NAP1]
 gi|85690168|gb|EAQ30171.1| molecular chaperone GrpE [Erythrobacter sp. NAP1]
          Length = 195

 Score =  121 bits (303), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 62/181 (34%), Positives = 99/181 (54%), Gaps = 5/181 (2%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           K + +E     +   +  E +     E      E  +   L   AE +N+RRR +++  D
Sbjct: 18  KGVPEEFLDDGSEDESEGEGALGEALEALRGDLEAAKQDVLYARAETQNVRRRAEKDIAD 77

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A++Y+   FARD+LSV DNLSRA+D+ P  L          +K L+ GIE T+RE+    
Sbjct: 78  ARNYAATGFARDILSVWDNLSRAVDAIPDSLRED-----DKMKGLVTGIEATQRELEKVF 132

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +++GV+++ A     +PN HQAM E P       T+I+ +Q G+ I +R+LRPA+V ++K
Sbjct: 133 KQHGVERVAAVGLPLDPNQHQAMMEIPSADHEPGTVIQEMQSGWMIKDRLLRPAMVGVAK 192

Query: 188 G 188
            
Sbjct: 193 K 193


>gi|302381324|ref|YP_003817147.1| GrpE protein [Brevundimonas subvibrioides ATCC 15264]
 gi|302191952|gb|ADK99523.1| GrpE protein [Brevundimonas subvibrioides ATCC 15264]
          Length = 209

 Score =  121 bits (303), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 54/203 (26%), Positives = 107/203 (52%), Gaps = 8/203 (3%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
           ++     ++  +NA +    +   +   +  +   + ++D+ +R  AE +N++RRT+ + 
Sbjct: 8   NDLEAQLDEALANAEAGLDADPDNLAPLDAMIADRDLWKDRAMRAAAEADNVKRRTETQM 67

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
            DA++++I +FA+D+L V+DNL RAL +AP D  +           LI G+E+T++ ++ 
Sbjct: 68  NDARAFAIQRFAKDLLGVADNLERALMAAPKDADS-------AAAGLINGLELTQKSLLQ 120

Query: 126 TLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
             E  G+K++       F+P++HQAM E+P    P  T+++ +Q GY +  R +RPA+V 
Sbjct: 121 AFETNGLKRLAPGLGDAFDPHLHQAMMEQPSTEAPGGTVLQTMQAGYELFGRTVRPAMVV 180

Query: 185 ISKGKTQNPTEEKKETIEQPSPL 207
           ++   +              S  
Sbjct: 181 VAAKGSGAQGANPYAAAPDGSGG 203


>gi|331005324|ref|ZP_08328711.1| Heat shock protein GrpE [gamma proteobacterium IMCC1989]
 gi|330420863|gb|EGG95142.1| Heat shock protein GrpE [gamma proteobacterium IMCC1989]
          Length = 195

 Score =  121 bits (303), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 50/183 (27%), Positives = 105/183 (57%), Gaps = 8/183 (4%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           ++      + +  ++    E S+ +I +    +    +++ LR  A+ +N+RRR++++ +
Sbjct: 21  DEGESVNNDDAEVDAEVEIESSDDSIGDVLTEEIASLKEQVLRAHADAQNVRRRSEQDVE 80

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
            A+ +++ KF  D+L V+DNL RA+ +   +        +   K+++EG+E+T + +  T
Sbjct: 81  KARKFALEKFVADLLPVADNLERAIAAGNPE--------DETQKAVLEGVELTLKSLQDT 132

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           L+++ V+ +D   + F+P +HQAM   P+  +  NT++ V Q GY +N R++RPA+V +S
Sbjct: 133 LKKHKVEMVDPAGEPFDPQLHQAMTMVPNPDMEPNTVMDVFQKGYTLNGRLVRPAMVVVS 192

Query: 187 KGK 189
              
Sbjct: 193 SAP 195


>gi|126664874|ref|ZP_01735858.1| Molecular chaperone GrpE (heat shock protein) [Marinobacter sp.
           ELB17]
 gi|126631200|gb|EBA01814.1| Molecular chaperone GrpE (heat shock protein) [Marinobacter sp.
           ELB17]
          Length = 202

 Score =  121 bits (302), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 52/189 (27%), Positives = 106/189 (56%), Gaps = 5/189 (2%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
           +D     +   +  A E S     E    + +EF+++ LR  AEM+N+RRR + + + A 
Sbjct: 19  VDNAAEENAEAAEAAPESSPSADLEALQAKVQEFQEQVLRSQAEMQNVRRRAENDVEKAH 78

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
            +++ KF +++L V D+L +A++S     ++       ++ S+ +G+E+T    +S L++
Sbjct: 79  KFAVEKFVKELLPVVDSLEKAVESTEGHDSSG-----DLVTSIRQGVELTLDMFLSGLKK 133

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
           + V++++   + F+P  H+AM   P      N+++ V+Q GY +N RV+RPA+V ++K +
Sbjct: 134 FNVERLNPVGEPFDPQYHEAMSMVPAPNAEPNSVVAVMQKGYLLNGRVVRPAMVMVAKPQ 193

Query: 190 TQNPTEEKK 198
                +E+ 
Sbjct: 194 DAPKIDEQA 202


>gi|212533907|ref|XP_002147110.1| mitochondrial co-chaperone GrpE, putative [Penicillium marneffei
           ATCC 18224]
 gi|210072474|gb|EEA26563.1| mitochondrial co-chaperone GrpE, putative [Penicillium marneffei
           ATCC 18224]
          Length = 247

 Score =  121 bits (302), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 59/193 (30%), Positives = 99/193 (51%), Gaps = 6/193 (3%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E    +++  KE       ++ + E +     E    +  E +DKY+R +A+  NL+ RT
Sbjct: 54  ENGAKKEDAQKETGEGAETATESPEDALKKELEAKNKEVVELKDKYIRSVADFRNLQERT 113

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
            R+  +A+S++I KFA D+L   DN  RAL   P D       +   L  L +G++MT  
Sbjct: 114 KRDMDNARSFAIQKFAVDLLESIDNFDRALSVVPADKLTDGADANKDLLELHQGLKMTES 173

Query: 122 EMMSTLERYGVKKIDAKD------QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINE 175
            +++TL+++G+++ D  D       KF+P +H+A F    +      I+ V   GY++N 
Sbjct: 174 ILLNTLKKHGLERFDPSDATDGKTSKFDPKIHEATFMAKVEGKENGDIMFVQSKGYSLNG 233

Query: 176 RVLRPALVSISKG 188
           RVLR A V + K 
Sbjct: 234 RVLRAAKVGVVKN 246


>gi|87312188|ref|ZP_01094291.1| molecular chaperone GrpE [Blastopirellula marina DSM 3645]
 gi|87285113|gb|EAQ77044.1| molecular chaperone GrpE [Blastopirellula marina DSM 3645]
          Length = 198

 Score =  121 bits (302), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 61/197 (30%), Positives = 93/197 (47%), Gaps = 9/197 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E  ++  + D  +    A      + S      +  N       + L   A+MENLR+R 
Sbjct: 11  EKPLNVFDSDALQEDVGALDEALADDSLDGEANKLRNDLAGAERRILLAQADMENLRKRM 70

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
            RE +D   Y+      D+L V DNL+RALDSA                 ++ G++M  +
Sbjct: 71  RREVEDTVKYADVPLITDLLPVIDNLNRALDSA---------GQSQEAAGIVTGVKMVAQ 121

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
            M+  L R G K I+A  Q F+PN H A+ ++P D VP+  ++ V Q GY +++RV+RPA
Sbjct: 122 SMLDVLARRGCKTIEALGQPFDPNRHDAILQQPSDEVPSGHVLMVTQSGYQLHDRVIRPA 181

Query: 182 LVSISKGKTQNPTEEKK 198
            V +S G       E  
Sbjct: 182 QVIVSTGSPAAAEGESS 198


>gi|77464797|ref|YP_354301.1| putative chaperone protein GrpE (heat shock protein) [Rhodobacter
           sphaeroides 2.4.1]
 gi|123590774|sp|Q3IYI4|GRPE_RHOS4 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|77389215|gb|ABA80400.1| putative chaperone protein GrpE (heat shock protein) [Rhodobacter
           sphaeroides 2.4.1]
          Length = 189

 Score =  121 bits (302), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 65/184 (35%), Positives = 105/184 (57%), Gaps = 8/184 (4%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
            E   D+        +    E  EI+  E    + +E RD+++R +A+ EN R+R DR++
Sbjct: 10  DEMAEDQAPREETVEAPELTEAPEIDELETLRAERDELRDRFMRALADAENSRKRADRDR 69

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
           ++A+ Y   + ARD+L V DNLSRAL+ A  +         +   +LIEG+E+T RE+ +
Sbjct: 70  REAEQYGGTRLARDLLPVYDNLSRALEVATDEQR-------AAAAALIEGVELTLRELRN 122

Query: 126 TLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
            + ++GV+ I  +    F+P  HQAMFE P     A  II+V+ +G+ I++R+LRPA V 
Sbjct: 123 VMNKHGVRPITPQVGDTFDPQQHQAMFEAPVPGTKAGQIIQVMTEGFMIHDRLLRPAQVG 182

Query: 185 ISKG 188
           +S  
Sbjct: 183 VSSN 186


>gi|117921343|ref|YP_870535.1| heat shock protein GrpE [Shewanella sp. ANA-3]
 gi|226737181|sp|A0KZB0|GRPE_SHESA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|117613675|gb|ABK49129.1| GrpE protein [Shewanella sp. ANA-3]
          Length = 206

 Score =  121 bits (302), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 61/195 (31%), Positives = 107/195 (54%), Gaps = 8/195 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   SE + ++         +    +    +  ++L + EE +D  +R  AE++N+RRR 
Sbjct: 15  EGVESEVSTEEASLIDELTQANFRIEELEQLLADALAKVEEQKDSVIRAAAEVDNIRRRA 74

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
             + + A  +++ KFA ++L V DN+ RAL              +   K+L EG+E+T++
Sbjct: 75  AMDVEKANKFALEKFANELLPVLDNMERALQ--------GTNPQDETTKALFEGVELTQK 126

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
             ++ + ++GVK ID + Q FNP+ HQA+  +P    PANT++ V+Q GY +N R+LRPA
Sbjct: 127 SFLTAVAKFGVKPIDPQGQAFNPDQHQAIGMQPSAEYPANTVMLVMQKGYELNSRLLRPA 186

Query: 182 LVSISKGKTQNPTEE 196
           +V +S+G     +  
Sbjct: 187 MVMVSQGGPSQESAS 201


>gi|47497617|dbj|BAD19686.1| putative co-chaperone CGE1 precursor isoform b [Oryza sativa
           Japonica Group]
          Length = 332

 Score =  121 bits (302), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 42/220 (19%), Positives = 90/220 (40%), Gaps = 10/220 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E  +++      +      S   E+ S ++       +    RD+ LR+ A+ +N R+R 
Sbjct: 117 EALINDDETKVAEIEDFLFSIEEEKNSLLSKISTLGAELTTERDRILRISADFDNYRKRV 176

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           +REK    +    +    +L V DN  RA     ++              + +  +   +
Sbjct: 177 EREKLSLMTNVQGEVIESLLPVLDNFERAKTQIKVETEQET--------KINDSYQSIYK 228

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           + +  L   GV+ ++   + F+P +H+A+  E         I++  + G+ + ER+LRPA
Sbjct: 229 QFIDILNSLGVEDVETVGKPFDPMLHEAIMREESVEYEEGVILQEFRKGFKLGERLLRPA 288

Query: 182 LVSISKGKTQNPT--EEKKETIEQPSPLDIEERNKTQTKN 219
           +V +S G        ++     +  +P  ++E       +
Sbjct: 289 MVKVSAGPGPEKPVYDDPAMVEDSVAPQKVKEAEDDGFDD 328


>gi|77166264|ref|YP_344789.1| GrpE protein [Nitrosococcus oceani ATCC 19707]
 gi|123593368|sp|Q3J7D7|GRPE_NITOC RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|76884578|gb|ABA59259.1| GrpE protein [Nitrosococcus oceani ATCC 19707]
          Length = 210

 Score =  121 bits (302), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 59/197 (29%), Positives = 107/197 (54%), Gaps = 8/197 (4%)

Query: 4   FMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDR 63
             S+   +  +    A   TAE ++   + E++ ++++E  ++ LR  AE+EN RRR +R
Sbjct: 22  VESQTRAEGGEQIQEAAPETAELEAVQQLLEDARSKADEHWNELLRARAELENQRRRHER 81

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           E +  + Y++ KFA+D+L V D+L   L +A  +        ++ + +L EG E+  +  
Sbjct: 82  ELEKGRKYALEKFAQDLLPVKDSLEMGLAAAQAE--------DANVTALREGTELILKMF 133

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
                R+G++ ID + + FNP+ HQA+  +       +T++ VV+ GYA+N R+LRPA+V
Sbjct: 134 NEVAARFGIETIDPQGEAFNPDFHQAISTQESSEAAPDTVLTVVRKGYALNGRLLRPAMV 193

Query: 184 SISKGKTQNPTEEKKET 200
            +SK   Q       + 
Sbjct: 194 VVSKPGEQTTAGVDTQA 210


>gi|254435973|ref|ZP_05049480.1| co-chaperone GrpE [Nitrosococcus oceani AFC27]
 gi|207089084|gb|EDZ66356.1| co-chaperone GrpE [Nitrosococcus oceani AFC27]
          Length = 215

 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 59/197 (29%), Positives = 107/197 (54%), Gaps = 8/197 (4%)

Query: 4   FMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDR 63
             S+   +  +    A   TAE ++   + E++ ++++E  ++ LR  AE+EN RRR +R
Sbjct: 27  VESQTRAEGGEQIQEAAPETAELEAVQQLLEDARSKADEHWNELLRARAELENQRRRHER 86

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           E +  + Y++ KFA+D+L V D+L   L +A  +        ++ + +L EG E+  +  
Sbjct: 87  ELEKGRKYALEKFAQDLLPVKDSLEMGLAAAQAE--------DANVTALREGTELILKMF 138

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
                R+G++ ID + + FNP+ HQA+  +       +T++ VV+ GYA+N R+LRPA+V
Sbjct: 139 NEVAARFGIETIDPQGEAFNPDFHQAISTQESSEAAPDTVLTVVRKGYALNGRLLRPAMV 198

Query: 184 SISKGKTQNPTEEKKET 200
            +SK   Q       + 
Sbjct: 199 VVSKPGEQTTAGVDTQA 215


>gi|225164491|ref|ZP_03726746.1| Molecular chaperone GrpE (heat shock protein)-like protein
           [Opitutaceae bacterium TAV2]
 gi|224800906|gb|EEG19247.1| Molecular chaperone GrpE (heat shock protein)-like protein
           [Opitutaceae bacterium TAV2]
          Length = 223

 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 52/161 (32%), Positives = 87/161 (54%), Gaps = 9/161 (5%)

Query: 29  EINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLS 88
                  +  ++    D+Y+R +A++EN RRRT REK + + ++ A+   D+L V DNL 
Sbjct: 46  LEAQLATAKQEAAANYDRYMRALADLENFRRRTIREKDELRQFAAARVIEDLLPVIDNLG 105

Query: 89  RALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMH 147
             L +A L  A++E        S+  GI +   +  + L  +G+K+I+      F+PN  
Sbjct: 106 FGLAAAKLPTASTE--------SVASGIVLVVDQFKNALGNHGLKEINPAVGDGFDPNQE 157

Query: 148 QAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           +A+   P   VP   ++ VV+ GY++N R+LRPA V +S G
Sbjct: 158 EAVSHLPSPDVPEGKVLNVVRIGYSLNGRLLRPATVVVSSG 198


>gi|109073648|ref|XP_001091412.1| PREDICTED: grpE protein homolog 1, mitochondrial [Macaca mulatta]
 gi|90085180|dbj|BAE91331.1| unnamed protein product [Macaca fascicularis]
          Length = 217

 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 53/178 (29%), Positives = 91/178 (51%), Gaps = 3/178 (1%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
            +            A EK+ +    +   Q +E  +KY R +A+ ENLR+R+ +  ++A+
Sbjct: 41  EEDVGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAK 100

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
            Y I  F +D+L V+D L +A    P +    +      LK+L EG+ MT  ++     +
Sbjct: 101 LYGIQAFCKDLLEVADVLEKATQCVPKEEIKDD---NPHLKNLYEGLVMTEVQIQKVFTK 157

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +G+ K++    KF+P  H+A+F  P +     T+  V + GY ++ R LRPALV + K
Sbjct: 158 HGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVK 215


>gi|317146906|ref|XP_001821747.2| hypothetical protein AOR_1_500014 [Aspergillus oryzae RIB40]
          Length = 317

 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 58/193 (30%), Positives = 103/193 (53%), Gaps = 7/193 (3%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
           T    +   +EKN +  + S   E +     E+   +  + +DKY+R +A+  NL+ RT 
Sbjct: 124 TENKAEEDKQEKNENAESESQNTEDAVRKELEKKEKEVVDLKDKYVRSVADFLNLQERTK 183

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           R+  +A++++I +FA D+L   DN  RAL + P    NS +     ++ L+ G++MT+  
Sbjct: 184 RDMDNARNFAIQRFAVDLLESIDNFDRALLAVPEAKLNSNEPEHKDIRDLVSGLKMTQNV 243

Query: 123 MMSTLERYGVKKIDAKD-------QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINE 175
           +M+ L+++G+++ D  +       QKF+PNMH+A F    +      I+     G+ +N 
Sbjct: 244 LMNALKKHGLERFDPSEPAEDGKTQKFDPNMHEATFMAKAEGKENGDIMYTQSKGFRLNG 303

Query: 176 RVLRPALVSISKG 188
           RVLR A V + K 
Sbjct: 304 RVLRAAKVGVVKN 316


>gi|332703265|ref|ZP_08423353.1| Protein grpE [Desulfovibrio africanus str. Walvis Bay]
 gi|332553414|gb|EGJ50458.1| Protein grpE [Desulfovibrio africanus str. Walvis Bay]
          Length = 182

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 57/190 (30%), Positives = 95/190 (50%), Gaps = 15/190 (7%)

Query: 5   MSEKNIDKEKNPSNANSSTAEE------KSEINIPEESLNQSEEFRDKYLRVIAEMENLR 58
           MSEK+ + +   + A+++   +             +E   +    +D  LR +AE EN++
Sbjct: 1   MSEKSKNAQTPDTAADAAAVGQAEAAAPSDLEARVKELDEELARLKDDKLRALAETENVK 60

Query: 59  RRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEM 118
           RR  REK++ Q +++     D+L V DNL  AL  A               K  ++G+EM
Sbjct: 61  RRLMREKEEFQKFAVEGVLADLLPVLDNLDMALAYAEK---------SEACKGFVQGVEM 111

Query: 119 TRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVL 178
           TR+  +  L  +G++      ++FNP  H+A+  EP    P N + +++Q GY +  R+L
Sbjct: 112 TRKVFLDILASHGLEATGGAGEEFNPEWHEAVGAEPSKDFPENHVCQLLQKGYKLKGRLL 171

Query: 179 RPALVSISKG 188
           RPA V ISK 
Sbjct: 172 RPAKVLISKP 181


>gi|124021735|ref|YP_001016042.1| heat shock protein GrpE [Prochlorococcus marinus str. MIT 9303]
 gi|226737157|sp|A2C5L7|GRPE_PROM3 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|123962021|gb|ABM76777.1| Heat shock protein GrpE [Prochlorococcus marinus str. MIT 9303]
          Length = 237

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 44/201 (21%), Positives = 81/201 (40%), Gaps = 8/201 (3%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           M+          +    + A  +           + E  R +Y+R+ A+ +N R+R  R+
Sbjct: 29  MNSDEGQPSAQSAPLADNEARLQQLEQEHSSLREEHETLRSQYMRIAADFDNFRKRQSRD 88

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
           + D +   I     ++L V DN  RA                   ++L    +   ++++
Sbjct: 89  QDDLRLQLICTTLSEILPVVDNFERARQQLE--------PQGEEAQALHRSYQGLYKQLV 140

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
             L++ GV  +    Q F+P +H+A+  EP +  P + + + +Q GY +N RVLR ALV 
Sbjct: 141 EVLKQLGVASMRVVGQAFDPTLHEAVSREPSEEHPEDVVTEELQRGYHLNGRVLRHALVK 200

Query: 185 ISKGKTQNPTEEKKETIEQPS 205
           +S G                 
Sbjct: 201 VSMGPGPQSGASPSSAQSNDD 221


>gi|126332076|ref|XP_001372319.1| PREDICTED: similar to GrpE protein homolog 1, mitochondrial
           precursor (Mt-GrpE#1) (HMGE) [Monodelphis domestica]
          Length = 217

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 59/180 (32%), Positives = 96/180 (53%), Gaps = 3/180 (1%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
            +          STA EK+ I    +   Q +E  +KY R +A+ ENLR+R+ +  ++A+
Sbjct: 41  EEDSSQNEQKIDSTATEKTLIEEKVKLEEQLKETLEKYKRALADTENLRQRSQKLVEEAK 100

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
            Y I  F +D+L V+D L +A +S P D    E      LK+L EG+ MT  ++    ++
Sbjct: 101 LYGIQGFCKDLLEVADILEKATESVPKDEIKEE---NPHLKNLYEGLVMTEVQIQKVFKK 157

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
           +G+ K++    KF+P  H+A+F  P +     T+  V + GY ++ R LRPALV + K  
Sbjct: 158 HGLLKLNPLGDKFDPYEHEALFHTPIEGKEPGTVALVNKVGYKLHGRTLRPALVGVVKEP 217


>gi|215919156|ref|NP_820285.2| co-chaperone GrpE [Coxiella burnetii RSA 493]
 gi|206584040|gb|AAO90799.2| GrpE [Coxiella burnetii RSA 493]
          Length = 208

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 52/179 (29%), Positives = 92/179 (51%), Gaps = 9/179 (5%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           +  +E  P          +           + +E++ +YLR  AEM+NLR+R +REK D 
Sbjct: 37  DGSQEMEPHREGLEFPSREKLEGQLTRMERKVDEYKTQYLRAQAEMDNLRKRIEREKADI 96

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
             +   +   D+L V+D+L   L+S   +        +  +KS+ +G+ +T   + +TL 
Sbjct: 97  IKFGSKQLITDLLPVADSLIHGLESPASE--------DPQVKSMRDGMSLTLDLLHNTLA 148

Query: 129 RYGVKKIDA-KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           ++GV+ I+      F+P +H+AM  +       +TII+V+Q GY +N RVLR A V ++
Sbjct: 149 KHGVQVINPNPGDPFDPALHEAMSVQAVPDAKPDTIIQVLQKGYQLNGRVLRAARVIVA 207


>gi|221133014|ref|XP_002166866.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
          Length = 218

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 55/187 (29%), Positives = 107/187 (57%), Gaps = 8/187 (4%)

Query: 4   FMSEKNIDKEKNPSNANSSTAEEKSEINIPE----ESLNQSEEFRDKYLRVIAEMENLRR 59
           + +E   +KE+  +  +      K  ++  E     +     EF+DKY+R +AE EN+RR
Sbjct: 35  YSTETTANKEEVKNEEDEEGKSLKKTLSEKEVLLSAAQKDLAEFKDKYIRSLAECENVRR 94

Query: 60  RTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMT 119
           R  +   DA+ +++  F++D+L V+D L +A+ S P+D          +LK+L +G+ MT
Sbjct: 95  RGVKMVSDAKLFAVQGFSKDLLEVADILEKAMLSVPIDELQK----NELLKNLYDGLVMT 150

Query: 120 RREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
              +     ++G++K++  ++KF+PN H+A+F++      + T+++V + GY +N R +R
Sbjct: 151 EAHLQKVFLKHGLQKVNPINEKFDPNFHEALFQKSIPGKASGTVVEVNKPGYLLNGRPVR 210

Query: 180 PALVSIS 186
            ALV ++
Sbjct: 211 AALVGVA 217


>gi|146278689|ref|YP_001168848.1| GrpE protein [Rhodobacter sphaeroides ATCC 17025]
 gi|145556930|gb|ABP71543.1| GrpE protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 186

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 65/184 (35%), Positives = 107/184 (58%), Gaps = 8/184 (4%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
            E   D+     + ++    E  EI+  E    + +E RD+++R +A+ EN R+R DR++
Sbjct: 7   DEMAEDQAPRYESVDAPELAEAPEIDELEVLRAERDELRDRFMRALADAENSRKRADRDR 66

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
           ++A+ Y   + ARD+L V DNLSRAL+ A  +         +   +LIEG+E+T RE+ +
Sbjct: 67  REAEQYGGTRLARDLLPVYDNLSRALEVAGDEQR-------AAAAALIEGVELTLRELRN 119

Query: 126 TLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
            + ++GV+ I  +    F+P  HQAMFE P     A  II+V+ +G+ I++R+LRPA V 
Sbjct: 120 VMNKHGVRPITPQVGDTFDPQQHQAMFEAPVPGTKAGQIIQVMTEGFMIHDRLLRPAQVG 179

Query: 185 ISKG 188
           +S  
Sbjct: 180 VSSN 183


>gi|24308295|ref|NP_079472.1| grpE protein homolog 1, mitochondrial precursor [Homo sapiens]
 gi|207080106|ref|NP_001128810.1| DKFZP468J092 protein [Pongo abelii]
 gi|114593140|ref|XP_526517.2| PREDICTED: grpE protein homolog 1, mitochondrial [Pan troglodytes]
 gi|18202951|sp|Q9HAV7|GRPE1_HUMAN RecName: Full=GrpE protein homolog 1, mitochondrial; AltName:
           Full=HMGE; AltName: Full=Mt-GrpE#1; Flags: Precursor
 gi|75061842|sp|Q5RA81|GRPE1_PONAB RecName: Full=GrpE protein homolog 1, mitochondrial; AltName:
           Full=Mt-GrpE#1; Flags: Precursor
 gi|33150634|gb|AAP97195.1|AF087896_1 stress-inducible chaperone GrpE [Homo sapiens]
 gi|18999489|gb|AAH24242.1| GrpE-like 1, mitochondrial (E. coli) [Homo sapiens]
 gi|55729185|emb|CAH91329.1| hypothetical protein [Pongo abelii]
 gi|119602777|gb|EAW82371.1| GrpE-like 1, mitochondrial (E. coli), isoform CRA_b [Homo sapiens]
 gi|123981240|gb|ABM82449.1| GrpE-like 1, mitochondrial (E. coli) [synthetic construct]
 gi|123996075|gb|ABM85639.1| GrpE-like 1, mitochondrial (E. coli) [synthetic construct]
 gi|189053577|dbj|BAG35730.1| unnamed protein product [Homo sapiens]
          Length = 217

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 53/178 (29%), Positives = 91/178 (51%), Gaps = 3/178 (1%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
            +            A EK+ +    +   Q +E  +KY R +A+ ENLR+R+ +  ++A+
Sbjct: 41  EEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAK 100

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
            Y I  F +D+L V+D L +A    P +    +      LK+L EG+ MT  ++     +
Sbjct: 101 LYGIQAFCKDLLEVADVLEKATQCVPKEEIKDD---NPHLKNLYEGLVMTEVQIQKVFTK 157

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +G+ K++    KF+P  H+A+F  P +     T+  V + GY ++ R LRPALV + K
Sbjct: 158 HGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVK 215


>gi|46105354|ref|XP_380481.1| hypothetical protein FG00305.1 [Gibberella zeae PH-1]
          Length = 244

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 59/184 (32%), Positives = 97/184 (52%), Gaps = 2/184 (1%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +    E       +            E    + ++++DK LR +A+  NL+ RT RE K 
Sbjct: 61  EEAKSETKSDEKPAENDPLAELKKSLEAKETEVKDWKDKCLRTVADFRNLQERTTREVKS 120

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSE--SVLKSLIEGIEMTRREMMS 125
           A+ ++I KFA+D++   DNL RAL   P +    + + E    L +L EG++MT   +M+
Sbjct: 121 AKDFAIQKFAKDLVDSVDNLDRALGMVPQEKLKVKDRPEGIEDLANLYEGLKMTEDILMN 180

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
           TL+++G++++  + +KFNPN  +A F  P       T+  V Q G+ +N RVLR A V +
Sbjct: 181 TLKKHGLERLSPEGEKFNPNEQEATFMTPQPDKEDGTVFFVQQKGFKLNGRVLRAAKVGV 240

Query: 186 SKGK 189
            K K
Sbjct: 241 VKNK 244


>gi|119478524|ref|ZP_01618486.1| putative heat shock protein GrpE [marine gamma proteobacterium
           HTCC2143]
 gi|119448505|gb|EAW29753.1| putative heat shock protein GrpE [marine gamma proteobacterium
           HTCC2143]
          Length = 212

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 61/169 (36%), Positives = 104/169 (61%), Gaps = 8/169 (4%)

Query: 28  SEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNL 87
           S     E   ++  + RD  LR +AE +N+RRR++++ ++A+ +++ KFA ++L V+DNL
Sbjct: 51  SPEAQIEALEDELAKTRDDALRTLAEAQNIRRRSEKDIENARKFALEKFASELLGVADNL 110

Query: 88  SRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMH 147
            RALDSA  D          V+K L+EG+ +T++ ++ TL ++ + ++D   + F+P  H
Sbjct: 111 ERALDSADKD--------NEVVKVLLEGVALTQKSLVDTLAKFNIMQLDPLGEPFDPQFH 162

Query: 148 QAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEE 196
           QAM    +  V  NT+  V+Q GY +NER+LRPA+V +SK    +  E+
Sbjct: 163 QAMSMVENPDVEPNTVTLVMQKGYVLNERLLRPAMVMVSKAVAPSIDEQ 211


>gi|197098918|ref|NP_001127196.1| grpE protein homolog 1, mitochondrial precursor [Pongo abelii]
 gi|55726032|emb|CAH89792.1| hypothetical protein [Pongo abelii]
          Length = 217

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 54/178 (30%), Positives = 92/178 (51%), Gaps = 3/178 (1%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
            +            A EK+ +    +   Q +E  +KY R +A+ ENLR+R+ +  ++A+
Sbjct: 41  EEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAK 100

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
            Y I  F +D+L V+D L +A   AP +    +      LK+L EG+ MT  ++     +
Sbjct: 101 LYGIQAFCKDLLEVADVLEKATQCAPKEEIKDD---NPHLKNLYEGLVMTEVQIQKVFTK 157

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +G+ K++    KF+P  H+A+F  P +     T+  V + GY ++ R LRPALV + K
Sbjct: 158 HGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVK 215


>gi|268317674|ref|YP_003291393.1| GrpE protein [Rhodothermus marinus DSM 4252]
 gi|262335208|gb|ACY49005.1| GrpE protein [Rhodothermus marinus DSM 4252]
          Length = 200

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 56/189 (29%), Positives = 97/189 (51%), Gaps = 4/189 (2%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
            +E     E   + + +   EE   +   E+   +  + +DK+LR  AE++N RRR ++E
Sbjct: 12  ETENTPTPEAEATASETPAEEENDLVARIEQLEAELAQVQDKFLRTAAELQNYRRRVEQE 71

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
           K+       A   R +L V D+L R+L++A            +    L EG+E+  ++ +
Sbjct: 72  KRQLLEMGKALAIRPLLEVLDDLERSLEAARQAETQDPG---AAYHKLREGVELVHQKFL 128

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT-VPANTIIKVVQDGYAINERVLRPALV 183
           + L R GV+ I+A  Q F+P +H+AM ++P    V   T+++ VQ GY + ERVLR + V
Sbjct: 129 TELARLGVEPIEAVGQPFDPALHEAMMQQPAPEGVTPGTVLQEVQKGYRMGERVLRHSRV 188

Query: 184 SISKGKTQN 192
            ++     N
Sbjct: 189 VVAAPPDGN 197


>gi|329896049|ref|ZP_08271285.1| Heat shock protein GrpE [gamma proteobacterium IMCC3088]
 gi|328922009|gb|EGG29373.1| Heat shock protein GrpE [gamma proteobacterium IMCC3088]
          Length = 190

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 56/187 (29%), Positives = 99/187 (52%), Gaps = 8/187 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E  +    ++  +       + AE+ S     E       E ++  LR  A+  N +RR 
Sbjct: 11  EVNLENVQVEAVETADTEQPAAAEQISPEQQIEALEQALGEAKEAVLRAQADAINAQRRA 70

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           ++E + A+ +++  F+R++L V+DNL RAL     +        +  +K ++EGIE+T +
Sbjct: 71  EKEIEKARKFALEGFSREVLVVADNLERALSVVNPE--------DESVKPIVEGIELTLK 122

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
                L ++ V+ +D   + F+P +HQAM   P+  V  NT+I V+Q GY +N R++RPA
Sbjct: 123 SFSDVLAKFNVEAVDPHGEPFDPQVHQAMSMVPNPEVEPNTVIAVMQKGYTLNGRLIRPA 182

Query: 182 LVSISKG 188
           +V +SK 
Sbjct: 183 MVMVSKA 189


>gi|126730095|ref|ZP_01745907.1| co-chaperone GrpE [Sagittula stellata E-37]
 gi|126709475|gb|EBA08529.1| co-chaperone GrpE [Sagittula stellata E-37]
          Length = 187

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 58/194 (29%), Positives = 115/194 (59%), Gaps = 10/194 (5%)

Query: 1   METFMSEKNIDKEKNPSNA--NSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLR 58
           M     E+ +D  ++        +  E   E    +    + ++++D+++R +A+ EN R
Sbjct: 1   MADPKEEQFLDDVESAEAETYAGAEEEIDDEAAEVDALRAERDDYKDRFMRALADAENAR 60

Query: 59  RRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEM 118
           +R  +++++AQ+Y  ++ ARD+L V DNL+RAL +A  D +N+         +L+EG+E+
Sbjct: 61  KRAAKDRQEAQAYGGSRIARDLLPVYDNLNRALLAAKEDGSNAST-------ALVEGVEL 113

Query: 119 TRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERV 177
           T +E+M+  +R+G+ ++  +  ++F+P +H+AMFE P     A  II+V  +G+ +++R+
Sbjct: 114 TLKELMNVFDRHGMTRVSPEIGERFDPKLHEAMFEAPVPGTSAGEIIQVSAEGFMLHDRL 173

Query: 178 LRPALVSISKGKTQ 191
           LRPA V +S    +
Sbjct: 174 LRPAQVGVSSTPAK 187


>gi|11139093|gb|AAG31605.1|AF298592_1 GrpE-like protein cochaperone [Homo sapiens]
          Length = 216

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 53/178 (29%), Positives = 91/178 (51%), Gaps = 3/178 (1%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
            +            A EK+ +    +   Q +E  +KY R +A+ ENLR+R+ +  ++A+
Sbjct: 40  EEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAK 99

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
            Y I  F +D+L V+D L +A    P +    +      LK+L EG+ MT  ++     +
Sbjct: 100 LYGIQAFCKDLLEVADVLEKATQCVPKEEIKDD---NPHLKNLYEGLVMTEVQIQKVFTK 156

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +G+ K++    KF+P  H+A+F  P +     T+  V + GY ++ R LRPALV + K
Sbjct: 157 HGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVK 214


>gi|313902211|ref|ZP_07835619.1| GrpE protein [Thermaerobacter subterraneus DSM 13965]
 gi|313467546|gb|EFR63052.1| GrpE protein [Thermaerobacter subterraneus DSM 13965]
          Length = 227

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 49/157 (31%), Positives = 76/157 (48%), Gaps = 11/157 (7%)

Query: 45  DKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKK 104
           D+  R+ A+  N RRR   E+   +  + A+ AR +L V DNL RAL +A  D       
Sbjct: 80  DQLRRLQADFTNYRRRMMEEQSRWRQEAEAELARALLPVVDNLERALAAAGEDD------ 133

Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTII 164
                  +++G+ M  R+ +  L + GV+ I A+ Q F+P  H+A+  E     P  T+I
Sbjct: 134 -----HPVVQGVAMVHRQFLEVLRQAGVEPIAAQGQPFDPYRHEAVAREETAEHPDGTVI 188

Query: 165 KVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETI 201
           +V Q GY    R LRPA+V ++    +    E     
Sbjct: 189 EVFQKGYLYRGRTLRPAMVKVAVAPPEAAPGEGTAGS 225


>gi|303232378|ref|ZP_07319070.1| co-chaperone GrpE [Atopobium vaginae PB189-T1-4]
 gi|302481462|gb|EFL44530.1| co-chaperone GrpE [Atopobium vaginae PB189-T1-4]
          Length = 256

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 42/184 (22%), Positives = 89/184 (48%), Gaps = 5/184 (2%)

Query: 18  NANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFA 77
             +  TA+        +    ++ +  D YLR+ A+ +N RRRT +E+ D ++ +     
Sbjct: 52  TVDELTAQIDEARTALDAEKEKAAKATDSYLRLQADWDNYRRRTAQERLDERAVAAQNLV 111

Query: 78  RDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDA 137
             +L V D++ RAL  A                + ++G+     +++  L ++ V+ +D 
Sbjct: 112 VSVLPVIDDMERALSHAETIENKD-----ENFTNFVDGVLAVHDKLLGILAKHDVEVMDP 166

Query: 138 KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEK 197
             + F+P +H+A+ +  +  V A+T+  V + GY +  +V+R A+V+++ G  + P+E  
Sbjct: 167 AGEVFDPMIHEAVGQCQNPDVYADTVADVYRKGYRMAGKVIRTAMVTVTCGGPRRPSEPA 226

Query: 198 KETI 201
               
Sbjct: 227 DNAD 230


>gi|222623226|gb|EEE57358.1| hypothetical protein OsJ_07499 [Oryza sativa Japonica Group]
          Length = 332

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 42/220 (19%), Positives = 90/220 (40%), Gaps = 10/220 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E  +++      +      S   E+ S ++       +    RD+ LR+ A+ +N R+R 
Sbjct: 117 EALINDDETKVAEIEDFLFSIEEEKNSLLSKISTLGAELTTERDRILRISADFDNYRKRV 176

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           +REK    +    +    +L V DN  RA     ++              + +  +   +
Sbjct: 177 EREKLSLMTNVQGEVIESLLPVLDNFERAKTQIKVETEQET--------KINDSYQSIYK 228

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           + +  L   GV+ ++   + F+P +H+A+  E         I++  + G+ + ER+LRPA
Sbjct: 229 QFIDILNSLGVEDVETVGKPFDPMLHEAIMREESVEYEEGVILQEFRKGFKLGERLLRPA 288

Query: 182 LVSISKGKTQNPT--EEKKETIEQPSPLDIEERNKTQTKN 219
           +V +S G        ++     +  +P  ++E       +
Sbjct: 289 MVKVSAGPGPEKPVYDDPAMVEDSVAPQKVKEAEDDGFDD 328


>gi|103485747|ref|YP_615308.1| GrpE protein [Sphingopyxis alaskensis RB2256]
 gi|98975824|gb|ABF51975.1| GrpE protein [Sphingopyxis alaskensis RB2256]
          Length = 181

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 61/187 (32%), Positives = 103/187 (55%), Gaps = 6/187 (3%)

Query: 4   FMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDR 63
             ++  +D  +    A  +        +   +   Q    +   L   AE +N+RRR ++
Sbjct: 1   MENDTPVDDGQTDDAATETETAATEPQDEAAKLAEQLAAVQQDLLYARAETQNVRRRAEK 60

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           E  DA +Y+  +FARD+LSV+DNL RAL +      + E++++  +K L+ G+E T RE+
Sbjct: 61  EVADAHAYAATRFARDILSVADNLGRALAAL-----SDEQRADEAIKPLVTGLEATEREL 115

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
           M+  ER+G+ +I A     +PN HQAM E P       TI++ +Q GY + +R+LRPA+V
Sbjct: 116 MAVFERHGITRIAAIGLPLDPNQHQAMLEIP-SDKEPGTIVQEMQAGYMMKDRLLRPAMV 174

Query: 184 SISKGKT 190
           +++K   
Sbjct: 175 AVAKKAE 181


>gi|304320409|ref|YP_003854052.1| GrpE, heat shock protein [Parvularcula bermudensis HTCC2503]
 gi|303299311|gb|ADM08910.1| GrpE, heat shock protein [Parvularcula bermudensis HTCC2503]
          Length = 209

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 65/159 (40%), Positives = 100/159 (62%), Gaps = 3/159 (1%)

Query: 30  INIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSR 89
                E   + +  +++ LRV AE+EN RRR +RE++DA  Y I KFA D+LSV+DN SR
Sbjct: 50  EARIAEMQAEIDAQKEQLLRVAAELENTRRRAERERQDAAKYGITKFAGDLLSVADNFSR 109

Query: 90  ALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQA 149
           AL+ AP D + +       +  LI GI MT +E+++  ER G+ +ID K ++F+PN HQA
Sbjct: 110 ALELAPSDPSLASP---DQISGLINGIRMTEKELLTVFERNGISRIDPKGERFDPNQHQA 166

Query: 150 MFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           + + P +  P + ++ V   G+ I ERV+R A+V++S G
Sbjct: 167 IAQVPGNGEPKDHVVDVAAPGFIIGERVIRAAMVTVSTG 205


>gi|296114320|ref|ZP_06832974.1| chaperone binding protein [Gluconacetobacter hansenii ATCC 23769]
 gi|295979081|gb|EFG85805.1| chaperone binding protein [Gluconacetobacter hansenii ATCC 23769]
          Length = 209

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 66/189 (34%), Positives = 106/189 (56%), Gaps = 4/189 (2%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   S  +    +  + A  +T       +   E   +    R+K++R  AEM+NLR RT
Sbjct: 25  EGTQSPHDAAATEAEATAQGATETGAETPDRIAELEAEVAAMREKWVRAEAEMQNLRTRT 84

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
            RE +DA+ Y+  KFARD++  ++NL RAL S P    +     + ++KS+ EGIE T R
Sbjct: 85  KREIEDARQYATQKFARDVVEAAENLKRALASLPAPTEDE----DGIIKSMREGIESTER 140

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
             +  LER G+  +DA+ + F+ N HQAM E+  D  PA T+++     + ++ R+L+PA
Sbjct: 141 SFIGILERNGIVAVDAQGKPFDANQHQAMAEQHSDEHPAGTVMQAWTPAWTLHGRLLKPA 200

Query: 182 LVSISKGKT 190
           +V +SKG+ 
Sbjct: 201 MVVVSKGQA 209


>gi|186680668|ref|YP_001863864.1| heat shock protein GrpE [Nostoc punctiforme PCC 73102]
 gi|186463120|gb|ACC78921.1| GrpE protein [Nostoc punctiforme PCC 73102]
          Length = 225

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 53/199 (26%), Positives = 96/199 (48%), Gaps = 11/199 (5%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
           TF  E  +   +N     ++ AE        E    Q EE   +Y+R+ A+ EN R+RT 
Sbjct: 34  TFNPETGVAATENTGVETAALAELT---QQIESLKTQLEERSTQYMRIAADFENYRKRTS 90

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           +EK++ ++        ++L V DN  RA                       +  +   ++
Sbjct: 91  KEKEELETLMKRNTILELLPVVDNFERARSHLKPQSDGEMTMH--------KSYQGVYKQ 142

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           ++ +L+R GV  +  + Q+F+PN+H+A+  EP D  P  T+++ +  GY + ERVLR A+
Sbjct: 143 LVDSLKRLGVSPMRPEGQEFDPNLHEAVMREPTDEHPEGTVLEELVRGYYLGERVLRHAM 202

Query: 183 VSISKGKTQNPTEEKKETI 201
           V ++  K   P+ E+ ++ 
Sbjct: 203 VKVAAPKEDTPSTEEDQSS 221


>gi|197127343|gb|ACH43841.1| putative GrpE-like 1 mitochondrial precusor variant 3 [Taeniopygia
           guttata]
          Length = 222

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 53/180 (29%), Positives = 93/180 (51%), Gaps = 3/180 (1%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +    +         ++ EK       +   Q +E  +KY R +A+ EN+R+R+ +  ++
Sbjct: 44  EEDQSQSQNEQKVEPSSAEKLLAEEKAKLEEQLKEVTEKYKRALADAENVRQRSQKLVEE 103

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A+ Y I  F +D+L V+D L +A +S P +    E      LKSL EG+ MT  ++    
Sbjct: 104 AKLYGIQSFCKDLLEVADILEKATESVPREEIKDE---NPHLKSLYEGLVMTEMQIQKVF 160

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +++G+ +++    KF+P  H+A+F    +     TI  V + GY ++ R LRPALV + K
Sbjct: 161 KKHGLLRLNPVGAKFDPYEHEALFHTAVEGQEPGTIALVSKIGYKLHGRTLRPALVGVVK 220


>gi|126463640|ref|YP_001044754.1| Fis family transcriptional regulator [Rhodobacter sphaeroides ATCC
           17029]
 gi|221640716|ref|YP_002526978.1| GrpE protein [Rhodobacter sphaeroides KD131]
 gi|126105304|gb|ABN77982.1| transcriptional regulator, Fis family [Rhodobacter sphaeroides ATCC
           17029]
 gi|221161497|gb|ACM02477.1| GrpE protein [Rhodobacter sphaeroides KD131]
          Length = 186

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 65/184 (35%), Positives = 105/184 (57%), Gaps = 8/184 (4%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
            E   D+        +    E  EI+  E    + +E RD+++R +A+ EN R+R DR++
Sbjct: 7   DEMAEDQAPREETVEAPELSEAPEIDELETLRAERDELRDRFMRALADAENSRKRADRDR 66

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
           ++A+ Y   + ARD+L V DNLSRAL+ A  +         +   +LIEG+E+T RE+ +
Sbjct: 67  REAEQYGGTRLARDLLPVYDNLSRALEVATDEQR-------AAAAALIEGVELTLRELRN 119

Query: 126 TLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
            + ++GV+ I  +    F+P  HQAMFE P     A  II+V+ +G+ I++R+LRPA V 
Sbjct: 120 VMNKHGVRPISPQVGDTFDPQQHQAMFEAPVPGTKAGQIIQVMTEGFMIHDRLLRPAQVG 179

Query: 185 ISKG 188
           +S  
Sbjct: 180 VSSN 183


>gi|224050149|ref|XP_002197019.1| PREDICTED: putative GrpE-like 1 mitochondrial precusor variant 2
           [Taeniopygia guttata]
 gi|197127344|gb|ACH43842.1| putative GrpE-like 1 mitochondrial precusor variant 2 [Taeniopygia
           guttata]
          Length = 222

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 53/180 (29%), Positives = 93/180 (51%), Gaps = 3/180 (1%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +    +         ++ EK       +   Q +E  +KY R +A+ EN+R+R+ +  ++
Sbjct: 44  EEDQSQSQNEQKVEPSSAEKLLAEEKAKLEEQLKEVTEKYKRALADAENVRQRSQKLVEE 103

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A+ Y I  F +D+L V+D L +A +S P +    E      LKSL EG+ MT  ++    
Sbjct: 104 AKLYGIQSFCKDLLEVADILEKATESVPKEEIKDE---NPHLKSLYEGLVMTEMQIQKVF 160

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +++G+ +++    KF+P  H+A+F    +     TI  V + GY ++ R LRPALV + K
Sbjct: 161 KKHGLLRLNPVGAKFDPYEHEALFHTAVEGQEPGTIALVSKIGYKLHGRTLRPALVGVVK 220


>gi|48525529|gb|AAT45012.1| GrpE1 [Saccharum hybrid cultivar SP80-3280]
          Length = 294

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 58/183 (31%), Positives = 100/183 (54%), Gaps = 5/183 (2%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +  D E    +          +    +    + ++ +DK LR  AEMEN+  RT RE ++
Sbjct: 97  QEADSEDLDLSKEDLVKLLLEKDESLKSKDEEFKDMKDKVLRSYAEMENVLARTKRESEN 156

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESV-----LKSLIEGIEMTRRE 122
            + Y+I  F++ +L V+DNLSRA        +  +  +        LK+L+EG+EMT ++
Sbjct: 157 TKKYAIQSFSKSLLDVADNLSRASSVVKESFSKIDSSNNFDEAVPLLKTLLEGVEMTEKQ 216

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           +    +++GV+K D  ++KF+PN H A F+    + P+ T+  VV+ GY +++RVLRPA 
Sbjct: 217 LGEVFKKFGVEKFDPLNEKFDPNRHYAFFQIHDPSKPSGTVAAVVKVGYMLHDRVLRPAE 276

Query: 183 VSI 185
           V +
Sbjct: 277 VGV 279


>gi|91793923|ref|YP_563574.1| GrpE protein [Shewanella denitrificans OS217]
 gi|123165920|sp|Q12L25|GRPE_SHEDO RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|91715925|gb|ABE55851.1| GrpE protein [Shewanella denitrificans OS217]
          Length = 201

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 57/189 (30%), Positives = 104/189 (55%), Gaps = 8/189 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E    E   D+         +    +    +  ES     E +D  +R  AE +N+R R 
Sbjct: 15  EALTQEVAQDEASLMDELTQANFRVEELEQLLAESQAALAERKDVEMRAAAETQNIRTRA 74

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
            ++ + A+ +++ KFA ++L V DN+ RAL              +   K++ EG+E+T +
Sbjct: 75  AKDVEQARKFALEKFANELLPVIDNMERALQ--------GTNPEDEATKAIYEGVELTMK 126

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
             ++++E++GVK+++ + + FNP+ HQA+  +P    PANT++ V+Q GY +N+R+LRPA
Sbjct: 127 GFLTSVEKFGVKQVNPQGETFNPDHHQAIGMQPSPDFPANTVMMVMQKGYLLNDRLLRPA 186

Query: 182 LVSISKGKT 190
           +V +S+G  
Sbjct: 187 MVMVSQGGP 195


>gi|240849047|ref|NP_001155829.1| GrpE protein homolog, mitochondrial [Acyrthosiphon pisum]
 gi|239789346|dbj|BAH71303.1| ACYPI010003 [Acyrthosiphon pisum]
          Length = 222

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 59/188 (31%), Positives = 105/188 (55%), Gaps = 3/188 (1%)

Query: 4   FMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDR 63
            MS+   D+ K     +    + ++ +   E+   +++   +K  R +AE EN+R+RT +
Sbjct: 38  KMSDAAADECKEQLKGSKDKIDIEALVKQNEDLHEENKNLTEKVRRYLAETENIRKRTIK 97

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           E  DA+ Y+I  F +D+L V+D+LS+A +  P +       S   LK L EG+  T  ++
Sbjct: 98  ETADAKIYAIQGFCKDLLDVADSLSKATECVPKEAV---CDSNPHLKHLYEGLVTTESQL 154

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
            +  +R+G+  I+  ++KF+PN H+A+FE+  +      ++ V Q GY ++ER++R A V
Sbjct: 155 QTIFQRHGLMSINPLNEKFDPNSHKALFEQVVEGKEGGIVVVVSQIGYKLHERIVRAAAV 214

Query: 184 SISKGKTQ 191
            ISK   Q
Sbjct: 215 GISKEPNQ 222


>gi|51891641|ref|YP_074332.1| heat-shock protein [Symbiobacterium thermophilum IAM 14863]
 gi|51855330|dbj|BAD39488.1| heat-shock protein [Symbiobacterium thermophilum IAM 14863]
          Length = 206

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 47/174 (27%), Positives = 83/174 (47%), Gaps = 10/174 (5%)

Query: 12  KEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
            E    +   + A         E   ++  E  D+ +R+ A+ EN RRR  REK++   Y
Sbjct: 39  PEAGADSEAPAEAAVDGAPGEAEPEADRVAELMDRLIRLQADFENYRRRVQREKEEIAQY 98

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
              +   ++L V DNL RAL + P              + L +G+E+T R  +  L + G
Sbjct: 99  GTQRLLINLLPVLDNLERALATPPNPGD----------ERLRQGVELTARSFLEVLAKEG 148

Query: 132 VKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
           VK I+A  Q F+P++H+A+            +++  + GY + +RV+R ++V +
Sbjct: 149 VKPIEAVGQPFDPHLHEAVMTGDDPDKEEGIVLEEFRKGYMLGDRVIRASMVKV 202


>gi|87120232|ref|ZP_01076127.1| heat shock protein GrpE [Marinomonas sp. MED121]
 gi|86164335|gb|EAQ65605.1| heat shock protein GrpE [Marinomonas sp. MED121]
          Length = 185

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 54/181 (29%), Positives = 99/181 (54%), Gaps = 11/181 (6%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +   + +     +      + +      +L + EE+++  LR  A+ +N+RRR +++ + 
Sbjct: 15  ETAAENEEVLQEDGQVESAQDDNPELVAALAKVEEYKEAALRSHADAQNVRRRAEQDVQK 74

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A  + + KFA+D+++V+DNL RAL SA  D             ++ EG+E+T + +  TL
Sbjct: 75  AHKFGLEKFAKDIITVADNLERALTSADSDND-----------AMREGVELTLKSLQETL 123

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            R+ V  +D   + FNP  HQAM   P+  +  NT++ V+Q GY ++ R++RPA+V +S 
Sbjct: 124 TRFEVIALDPHGEPFNPEFHQAMTMVPNPEMEPNTVMDVIQKGYTLHGRLIRPAMVVVSS 183

Query: 188 G 188
            
Sbjct: 184 A 184


>gi|301781806|ref|XP_002926319.1| PREDICTED: grpE protein homolog 1, mitochondrial-like [Ailuropoda
           melanoleuca]
          Length = 217

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 54/185 (29%), Positives = 100/185 (54%), Gaps = 4/185 (2%)

Query: 4   FMSEKNIDKEKNPSNANSST-AEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
             + +N++++   +     T + EK  ++   +   Q +E  DKY R +A+ ENLR+R+ 
Sbjct: 34  KNNGQNLEEDVGQNEQKPDTPSPEKILMDEKVKLEEQLKETVDKYKRALADTENLRQRSQ 93

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           +  ++A+ Y I  F +D+L V+D L +A  S P +    +      LK+L EG+ MT  +
Sbjct: 94  KLVEEAKLYGIQGFCKDLLEVADILEKATQSVPKEEVKDD---NPHLKNLYEGLIMTEVQ 150

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           +     ++G+ +++    +F+P  H+A+F  P +     T+  V + GY ++ R LRPAL
Sbjct: 151 IQKVFTKHGLLRLNPVGARFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPAL 210

Query: 183 VSISK 187
           V + K
Sbjct: 211 VGVVK 215


>gi|254283763|ref|ZP_04958731.1| co-chaperone GrpE [gamma proteobacterium NOR51-B]
 gi|219679966|gb|EED36315.1| co-chaperone GrpE [gamma proteobacterium NOR51-B]
          Length = 214

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 55/189 (29%), Positives = 100/189 (52%), Gaps = 9/189 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   + +   +  NP+N   + + E +     E    +    R+  LR  A+  N RRR 
Sbjct: 35  EVLETGEAAAESDNPTNEPDAISGESAPDATIERLEAELATAREDALRAQADSINARRRA 94

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           ++E + A+ +++ +F  ++L V DNL RAL +A  D  N         ++++EGIE+T +
Sbjct: 95  EQEVEKARKFALERFIGELLPVVDNLERALQAAGGDDQN---------RAVVEGIELTLK 145

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
                L + GV+ ++ + + ++P   QAM    +  +  NT++ V+Q GY +N R+LRPA
Sbjct: 146 SFTDALSKSGVEALNPEGEPYDPQTAQAMSMVENADMEPNTVVAVMQKGYQLNGRLLRPA 205

Query: 182 LVSISKGKT 190
           +V +SK  +
Sbjct: 206 MVMVSKAAS 214


>gi|194476883|ref|YP_002049062.1| Heat shock protein GrpE [Paulinella chromatophora]
 gi|171191890|gb|ACB42852.1| Heat shock protein GrpE [Paulinella chromatophora]
          Length = 242

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 44/196 (22%), Positives = 87/196 (44%), Gaps = 8/196 (4%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
              SE+N +        ++   + +          +  E  + +Y+R+ A+ +N R+R  
Sbjct: 40  KDESEQNENHTNTEVINDNPAQDIEQLQKAYSILSHDHEILKGQYMRIAADFDNFRKRQT 99

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           R+++D +   I      +L + DN  RA                   + L    +   ++
Sbjct: 100 RDQEDLRLQLICSNLEAILPIVDNFERARQQLD--------PQTEEGQGLHLSYQGLYKQ 151

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           ++  L++ GV  +  + + F+PN+H+A+  EP D    + II+ +Q GY ++ RVLR AL
Sbjct: 152 LVDVLKQLGVAPMRVEGESFDPNLHEAILREPSDIYSEDIIIEELQRGYHLSGRVLRHAL 211

Query: 183 VSISKGKTQNPTEEKK 198
           V +S G     + +  
Sbjct: 212 VKVSMGPGCQTSPDDS 227


>gi|94970270|ref|YP_592318.1| GrpE protein [Candidatus Koribacter versatilis Ellin345]
 gi|94552320|gb|ABF42244.1| GrpE protein [Candidatus Koribacter versatilis Ellin345]
          Length = 181

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 56/185 (30%), Positives = 95/185 (51%), Gaps = 12/185 (6%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
            +E+ +D E     A + TA   ++    E    + +++ D+  R+ AE +N R+R  RE
Sbjct: 9   ETEEQLDVEHELPAAENETAATSAD-AEIEALRKERDQYLDRLARLQAEFDNFRKRNARE 67

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
           ++D + Y++    +  L + D+L  A  S               L  +  GIE+  R+  
Sbjct: 68  QQDYRDYAVVDALKTFLPILDSLDGAAKS-----------DAQDLDQIRSGIELIDRQFH 116

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
             L + GV+ I A+ Q F+PN+H A+  E  D  P NT+I  +Q GY I +R+LRPA+V 
Sbjct: 117 DALAKLGVQPIPAEGQPFDPNLHMAIAMEDTDAAPDNTVIGELQRGYKIKDRLLRPAMVR 176

Query: 185 ISKGK 189
           +++ K
Sbjct: 177 VARSK 181


>gi|260576119|ref|ZP_05844112.1| GrpE protein [Rhodobacter sp. SW2]
 gi|259021599|gb|EEW24902.1| GrpE protein [Rhodobacter sp. SW2]
          Length = 186

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 62/193 (32%), Positives = 102/193 (52%), Gaps = 8/193 (4%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           M+    +   D +    +      E+    +  +    + +E RD+++R +A+ EN R+R
Sbjct: 1   MDDTRKDDMADDQAVAEDLEPEEIEDYIGADELDALRAERDELRDRFMRALADAENARKR 60

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
            +R++++A+ Y   + ARDML V DNL RALD    +             +L+EGIE+T 
Sbjct: 61  GERDRREAEQYGGTRLARDMLPVYDNLRRALDVISEEQR-------EGSAALVEGIELTL 113

Query: 121 REMMSTLERYGVKKIDA-KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
           REM + L ++GV  I       F+P  HQAMFE P     A  II+V+ +G+ +++R+LR
Sbjct: 114 REMQNVLTKHGVTVIAPAIGDVFDPQRHQAMFEAPVAGTKAGQIIQVMTEGFLLHDRLLR 173

Query: 180 PALVSISKGKTQN 192
           PA V +S   +  
Sbjct: 174 PAQVGVSSNTSGE 186


>gi|255019874|ref|ZP_05291949.1| Heat shock protein GrpE [Acidithiobacillus caldus ATCC 51756]
 gi|254970654|gb|EET28141.1| Heat shock protein GrpE [Acidithiobacillus caldus ATCC 51756]
          Length = 192

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 57/199 (28%), Positives = 107/199 (53%), Gaps = 10/199 (5%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPE-ESLNQSEEFRDKYLRVIAEMENLRRRTDR 63
           M+E     ++    A +    + ++   PE     Q+E++R+ YLR +A+MENLR+R +R
Sbjct: 1   MTEAEQQDQQGTEKAAAEGVGKDADAAQPEPNWQEQAEQYRNDYLRALADMENLRKRLER 60

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           + +DA++Y++ +FAR++L V D+L  AL +               +  L +G+E T    
Sbjct: 61  QMEDARNYAVERFARELLPVVDSLELALST--------PVAGGEGVAQLRQGLENTLSLF 112

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
              L + GV  ++A+  +F+P+ HQA+     +    N ++ V Q GY I++R+LRPA+V
Sbjct: 113 FQALAKAGVAPVEAEAARFDPHRHQAIAMVEAEG-EPNRVLAVHQKGYVIHDRLLRPAMV 171

Query: 184 SISKGKTQNPTEEKKETIE 202
           +++K  +     +     +
Sbjct: 172 TVAKAASGEAGRDPGSDSQ 190


>gi|330991342|ref|ZP_08315293.1| Protein grpE [Gluconacetobacter sp. SXCC-1]
 gi|329761361|gb|EGG77854.1| Protein grpE [Gluconacetobacter sp. SXCC-1]
          Length = 201

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 63/179 (35%), Positives = 99/179 (55%), Gaps = 4/179 (2%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
             P    ++ A+E        E   +    RDK++R  AE +N+R R  RE +DA+ Y++
Sbjct: 26  AQPEAPGAAPAQESPVDARIAELEAEVAALRDKWVRAEAETQNVRSRAKREVEDARQYAV 85

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
            KFA+D++  +DNL RA+ S P          +S+L  + EGIE T R  +  LER G+K
Sbjct: 86  QKFAKDVVEAADNLKRAVASLPPATEGE----DSLLTRMREGIESTERSFVGILERNGIK 141

Query: 134 KIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQN 192
             DAK + F+ N+HQAM E+  D     T+++     + ++ R+L+PA+V +SKG  Q 
Sbjct: 142 AEDAKGKPFDANLHQAMSEQHSDEHGHGTVMEAWTPAWTLHGRLLKPAMVVVSKGPAQA 200


>gi|118097295|ref|XP_001231561.1| PREDICTED: hypothetical protein [Gallus gallus]
          Length = 222

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 41/173 (23%), Positives = 85/173 (49%), Gaps = 2/173 (1%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
           ++P +       + +  +   +   Q  +  ++Y + +A+ EN+RRRT +  +DA+ + I
Sbjct: 47  EDPRDEPKHPLSDCALEHKAIKLEEQVRDLTERYRKALADSENVRRRTQKFVEDAKLFGI 106

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
             F RD++ V+D L     +               L+ + EG+ +   ++ S   ++G++
Sbjct: 107 QSFCRDLVEVADILE--KTAESAAEEAEPTNPNPTLQKIYEGLSLIEAKLQSVFAKHGLQ 164

Query: 134 KIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           K+     K++P  H+ +   P + +   TI  V QDGY ++ R +R ALV ++
Sbjct: 165 KMSPVGDKYDPYDHEIVCHVPAEGMQPGTIALVTQDGYKLHGRTIRHALVGVA 217


>gi|239814719|ref|YP_002943629.1| heat shock protein GrpE [Variovorax paradoxus S110]
 gi|239801296|gb|ACS18363.1| GrpE protein [Variovorax paradoxus S110]
          Length = 179

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 55/159 (34%), Positives = 85/159 (53%), Gaps = 12/159 (7%)

Query: 32  IPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRAL 91
                  ++ E  D+YLR  A+++N RRR D E   A+ +++  FA  +L V+D+L   L
Sbjct: 32  ELAALQAKNAELSDQYLRAQADVQNARRRADDEITKARKFAVEAFAESLLPVTDSLEAGL 91

Query: 92  DSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG-VKKIDAKDQKFNPNMHQAM 150
                         ++  + + EG E T R++ S LER   ++   A   KF+P+ HQA+
Sbjct: 92  AV-----------KDATPEQIREGAEATLRQLKSALERNKVIEVAPAPGAKFDPHQHQAI 140

Query: 151 FEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
              P      NT++ V+Q GY IN+RVLRPALV++S  K
Sbjct: 141 SVVPAPEQEPNTVVTVLQKGYTINDRVLRPALVTVSAPK 179


>gi|118777122|ref|XP_307508.3| Anopheles gambiae str. PEST AGAP012770-PA [Anopheles gambiae str.
           PEST]
 gi|116133044|gb|EAA03306.3| AGAP012770-PA [Anopheles gambiae str. PEST]
          Length = 204

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 61/182 (33%), Positives = 106/182 (58%), Gaps = 4/182 (2%)

Query: 4   FMSEKNIDKEKNPSNANSSTAEEKSEI-NIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
           F +EK+  + + P+        E  E+     E   + +   DKY R +AE EN+RRR  
Sbjct: 26  FSTEKDTARVEEPTENEKKLTVEVEELRKEAAELTEKVKSLDDKYKRALAESENIRRRLT 85

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           ++  DA+ + I  F +D+L V+D L  A ++ P D  + +      LK+L EG+ MTR++
Sbjct: 86  KQIDDAKLFGIQGFCKDLLEVADILGHATEAVPKDEISDK---NPHLKNLFEGLSMTRQQ 142

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           + S  +R+G++ ++  ++KFNPN+H+A+F++    V  NT + V + GY +++R +RPAL
Sbjct: 143 LNSVFKRHGLETVNPMNEKFNPNLHEALFQQEVANVEPNTGVVVSKIGYKLHDRCIRPAL 202

Query: 183 VS 184
           V 
Sbjct: 203 VG 204


>gi|114048297|ref|YP_738847.1| heat shock protein GrpE [Shewanella sp. MR-7]
 gi|122944499|sp|Q0HSW5|GRPE_SHESR RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|113889739|gb|ABI43790.1| GrpE protein [Shewanella sp. MR-7]
          Length = 203

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 60/192 (31%), Positives = 106/192 (55%), Gaps = 8/192 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   SE + ++         +    +    +  ++L + EE +D  +R  AE++N+RRR 
Sbjct: 15  EGVESEVSTEEASLIDELTQANFRIEELEQLLADALAKVEEQKDSVIRAAAEVDNIRRRA 74

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
             + + A  +++ KFA ++L V DN+ RAL              +   K++ EG+E+T++
Sbjct: 75  AMDVEKANKFALEKFANELLPVLDNMERALQ--------GTNPQDETTKAIYEGVELTQK 126

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
             ++ + ++GVK ID + Q FNP+ HQA+  +P    PANT++ V+Q GY +N R+LRPA
Sbjct: 127 SFLTAVAKFGVKPIDPQGQAFNPDQHQAIGMQPSAEYPANTVMLVMQKGYELNSRLLRPA 186

Query: 182 LVSISKGKTQNP 193
           +V +S+G     
Sbjct: 187 MVMVSQGGPSQE 198


>gi|212212324|ref|YP_002303260.1| heat shock protein GrpE [Coxiella burnetii CbuG_Q212]
 gi|212010734|gb|ACJ18115.1| GrpE [Coxiella burnetii CbuG_Q212]
          Length = 210

 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 52/179 (29%), Positives = 92/179 (51%), Gaps = 9/179 (5%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           +  +E  P          +           + +E++ +YLR  AEM+NLR+R +REK D 
Sbjct: 39  DGSQEMEPHRDGLEFPSREKLEGQLTRMERKVDEYKTQYLRAQAEMDNLRKRIEREKADI 98

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
             +   +   D+L V+D+L   L+S   +        +  +KS+ +G+ +T   + +TL 
Sbjct: 99  IKFGSKQLITDLLPVADSLIHGLESPASE--------DPQVKSMRDGMSLTLDLLHNTLA 150

Query: 129 RYGVKKIDA-KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           ++GV+ I+      F+P +H+AM  +       +TII+V+Q GY +N RVLR A V ++
Sbjct: 151 KHGVQVINPNPGDPFDPALHEAMSVQAVPDAKPDTIIQVLQKGYQLNGRVLRAARVIVA 209


>gi|4455201|emb|CAB36524.1| grpE like protein [Arabidopsis thaliana]
 gi|7269530|emb|CAB79533.1| grpE like protein [Arabidopsis thaliana]
          Length = 311

 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 53/166 (31%), Positives = 99/166 (59%), Gaps = 5/166 (3%)

Query: 40  SEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPL--- 96
            ++ +DK LR  AEMEN+  RT R+ ++ + Y++  FA+ +L V+DNL RA         
Sbjct: 146 IKQLKDKVLRTYAEMENVMDRTRRDAENTKKYAVQNFAKSLLDVADNLGRASSVVKESFS 205

Query: 97  --DLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEP 154
             D +     +  +LK+L+EG+EMT +++    +++G++K D  ++ F+PN H A+F+ P
Sbjct: 206 KLDTSEDSAGAAPLLKTLLEGVEMTEKQLAEVFKKFGMEKYDPINEPFDPNRHNAVFQVP 265

Query: 155 HDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKET 200
             + P  T+  V++ GY + +RV+RPA V +++G      +++ + 
Sbjct: 266 DASKPEGTVAHVLKSGYTLYDRVIRPAEVGVTQGGENQEEKKESDA 311


>gi|332140812|ref|YP_004426550.1| heat shock protein GrpE [Alteromonas macleodii str. 'Deep ecotype']
 gi|327550834|gb|AEA97552.1| heat shock protein GrpE [Alteromonas macleodii str. 'Deep ecotype']
          Length = 207

 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 57/193 (29%), Positives = 99/193 (51%), Gaps = 8/193 (4%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
              +    E      + +            E+    +E +D  LR  A+ +N RRR + E
Sbjct: 23  EEAQVETSEAEGVELDENAQRIYELETALSEAQATIKEQQDGVLRARADADNARRRAEGE 82

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
            + A+ +++ +FA ++L V DNL RA++    D           +K L+EG+EMT +  +
Sbjct: 83  VEKARKFALERFAGELLPVIDNLERAIEMTDGD--------NEAVKPLLEGVEMTHKTFL 134

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
            T+E++G+  ID + + FNP++HQAM  +       NT++ V+Q GY IN R+LRPA+V 
Sbjct: 135 GTIEKFGLSLIDPQGETFNPDLHQAMSMQESADHEPNTVMAVMQKGYQINGRLLRPAMVM 194

Query: 185 ISKGKTQNPTEEK 197
           +S+  +     + 
Sbjct: 195 VSRAPSDGVDTQA 207


>gi|319787254|ref|YP_004146729.1| GrpE protein [Pseudoxanthomonas suwonensis 11-1]
 gi|317465766|gb|ADV27498.1| GrpE protein [Pseudoxanthomonas suwonensis 11-1]
          Length = 171

 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 52/183 (28%), Positives = 89/183 (48%), Gaps = 14/183 (7%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           M+E +         +  +   E       E    + E+ R   LR  A++EN R+R  R+
Sbjct: 1   MTEHDTQ----SPQSQDAEGLEAQLRGEIEALRGEIEQLRMDSLRERADLENQRKRVARD 56

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
            + A+ ++  K   ++L V D+L   L +A  +  N           L EG+E+T+R+++
Sbjct: 57  IEQARRFANEKLLGELLPVLDSLDAGLAAAGTEEGNP----------LREGLELTKRQLL 106

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
                 G+  +D   Q FNP  HQA+ +         T+++V Q GY +NER+LRPALV 
Sbjct: 107 KVATDNGLVVVDPAGQAFNPEHHQAISQADPGEAAPGTVLQVFQKGYLLNERLLRPALVV 166

Query: 185 ISK 187
           +++
Sbjct: 167 VAR 169


>gi|224133294|ref|XP_002321532.1| predicted protein [Populus trichocarpa]
 gi|222868528|gb|EEF05659.1| predicted protein [Populus trichocarpa]
          Length = 265

 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 56/183 (30%), Positives = 104/183 (56%), Gaps = 5/183 (2%)

Query: 20  NSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARD 79
           +        +  + E    + E  +DK LR  AEMEN++ RT RE ++++ ++I  FA+ 
Sbjct: 83  DDLVKLVAEKEELLEAKHKEIETIQDKVLRAYAEMENVKERTKREAENSKKFAIQNFAKS 142

Query: 80  MLSVSDNLSRALDSAPL-----DLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKK 134
           +L V+DNL RA           D++N   +   +LK+L+EG+EMT +++    ++YG++K
Sbjct: 143 LLDVADNLGRASSVVKGNFSKIDVSNDTAQVVPLLKTLLEGVEMTEKQLGEVFKKYGIEK 202

Query: 135 IDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPT 194
            D  ++ F+P+ H A+F+ P  + P  T+  V++ GY +++RV+RPA V +++       
Sbjct: 203 FDPTNEPFDPHRHNAIFQVPDASKPPGTVAAVLKAGYMLHDRVIRPAEVGVTREVENGAE 262

Query: 195 EEK 197
             +
Sbjct: 263 ANE 265


>gi|320103113|ref|YP_004178704.1| GrpE protein [Isosphaera pallida ATCC 43644]
 gi|319750395|gb|ADV62155.1| GrpE protein [Isosphaera pallida ATCC 43644]
          Length = 202

 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 49/172 (28%), Positives = 88/172 (51%), Gaps = 5/172 (2%)

Query: 21  SSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDM 80
            + A E            + +E RDK  R +A+  N ++R   + +    Y++   A ++
Sbjct: 35  QNQAVENPLAAELARVTQERDELRDKLQRTLADHVNFQKRARAQAELEIKYAVGPLAAEL 94

Query: 81  LSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQ 140
           L V DNL RALD+     ++          SL +G+ M  ++++  L ++GVK I A  Q
Sbjct: 95  LQVVDNLERALDAVDASASD-----HPATASLRDGVAMVHKQLLDILNKHGVKPIVALHQ 149

Query: 141 KFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQN 192
            F+P+ H+A+  +P    PA T++   + GY  ++R+LRPA V ++   +Q+
Sbjct: 150 PFDPHHHEALTNQPSSDHPAGTVLHEHRKGYLHHDRLLRPAQVVVACDPSQS 201


>gi|254483127|ref|ZP_05096361.1| co-chaperone GrpE [marine gamma proteobacterium HTCC2148]
 gi|214036649|gb|EEB77322.1| co-chaperone GrpE [marine gamma proteobacterium HTCC2148]
          Length = 201

 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 56/188 (29%), Positives = 101/188 (53%), Gaps = 8/188 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E  +           ++A +    E S  +   +        RD  LR  A+ +N++RR 
Sbjct: 22  EAQLETAEEVAAAEAADAGAEGDTEASLDDELSQLQEDLLTARDAALRAQADAQNVKRRA 81

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           +++ + A+ +++ +FA D+L V DNL RAL++A  D        +  +K + EG+E+T +
Sbjct: 82  EQDVEKARKFALERFASDLLPVVDNLERALEAASGD--------DEAIKPIAEGVELTLK 133

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
             +  L +  V  +D + + F+PN+HQA+    +  V  NT+  V+Q GY++N R++RPA
Sbjct: 134 SFIDVLGKNKVDVVDPQGEPFDPNLHQAITMIENKEVEPNTVTAVMQKGYSLNGRLIRPA 193

Query: 182 LVSISKGK 189
           +V +SKG 
Sbjct: 194 MVMVSKGG 201


>gi|320353049|ref|YP_004194388.1| GrpE protein [Desulfobulbus propionicus DSM 2032]
 gi|320121551|gb|ADW17097.1| GrpE protein [Desulfobulbus propionicus DSM 2032]
          Length = 196

 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 59/188 (31%), Positives = 104/188 (55%), Gaps = 4/188 (2%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
            ++  +   + S+  + T E+ +  +  E    Q +E RD+ +R+ AE EN ++R +RE+
Sbjct: 13  EQQTTEAPADLSDVETITGEDSTPESEAETLQRQLDESRDQLMRIAAEFENYKKRMERER 72

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
                Y+     RD+L+  DNL RA++    +  +        L+++++GIE+TR+ +++
Sbjct: 73  GKLLKYAGENILRDLLTTLDNLDRAVEQGNAEAEDD----SKKLEAMLQGIELTRKGLVA 128

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
           T+ERYGV+ + A    FNP+ H A+  E  D VPAN +++    GY   +RVLR A V +
Sbjct: 129 TMERYGVEPLAAIGLSFNPDEHDALTMEASDEVPANHVLREFAKGYRFKDRVLRHAQVVV 188

Query: 186 SKGKTQNP 193
           S G  +  
Sbjct: 189 SSGPGKAA 196


>gi|295691342|ref|YP_003595035.1| GrpE protein [Caulobacter segnis ATCC 21756]
 gi|295433245|gb|ADG12417.1| GrpE protein [Caulobacter segnis ATCC 21756]
          Length = 207

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 70/205 (34%), Positives = 116/205 (56%), Gaps = 7/205 (3%)

Query: 13  EKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYS 72
               + A  +T E +      E    +    +++ LR  AE EN +RR +RE  DA++Y+
Sbjct: 2   TDEQTPAEDTTFETEDLAQEVEALKAEVAALKEQALRYAAEAENTKRRAEREMNDARAYA 61

Query: 73  IAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGV 132
           I KFARD+L  +DNL+RA   +P D A+       V+K+ + G+EMT +E+++  ER G+
Sbjct: 62  IQKFARDLLGAADNLARATAHSPRDSADP------VVKNFVIGVEMTEKELLTAFERNGL 115

Query: 133 KKIDA-KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQ 191
           KKID  K +KF+P++HQAM E+P D V A  ++ V+Q GY +  R++RPA+V+++   + 
Sbjct: 116 KKIDPAKGEKFDPHLHQAMMEQPSDEVAAGGVVAVLQAGYELMGRLVRPAMVAVAAKGST 175

Query: 192 NPTEEKKETIEQPSPLDIEERNKTQ 216
            P   +      P      + + + 
Sbjct: 176 GPAAAEASVGGNPYAEAASDADGSG 200


>gi|149702916|ref|XP_001501567.1| PREDICTED: similar to GrpE-like 1, mitochondrial (E. coli) [Equus
           caballus]
          Length = 217

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 51/172 (29%), Positives = 88/172 (51%), Gaps = 3/172 (1%)

Query: 16  PSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAK 75
                   + EK  +        Q +E  +KY R +A+ ENLR+R+ +  ++A+ Y I  
Sbjct: 47  NEQKTDPPSTEKMLMEEKVRLEEQLKETMEKYKRALADTENLRQRSQKLVEEAKLYGIQG 106

Query: 76  FARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI 135
           F +D+L V+D L +A    P +    +      LK+L EG+ MT  ++     ++G+ ++
Sbjct: 107 FCKDLLEVADILEKATQCVPKEEIKDD---NPHLKNLYEGLVMTEVQIQKVFTKHGLLRL 163

Query: 136 DAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +    KF+P  H+A+F  P +     T+  V + GY ++ R LRPALV + K
Sbjct: 164 NPLGAKFDPYEHEALFHTPVEGKEPGTVALVNKVGYKLHGRTLRPALVGVVK 215


>gi|324111249|gb|EGC05231.1| GrpE protein [Escherichia fergusonii B253]
          Length = 283

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 57/190 (30%), Positives = 99/190 (52%), Gaps = 9/190 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR-DKYLRVIAEMENLRRR 60
           E  M +    +   P  +         +I   E  L +++    D  LRV AEMENLRRR
Sbjct: 102 EIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLRRR 161

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+ + + A  +++ KF  ++L V D+L RAL+ A              + +++EGIE+T 
Sbjct: 162 TELDIEKAHKFALEKFINELLPVIDSLDRALEVADKA--------NPDMSAMVEGIELTL 213

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + M+  + ++GV+ I   +   +PN+HQA+     D V    ++ ++Q GY +N R +R 
Sbjct: 214 KSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRA 273

Query: 181 ALVSISKGKT 190
           A+V+++K K 
Sbjct: 274 AMVTVAKAKA 283


>gi|84514909|ref|ZP_01002272.1| co-chaperone GrpE [Loktanella vestfoldensis SKA53]
 gi|84511068|gb|EAQ07522.1| co-chaperone GrpE [Loktanella vestfoldensis SKA53]
          Length = 184

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 64/179 (35%), Positives = 107/179 (59%), Gaps = 8/179 (4%)

Query: 13  EKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYS 72
           ++  +  +      ++ I   E    + +EFRDK++R +A+ EN R+R DR++++A++Y 
Sbjct: 12  DEMAAEGDMMDQAPEAGIEELEALRAERDEFRDKFMRALADAENTRKRADRDRREAENYG 71

Query: 73  IAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGV 132
            A+FARDML + DNL RAL SA             + K+L+EG+E+T RE++S  +++G+
Sbjct: 72  SARFARDMLPIYDNLRRALMSADEAEQ-------DINKALLEGVELTMRELISVFKKHGI 124

Query: 133 KKI-DAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
             I      +F+P +HQAMFE P     A  II+V  +G+ +++R+LRPA V +S    
Sbjct: 125 DPIVPQVGDRFDPQLHQAMFEAPLPGTKAGDIIQVAAEGFMLHDRLLRPAQVGVSSTPA 183


>gi|95931198|ref|ZP_01313920.1| GrpE protein [Desulfuromonas acetoxidans DSM 684]
 gi|95132760|gb|EAT14437.1| GrpE protein [Desulfuromonas acetoxidans DSM 684]
          Length = 202

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 64/194 (32%), Positives = 106/194 (54%), Gaps = 8/194 (4%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
             E      K+    +       +     E+S N+ E+ +++YLR  AEMEN RRR  RE
Sbjct: 17  EPEIVEATPKDAPAPSEEADALDALKAELEQSRNEVEQQKEQYLRTRAEMENFRRRMQRE 76

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
           K++   ++     R++L V DNL RA+  A  + A++         SL++G+EMT  +  
Sbjct: 77  KEELSKFANESILREILPVIDNLERAVCHARENEADAS--------SLLDGVEMTLSQFQ 128

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
             LE++ V  +DA+ + F+P+ H+AM ++ +     NT+++V+Q GY +N+R+LRPALV 
Sbjct: 129 KVLEKFNVIPVDAQGKPFDPSCHEAMGQQENADCEPNTVVQVLQSGYMLNDRLLRPALVM 188

Query: 185 ISKGKTQNPTEEKK 198
           +SK       E  K
Sbjct: 189 VSKAAASQEAEADK 202


>gi|331214714|ref|XP_003320038.1| protein grpE [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
 gi|309299028|gb|EFP75619.1| protein grpE [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
          Length = 253

 Score =  119 bits (297), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 54/193 (27%), Positives = 92/193 (47%), Gaps = 13/193 (6%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
                 +    ++   +  +  +   +   Q  E++D Y+R  A+ ENL++ T REK  A
Sbjct: 57  QTADASSSDPTSTQNKKTLTVEDQLAQKDAQLNEYKDLYIRARADFENLQKITSREKAQA 116

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPL-------------DLANSEKKSESVLKSLIEG 115
           + Y+I  FARD++S  D L  AL+S P                     +S   L  L  G
Sbjct: 117 KEYAIQGFARDLVSNIDVLQLALNSVPEPLRTVQEDATTTTSTTEGAPESRKHLADLWAG 176

Query: 116 IEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINE 175
           ++ T+  +  TL  YGV   +   Q+F+PN H+AM++        N+++   + G+ + +
Sbjct: 177 VQSTKSLLEKTLALYGVTPFNPVGQQFDPNRHEAMYQAQVPGKEPNSVLNCSKVGWMLRD 236

Query: 176 RVLRPALVSISKG 188
           RVLRPA V + +G
Sbjct: 237 RVLRPAQVGVVQG 249


>gi|283852173|ref|ZP_06369446.1| GrpE protein [Desulfovibrio sp. FW1012B]
 gi|283572399|gb|EFC20386.1| GrpE protein [Desulfovibrio sp. FW1012B]
          Length = 175

 Score =  119 bits (297), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 49/183 (26%), Positives = 84/183 (45%), Gaps = 9/183 (4%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           M+      E   +   ++     +                D+ LR +AE ENL++R  +E
Sbjct: 1   MAPDEKLSEAQATPEGAADTPAPTLEEEVAALRAALAAESDRRLRSLAETENLKKRLLKE 60

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
           K++ Q Y+      +++ V D+L  AL                  K  + G++MTR+  +
Sbjct: 61  KEEFQKYATESLVAELVPVLDHLDLALAHGRG---------NDACKDFVVGVDMTRKAFL 111

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
             L R+GV +     + FNP  H+A+       +PA+T+ +VVQ GY +  R+LRPA V 
Sbjct: 112 DILGRHGVAEFGRTGEPFNPETHEALGMASLPDLPADTVAQVVQKGYTLRGRLLRPAKVM 171

Query: 185 ISK 187
           ++K
Sbjct: 172 VNK 174


>gi|255638729|gb|ACU19669.1| unknown [Glycine max]
          Length = 290

 Score =  119 bits (297), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 62/212 (29%), Positives = 111/212 (52%), Gaps = 17/212 (8%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEE------------KSEINIPEESLNQSEEFRDKYLR 49
           E  +S+++   E       S    E              +  + +    + E+ +DK LR
Sbjct: 79  EAKVSDQSEQAEAADQTKESDVESECDLSRDDLIKLVAEKEQLLKLKHKEIEKMQDKVLR 138

Query: 50  VIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPL-----DLANSEKK 104
             AEMEN+  RT RE ++++ ++I  FA+ +L V+DNL RA           +      +
Sbjct: 139 TYAEMENVMDRTRREAENSKKFAIQNFAKSLLDVADNLGRASSVVKDNFSKIESPEESSE 198

Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTII 164
           +  +LK+L+EG+EMT +++   L+++GV+K D  ++ F+P+MH A+F+ P  +    T+ 
Sbjct: 199 AAQLLKTLLEGVEMTEKQLAEVLKKFGVEKFDPTNEPFDPHMHNAIFQIPDASKAPGTVG 258

Query: 165 KVVQDGYAINERVLRPALVSISKGKTQNPTEE 196
            V++ GY + +RVLRPA V +++    N   E
Sbjct: 259 VVLKAGYKLYDRVLRPAEVGVTQEVEDNKAAE 290


>gi|212218707|ref|YP_002305494.1| heat shock protein GrpE [Coxiella burnetii CbuK_Q154]
 gi|212012969|gb|ACJ20349.1| GrpE [Coxiella burnetii CbuK_Q154]
          Length = 208

 Score =  119 bits (297), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 52/177 (29%), Positives = 91/177 (51%), Gaps = 9/177 (5%)

Query: 11  DKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQS 70
            +E  P          +           + +E++ +YLR  AEM+NLR+R +REK D   
Sbjct: 39  SQEMEPHREGLEFPSREKLEGQLTRMERKVDEYKTQYLRAQAEMDNLRKRIEREKADIIK 98

Query: 71  YSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERY 130
           +   +   D+L V+D+L   L+S   +        +  +KS+ +G+ +T   + +TL ++
Sbjct: 99  FGSKQLITDLLPVADSLIHGLESPASE--------DPQVKSMRDGMSLTLDLLHNTLAKH 150

Query: 131 GVKKIDA-KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           GV+ I+      F+P +H+AM  +       +TII+V+Q GY +N RVLR A V ++
Sbjct: 151 GVQVINPNPGDPFDPALHEAMSVQAVPDAKPDTIIQVLQKGYQLNGRVLRAARVIVA 207


>gi|296533452|ref|ZP_06896035.1| co-chaperone GrpE [Roseomonas cervicalis ATCC 49957]
 gi|296266232|gb|EFH12274.1| co-chaperone GrpE [Roseomonas cervicalis ATCC 49957]
          Length = 199

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 59/187 (31%), Positives = 104/187 (55%), Gaps = 6/187 (3%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           +++ M++ +     +P     +  +    +    E   ++ + +D++LR  AEM+NLR R
Sbjct: 10  IDSDMTDPSNPTAPHPET-QPTPEQPADALARLAELEAENAQLKDRWLRSEAEMQNLRTR 68

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T RE ++A+++++ KFARD++  ++NL R LD+ P            +L  L  G E   
Sbjct: 69  TKREVEEARAFAVQKFARDVVEAAENLRRGLDALPPAQEGE----AELLTKLRGGFEGVE 124

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT-VPANTIIKVVQDGYAINERVLR 179
           R  +S LER GV K DA  + F+P +HQAM ++P    V A T+I+     + +N R+L+
Sbjct: 125 RAFLSILERNGVSKQDATGKPFDPELHQAMAQQPPPEGVAAGTVIQAWTPAWTLNGRLLK 184

Query: 180 PALVSIS 186
           PA+V ++
Sbjct: 185 PAMVVVA 191


>gi|254453526|ref|ZP_05066963.1| co-chaperone GrpE [Octadecabacter antarcticus 238]
 gi|198267932|gb|EDY92202.1| co-chaperone GrpE [Octadecabacter antarcticus 238]
          Length = 190

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 58/191 (30%), Positives = 107/191 (56%), Gaps = 13/191 (6%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           ++  MS+ N+  E        +  E  +E +       +  + +D Y+R +A++EN R+R
Sbjct: 11  LDDIMSDPNVGPED-----EMTLDEMIAEDDNIVALKTEMSQLKDGYMRALADVENSRKR 65

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
            DR++++A++Y  ++ ARD+L + DNL RAL     D  + +       K+L+EG+E+T 
Sbjct: 66  ADRDRREAENYGGSRLARDLLPIYDNLERALKMNKEDGKDGD-------KALLEGVELTM 118

Query: 121 REMMSTLERYGVKKI-DAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
           R ++   +++G+  I     ++F+P +H+AMFE P     A  II+V   G+ +++R+LR
Sbjct: 119 RALVGVFKKHGIDPIVAEVGERFDPQIHEAMFEAPLPGTKAGDIIQVASTGFMLHDRLLR 178

Query: 180 PALVSISKGKT 190
           PA V +S    
Sbjct: 179 PAQVGVSSAPK 189


>gi|24373098|ref|NP_717141.1| heat shock protein GrpE [Shewanella oneidensis MR-1]
 gi|52782945|sp|Q8EGS0|GRPE_SHEON RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|24347284|gb|AAN54585.1|AE015598_4 heat shock protein GrpE [Shewanella oneidensis MR-1]
          Length = 206

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 58/195 (29%), Positives = 108/195 (55%), Gaps = 8/195 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   SE + ++         +    +    +  ++L + +E +D  +R  AE++N+RRR 
Sbjct: 15  EGVESEVSTEEASLIDELTQANFRIEELEQLLADALAKVDEQKDSVIRAAAEVDNIRRRA 74

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
             + + A  +++ KFA ++L V DN+ RAL              +   K++ EG+E+T++
Sbjct: 75  AMDVEKANKFALEKFANELLPVLDNMERALQ--------GTNPQDETTKAIYEGVELTQK 126

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
            +++ + ++GVK+ID + Q FNP+ HQA+  +P    P NT++ V+Q GY +N R+LRPA
Sbjct: 127 SLLTAVAKFGVKQIDPQGQAFNPDQHQAIGMQPSAEFPTNTVMLVMQKGYELNSRLLRPA 186

Query: 182 LVSISKGKTQNPTEE 196
           +V +S+G     +  
Sbjct: 187 MVMVSQGGPSQESAS 201


>gi|113971067|ref|YP_734860.1| heat shock protein GrpE [Shewanella sp. MR-4]
 gi|122943661|sp|Q0HGL4|GRPE_SHESM RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|113885751|gb|ABI39803.1| GrpE protein [Shewanella sp. MR-4]
          Length = 203

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 60/192 (31%), Positives = 107/192 (55%), Gaps = 8/192 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   SE + ++         +    +    +  ++L + EE +D  +R  AE++N+RRR 
Sbjct: 15  EGVESEVSTEEASLIDELTQANFRIEELEQLLADALAKVEEQKDSVIRAAAEVDNIRRRA 74

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
             + + A  +++ KFA ++L V DN+ RAL              +   K++ EG+E+T++
Sbjct: 75  AMDVEKANKFALEKFANELLPVLDNMERALQ--------GTNPQDETTKAIYEGVELTQK 126

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
            +++ + ++GVK ID + Q FNP+ HQA+  +P    PANT++ V+Q GY +N R+LRPA
Sbjct: 127 SLLTAVAKFGVKPIDPQGQAFNPDQHQAIGMQPSAEFPANTVMLVMQKGYELNSRLLRPA 186

Query: 182 LVSISKGKTQNP 193
           +V +S+G     
Sbjct: 187 MVMVSQGGPSQE 198


>gi|227113544|ref|ZP_03827200.1| heat shock protein [Pectobacterium carotovorum subsp. brasiliensis
           PBR1692]
          Length = 195

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 61/191 (31%), Positives = 98/191 (51%), Gaps = 12/191 (6%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR----DKYLRVIAEMENL 57
           E  + +K   K +    A  +            E   Q  E +    D  LRV AE +N+
Sbjct: 11  EQVLDQKEAAKGQQADAAPETADVADPRDARIAELETQLSELQQRERDNMLRVRAEADNI 70

Query: 58  RRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIE 117
           RRR + + + A  +++ KFA +ML V DNL RALD+A              L ++IEG+E
Sbjct: 71  RRRAEMDVEKAHKFAVEKFASEMLPVIDNLERALDTADKS--------NESLVAMIEGVE 122

Query: 118 MTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERV 177
           +T + ++  + ++G++ +      FNP +HQAM   P      N ++ V+Q GY +N R+
Sbjct: 123 LTLKSLLDAVRKFGIEVVGDVGVPFNPEVHQAMTMLPSADHQPNHVMMVMQKGYTLNGRL 182

Query: 178 LRPALVSISKG 188
           LRPA+V++SK 
Sbjct: 183 LRPAMVAVSKA 193


>gi|227328447|ref|ZP_03832471.1| heat shock protein [Pectobacterium carotovorum subsp. carotovorum
           WPP14]
          Length = 195

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 61/191 (31%), Positives = 98/191 (51%), Gaps = 12/191 (6%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR----DKYLRVIAEMENL 57
           E  + +K   K +    A  +            E   Q  E +    D  LRV AE +N+
Sbjct: 11  EQVLDQKEAAKGQQADAAPETADVADPRDARIAELETQLSELQQRERDNMLRVRAEADNI 70

Query: 58  RRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIE 117
           RRR + + + A  +++ KFA +ML V DNL RALD+A              L ++IEG+E
Sbjct: 71  RRRAEMDVEKAHKFAVEKFASEMLPVIDNLERALDTADKA--------NESLAAMIEGVE 122

Query: 118 MTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERV 177
           +T + ++  + ++G++ +      FNP +HQAM   P      N ++ V+Q GY +N R+
Sbjct: 123 LTLKSLLDAVRKFGIEVVGDVGIPFNPEVHQAMTMLPSADHQPNHVMMVMQKGYTLNGRL 182

Query: 178 LRPALVSISKG 188
           LRPA+V++SK 
Sbjct: 183 LRPAMVAVSKA 193


>gi|89091964|ref|ZP_01164919.1| Hsp 24 DnaK nucleotide exchange factor; probable member of the
           DnaK/DnaJ/GrpE foldase complex [Oceanospirillum sp.
           MED92]
 gi|89083699|gb|EAR62916.1| Hsp 24 DnaK nucleotide exchange factor; probable member of the
           DnaK/DnaJ/GrpE foldase complex [Oceanospirillum sp.
           MED92]
          Length = 205

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 55/187 (29%), Positives = 100/187 (53%), Gaps = 9/187 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E     +     ++      S  +        E +  +    +D+ LR+ AE +N+RRR 
Sbjct: 28  ENAEQAEEAVASEDAEAQADSVVDADKLAQDLEAATAEVANLKDQMLRIQAEAQNVRRRA 87

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           +++ + A  + + KFA +ML + D+L RA+++   D           LK + EG+EMT  
Sbjct: 88  EQDVEKAHKFGVEKFANEMLPIVDSLERAIEAFGDD---------ESLKPMREGVEMTMN 138

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
             +S L ++ +K+++ K + F+P +HQAM   P     ANT++ V+Q GY ++ R++RPA
Sbjct: 139 MFVSGLAKFEMKQVNPKGEMFDPALHQAMSMIPVPDTAANTVVDVMQKGYTLHGRLVRPA 198

Query: 182 LVSISKG 188
           +V ++KG
Sbjct: 199 MVIVAKG 205


>gi|326928364|ref|XP_003210350.1| PREDICTED: grpE protein homolog 2, mitochondrial-like [Meleagris
           gallopavo]
          Length = 209

 Score =  118 bits (296), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 41/173 (23%), Positives = 85/173 (49%), Gaps = 2/173 (1%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
           ++P +       + +  +   +   Q  +  ++Y + +A+ EN+RRRT +  +DA+ + I
Sbjct: 34  EDPRDEPKHPLSDCALEHKAIKLEEQVRDLTERYRKALADSENVRRRTQKFVEDAKLFGI 93

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
             F RD++ V+D L     +               L+ + EG+ +   ++ S   ++G++
Sbjct: 94  QSFCRDLVEVADILE--KTAESAAEEAEPTNPNPTLQKIYEGLSLIEAKLQSVFAKHGLQ 151

Query: 134 KIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           K+     K++P  H+ +   P + +   TI  V QDGY ++ R +R ALV ++
Sbjct: 152 KMSPVGDKYDPYDHEIVCHVPAEGMQPGTIALVTQDGYKLHGRTIRHALVGVA 204


>gi|209364057|ref|YP_001424733.2| heat shock protein GrpE [Coxiella burnetii Dugway 5J108-111]
 gi|207081990|gb|ABS77875.2| GrpE [Coxiella burnetii Dugway 5J108-111]
          Length = 208

 Score =  118 bits (296), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 52/177 (29%), Positives = 92/177 (51%), Gaps = 9/177 (5%)

Query: 11  DKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQS 70
            +E  P          +          ++ +E++ +YLR  AEM+NLR+R +REK D   
Sbjct: 39  SQEMEPHREGLEFPSREKLEGQLTRMEHKVDEYKTQYLRAQAEMDNLRKRIEREKADIIK 98

Query: 71  YSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERY 130
           +   +   D+L V+D+L   L+S   +        +  +KS+ +G+ +T   + +TL ++
Sbjct: 99  FGSKQLITDLLPVADSLIHGLESPASE--------DPQVKSMRDGMSLTLDLLHNTLAKH 150

Query: 131 GVKKIDA-KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           GV+ I+      F+P +H+AM  +       +TII+V+Q GY +N RVLR A V ++
Sbjct: 151 GVQVINPNPGDPFDPALHEAMSVQAVPDAKPDTIIQVLQKGYQLNGRVLRAARVIVA 207


>gi|189425886|ref|YP_001953063.1| GrpE protein [Geobacter lovleyi SZ]
 gi|226737138|sp|B3E7X0|GRPE_GEOLS RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|189422145|gb|ACD96543.1| GrpE protein [Geobacter lovleyi SZ]
          Length = 181

 Score =  118 bits (296), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 58/191 (30%), Positives = 96/191 (50%), Gaps = 12/191 (6%)

Query: 1   METFMSEKNIDKEKNPSNAN-SSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRR 59
           M     +   ++E     A  +   +             ++++  DK LR  A++EN R+
Sbjct: 1   MNKEQQDLQTEQEAAVETAELTPEQQLVQLQEKLAAKEQEAKDNWDKLLRERADLENYRK 60

Query: 60  RTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMT 119
           R  REK++  +Y I     ++L V DNL RAL+ A  D           L +L+EG++MT
Sbjct: 61  RASREKEELLNYGIKSLVEEVLPVLDNLERALEHANEDG----------LPALVEGVKMT 110

Query: 120 RREMMSTLERYGVKKID-AKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVL 178
              + + L+++GV  +D      F+P  HQAM +      P NTI++  Q GY + ER+L
Sbjct: 111 HTLLQTALKKFGVCAVDGNCGTLFDPAFHQAMAQVETSDHPNNTIVQEFQKGYLLKERLL 170

Query: 179 RPALVSISKGK 189
           RP++VS++K  
Sbjct: 171 RPSMVSVAKNP 181


>gi|254418657|ref|ZP_05032381.1| co-chaperone GrpE [Brevundimonas sp. BAL3]
 gi|196184834|gb|EDX79810.1| co-chaperone GrpE [Brevundimonas sp. BAL3]
          Length = 211

 Score =  118 bits (296), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 65/212 (30%), Positives = 120/212 (56%), Gaps = 16/212 (7%)

Query: 5   MSEKNIDKEKNPSNANSST--------AEEKSEINIPEESLNQSEEFRDKYLRVIAEMEN 56
           MS+K ++ + N  +A+ +         A+    +   +  + + +E++D+ LRV AEMEN
Sbjct: 1   MSDKPLNDDFNELDADMAETNAEHGLDADPSDNLAPLDAVIAERDEWKDRALRVAAEMEN 60

Query: 57  LRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGI 116
           L+RR + ++ DA++++I +FA+D+L V+DNL RAL +AP D             +L+ G+
Sbjct: 61  LKRRAETQQNDARAFAIQRFAKDLLGVADNLERALMAAPKDTDGPTV-------ALVTGL 113

Query: 117 EMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINE 175
           EMT++ ++   E  G+K++  +  + FNP++HQAM E+P DTVP   +++ +Q G+ +  
Sbjct: 114 EMTQKALLQAFETNGLKRVAPEAGEAFNPHLHQAMIEQPSDTVPGGAVLQTMQSGFELFG 173

Query: 176 RVLRPALVSISKGKTQNPTEEKKETIEQPSPL 207
           R +RPA+V ++   +             P   
Sbjct: 174 RTIRPAMVVVAAKGSGAQGANPYGAAPAPEGQ 205


>gi|56694938|ref|YP_165283.1| co-chaperone GrpE [Ruegeria pomeroyi DSS-3]
 gi|56676675|gb|AAV93341.1| co-chaperone GrpE [Ruegeria pomeroyi DSS-3]
          Length = 187

 Score =  118 bits (296), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 96/165 (58%), Gaps = 8/165 (4%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
             E    +    + + F+DK++R +A+ EN+R+R +R +++A+ Y  +K ARDML V DN
Sbjct: 29  SDEAAELDTLRAERDAFKDKFMRALADAENVRKRGERARREAEQYGGSKLARDMLPVYDN 88

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPN 145
           + RAL++   +             +LIEGIE+T R ++    ++G++ +  +   +F+P 
Sbjct: 89  MKRALETVTDEQRAVSG-------ALIEGIELTMRALLDVFGKHGIQVLSPQVGDRFDPQ 141

Query: 146 MHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           MH+AMFE P     A  II+V  +G+ +++R+LRPA V +S    
Sbjct: 142 MHEAMFEAPVPGTKAGDIIQVSAEGFMLHDRLLRPAQVGVSSMPA 186


>gi|225718590|gb|ACO15141.1| GrpE protein homolog, mitochondrial precursor [Caligus clemensi]
          Length = 201

 Score =  118 bits (296), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 54/181 (29%), Positives = 97/181 (53%), Gaps = 11/181 (6%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           + D     S + S   E     +   E   ++ +  DKY R IAE EN+R+R  ++  DA
Sbjct: 31  STDSTNTESESVSEHPEVIKMSSEIAELKEKNSDLLDKYRRSIAENENMRKRLSKQIDDA 90

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
           + + I  F +D+L VSD LS+A+++ P D +            + +G+ +T  +++   +
Sbjct: 91  KVFGIQSFCKDLLDVSDVLSKAVETLPRDASPD----------IRDGMMLTESQLLQVFK 140

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDT-VPANTIIKVVQDGYAINERVLRPALVSISK 187
           R+G+ K +  ++KF+PN H+A F+ P    V  N ++ V + G+ +  R +RPA+V +SK
Sbjct: 141 RHGLVKENPLNEKFDPNKHEAAFQIPAPEGVETNIVLDVQKVGFILQGRTIRPAVVGVSK 200

Query: 188 G 188
            
Sbjct: 201 K 201


>gi|56421040|ref|YP_148358.1| heat shock protein GrpE [Geobacillus kaustophilus HTA426]
 gi|81675749|sp|Q5KWZ6|GRPE_GEOKA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|56380882|dbj|BAD76790.1| chaperone protein (heat shock protein) (HSP-70 cofactor)
           [Geobacillus kaustophilus HTA426]
          Length = 213

 Score =  118 bits (296), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 54/164 (32%), Positives = 87/164 (53%), Gaps = 9/164 (5%)

Query: 23  TAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLS 82
             E  +      E   +  E   +YLR+ A+ EN RRRT +E + A+ Y     A D+L 
Sbjct: 58  AEELAAAKAQIAELEAKLSEMEHRYLRLYADFENFRRRTRQEMEAAEKYRAQSLASDLLP 117

Query: 83  VSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKF 142
           V DN  RAL                  KS+++G+EM  R ++  L++ GV+ I+A  + F
Sbjct: 118 VLDNFERALKIETD---------NEQAKSILQGMEMVYRSLVDALKKEGVEAIEAVGKPF 168

Query: 143 NPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           +P +HQA+ +   +    NT+++ +Q GY + +RVLRPA+V +S
Sbjct: 169 DPYLHQAVMQAEAEGYEPNTVVEELQKGYKLKDRVLRPAMVKVS 212


>gi|292493429|ref|YP_003528868.1| GrpE protein [Nitrosococcus halophilus Nc4]
 gi|291582024|gb|ADE16481.1| GrpE protein [Nitrosococcus halophilus Nc4]
          Length = 210

 Score =  118 bits (296), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 60/197 (30%), Positives = 109/197 (55%), Gaps = 8/197 (4%)

Query: 4   FMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDR 63
             SE   +  +    +   T E +    + E++ ++++E  ++ LR  AE+EN RRR +R
Sbjct: 22  VESEVPTEGGEKAQESAPETTEMEDIQRLLEDARSKADEHWNELLRARAELENQRRRHER 81

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           E + A+ Y++ KFA+++L V D+L   L +A  +        ++ + +L EG E+  +  
Sbjct: 82  ELEKARKYALEKFAQELLPVKDSLEMGLAAAQAE--------DADVAALREGSELILKMF 133

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
                R+G++ +D + + FNP +HQA+  + +D V  NT++ VV+ GY +N R+LRPA+V
Sbjct: 134 DEVTTRFGIETVDPQGESFNPELHQAISTQENDEVAPNTVLIVVRKGYVLNGRLLRPAMV 193

Query: 184 SISKGKTQNPTEEKKET 200
            +SK   Q P     + 
Sbjct: 194 VVSKPSEQIPPGVDTQA 210


>gi|50290879|ref|XP_447872.1| hypothetical protein [Candida glabrata CBS 138]
 gi|52782863|sp|Q6FPH2|GRPE_CANGA RecName: Full=GrpE protein homolog, mitochondrial; Flags: Precursor
 gi|49527183|emb|CAG60821.1| unnamed protein product [Candida glabrata]
          Length = 231

 Score =  118 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 54/171 (31%), Positives = 92/171 (53%), Gaps = 4/171 (2%)

Query: 17  SNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKF 76
            N ++   + K      ++   ++ E +D+ LR +A+  NL+  T ++ + A+SY++ KF
Sbjct: 63  QNLSAEEQKLKDLQEQLDKKTKEAAELKDRLLRSVADFRNLQEVTKKDVEKAKSYALQKF 122

Query: 77  ARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID 136
           A+D+L   DN   AL +   +           +  L  G++MTR     TL++YG++K+D
Sbjct: 123 AKDLLESVDNFGHALGAFKEEDLEK----SKEISDLYTGVKMTRDVFEKTLKKYGIEKLD 178

Query: 137 AKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
              ++F+PN H+A FE         T+  V Q GY +NERV+RPA V + K
Sbjct: 179 PLGERFDPNKHEATFELAQPDKEPGTVFHVQQLGYTLNERVIRPAKVGVVK 229


>gi|161830132|ref|YP_001597145.1| heat shock protein GrpE [Coxiella burnetii RSA 331]
 gi|52782927|sp|Q83C41|GRPE_COXBU RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|189041739|sp|A9N8H5|GRPE_COXBR RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|161761999|gb|ABX77641.1| co-chaperone GrpE [Coxiella burnetii RSA 331]
          Length = 204

 Score =  118 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 52/179 (29%), Positives = 92/179 (51%), Gaps = 9/179 (5%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           +  +E  P          +           + +E++ +YLR  AEM+NLR+R +REK D 
Sbjct: 33  DGSQEMEPHREGLEFPSREKLEGQLTRMERKVDEYKTQYLRAQAEMDNLRKRIEREKADI 92

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
             +   +   D+L V+D+L   L+S   +        +  +KS+ +G+ +T   + +TL 
Sbjct: 93  IKFGSKQLITDLLPVADSLIHGLESPASE--------DPQVKSMRDGMSLTLDLLHNTLA 144

Query: 129 RYGVKKIDA-KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           ++GV+ I+      F+P +H+AM  +       +TII+V+Q GY +N RVLR A V ++
Sbjct: 145 KHGVQVINPNPGDPFDPALHEAMSVQAVPDAKPDTIIQVLQKGYQLNGRVLRAARVIVA 203


>gi|148260644|ref|YP_001234771.1| GrpE protein [Acidiphilium cryptum JF-5]
 gi|326403838|ref|YP_004283920.1| GrpE protein [Acidiphilium multivorum AIU301]
 gi|146402325|gb|ABQ30852.1| GrpE protein [Acidiphilium cryptum JF-5]
 gi|325050700|dbj|BAJ81038.1| GrpE protein [Acidiphilium multivorum AIU301]
          Length = 202

 Score =  118 bits (295), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 58/201 (28%), Positives = 100/201 (49%), Gaps = 16/201 (7%)

Query: 5   MSEKNIDKEK------------NPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIA 52
           M+E  ++ E             +     S   +  +          +S + RDK++R  A
Sbjct: 1   MTEDTLNAEPVLDAGADPLEAGSERAPASEAEQLAAARERIAALEAESADLRDKWVRAQA 60

Query: 53  EMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSL 112
           EMENLR RT RE +DA+ Y++ KFA D+   ++NL R LD+ P      ++    +L  L
Sbjct: 61  EMENLRARTRREVEDARLYAVQKFAADVAETAENLRRGLDALP----PPQEGESPLLARL 116

Query: 113 IEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYA 172
            +G     R  ++ LER+G++  +A    F+ + HQAM E+     P  T+I+     + 
Sbjct: 117 RDGFAGVERSFIAMLERHGIRAEEAMGATFDADKHQAMGEQETSDAPPGTVIQAWSRTWT 176

Query: 173 INERVLRPALVSISKGKTQNP 193
           +N R+L+PA+V +++ +   P
Sbjct: 177 LNGRLLKPAMVVVARAQAGKP 197


>gi|88801009|ref|ZP_01116559.1| co-chaperone GrpE [Reinekea sp. MED297]
 gi|88776276|gb|EAR07501.1| co-chaperone GrpE [Reinekea sp. MED297]
          Length = 200

 Score =  118 bits (295), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 55/191 (28%), Positives = 107/191 (56%), Gaps = 8/191 (4%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
              D  +    AN+S  + ++     E++ +++ + +D+Y+R  AEM NLRRR +++ ++
Sbjct: 17  DEFDASEARDEANASETDVEALKVQLEQAQDEAAKMKDQYVRAEAEMANLRRRVEKDVEN 76

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A  +   K  +++L+V+DNL RA+ S   +           + ++ EG+EMT + +    
Sbjct: 77  AHKFGQEKLTKELLAVADNLERAIVSTEGE--------NVDVNAIKEGVEMTLKGLQDVF 128

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            ++ ++ ID + + F+P +HQAM    +  V  NT+I V+Q GY ++ R++RPA+V +SK
Sbjct: 129 SKFSIEAIDPQGEPFDPQLHQAMSMVENPEVEPNTVIAVMQKGYQLHGRLVRPAMVMVSK 188

Query: 188 GKTQNPTEEKK 198
           G       ++ 
Sbjct: 189 GGAPAAKIDET 199


>gi|302923480|ref|XP_003053685.1| hypothetical protein NECHADRAFT_98880 [Nectria haematococca mpVI
           77-13-4]
 gi|256734626|gb|EEU47972.1| hypothetical protein NECHADRAFT_98880 [Nectria haematococca mpVI
           77-13-4]
          Length = 247

 Score =  118 bits (295), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 65/185 (35%), Positives = 103/185 (55%), Gaps = 2/185 (1%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
            E   + +K+  + N  T          E    ++ +++DK LR +A+  NL+ RT RE 
Sbjct: 62  EEAKTESKKDEKSTNGETDAVAELKKALEAKETEARDWKDKCLRTVADFRNLQERTQREV 121

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSE--SVLKSLIEGIEMTRREM 123
           K A+ ++I KFA+D++   DNL RAL   P +  N ++K E    L +L EG++MT   +
Sbjct: 122 KTARDFAIQKFAKDLVDSVDNLDRALGMVPQEKLNVDEKPEHLQDLANLYEGLKMTEDIL 181

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
           MSTL+++G+++ + +  KFNPN  +A F  P      NT+  V Q G+ +N RVLR A V
Sbjct: 182 MSTLKKHGLERTNPEGDKFNPNEQEATFMAPQPDKEDNTVFFVQQKGFKLNGRVLRAAKV 241

Query: 184 SISKG 188
            + K 
Sbjct: 242 GVVKN 246


>gi|116788847|gb|ABK25023.1| unknown [Picea sitchensis]
          Length = 322

 Score =  118 bits (295), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 51/180 (28%), Positives = 101/180 (56%), Gaps = 5/180 (2%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
           + +  + +E   + +  ++K LR  AE+EN+  R  RE +  + ++I  FA+ +L V+DN
Sbjct: 143 QEKELLLKEKHKEIKVMQEKVLRSYAEVENVMDRARREAESTKKFAIQSFAKSLLDVADN 202

Query: 87  LSRALDSAPL-----DLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQK 141
           LSRA           D +     +  +LK+L+EG+ MT +++   L+++GV++ D  +++
Sbjct: 203 LSRASSVVKESFSKIDPSKDSSGAAPLLKTLLEGVAMTEKQLSDVLKKHGVERFDPLNEQ 262

Query: 142 FNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETI 201
           F+PNMH A+F+    +    ++  V++ GY +++RV+RPA V + +G         + + 
Sbjct: 263 FDPNMHMAVFQVQDASKQTGSVAVVLKPGYTLHDRVIRPAEVGVVEGVESEVAGNSEPSA 322


>gi|126734417|ref|ZP_01750164.1| GrpE protein HSP-70 cofactor, putative [Roseobacter sp. CCS2]
 gi|126717283|gb|EBA14147.1| GrpE protein HSP-70 cofactor, putative [Roseobacter sp. CCS2]
          Length = 185

 Score =  118 bits (295), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 68/191 (35%), Positives = 111/191 (58%), Gaps = 12/191 (6%)

Query: 5   MSEKNID----KEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           MSEK+ +     E             ++  +  E    + +E+RDK++R +A+ ENLR+R
Sbjct: 1   MSEKDEELQSLDELAAEGDEIDFDAAEATFDEIEALRAERDEYRDKFMRALADTENLRKR 60

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           +DR++++A+ Y  +K ARDML V DN+ RAL S+             V K+L+EG+E+T 
Sbjct: 61  SDRDRREAEDYGGSKLARDMLPVYDNMRRALQSSAEAEQ-------DVNKALLEGVELTM 113

Query: 121 REMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
           RE++S  +++G+  I  +   KF+P +HQAMFE P     A  II+V  +G+ +++R+LR
Sbjct: 114 RELISVFKKHGIDPITPEVGDKFDPKLHQAMFEAPLPDTKAGDIIQVAAEGFMLHDRLLR 173

Query: 180 PALVSISKGKT 190
           PA V +S    
Sbjct: 174 PAQVGVSSTPA 184


>gi|50119785|ref|YP_048952.1| heat shock protein GrpE [Pectobacterium atrosepticum SCRI1043]
 gi|52782860|sp|Q6D8X9|GRPE_ERWCT RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|49610311|emb|CAG73755.1| heat shock protein [Pectobacterium atrosepticum SCRI1043]
          Length = 195

 Score =  118 bits (295), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 61/191 (31%), Positives = 98/191 (51%), Gaps = 12/191 (6%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR----DKYLRVIAEMENL 57
           E  + +K   K +    A  +            E   Q  E +    D  LRV AE +N+
Sbjct: 11  EQVLDQKEAAKGQQADAAPETADVADPRDERIAELEAQLSELQQRERDNMLRVRAEADNV 70

Query: 58  RRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIE 117
           RRR + + + A  +++ KFA +ML V DNL RALD+A              L ++IEG+E
Sbjct: 71  RRRAEMDIEKAHKFAVEKFASEMLPVIDNLERALDTADKA--------NESLAAMIEGVE 122

Query: 118 MTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERV 177
           +T + ++  + ++G++ +      FNP +HQAM   P      N ++ V+Q GY +N R+
Sbjct: 123 LTLKSLLDAVHKFGIEVVGDVGVPFNPEVHQAMTMLPSADHQPNHVMMVMQKGYTLNGRL 182

Query: 178 LRPALVSISKG 188
           LRPA+V++SK 
Sbjct: 183 LRPAMVAVSKA 193


>gi|87123328|ref|ZP_01079179.1| Heat shock protein GrpE [Synechococcus sp. RS9917]
 gi|86169048|gb|EAQ70304.1| Heat shock protein GrpE [Synechococcus sp. RS9917]
          Length = 244

 Score =  118 bits (295), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 46/197 (23%), Positives = 87/197 (44%), Gaps = 12/197 (6%)

Query: 19  ANSSTAEEKSEINIPE----ESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIA 74
           A+   A+ ++ +   E       ++ E  R +Y+R+ A+ +N R+R  R++ D +     
Sbjct: 47  ADQPAADNEARLEQLEREHSTLRDEHETLRSQYMRIAADFDNFRKRQSRDQDDLKLQITC 106

Query: 75  KFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKK 134
               ++L V DN  RA      +            +SL    +   ++++  L++ GV  
Sbjct: 107 STLSEILPVVDNFERARQQLNPE--------SEEAQSLHRSYQGLYKQLVDVLKQLGVAP 158

Query: 135 IDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPT 194
           +    Q+F+P +H+A+  EP D    + +I+ +Q GY +  RVLR A+V +S G      
Sbjct: 159 MRVVGQEFDPTLHEAVLREPSDEHGEDVVIEELQRGYHLQGRVLRHAMVKVSMGPGPQVQ 218

Query: 195 EEKKETIEQPSPLDIEE 211
                  E  +     E
Sbjct: 219 AGATSATEASAESAEPE 235


>gi|167465370|ref|ZP_02330459.1| hypothetical protein Plarl_22890 [Paenibacillus larvae subsp.
           larvae BRL-230010]
 gi|322383632|ref|ZP_08057383.1| nucleotide exchange factor-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
 gi|321151844|gb|EFX44787.1| nucleotide exchange factor-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
          Length = 199

 Score =  118 bits (295), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 56/179 (31%), Positives = 93/179 (51%), Gaps = 9/179 (5%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +    +   S + S  +EE + +   EE   Q +E +++YLRV A+ +N RRR+  EK+D
Sbjct: 29  EEPKNDAAESVSESPDSEENACVKELEELREQVKEHQERYLRVQADFDNFRRRSRLEKED 88

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
              Y+  K    +L V DN  RAL S+                +L +GIEM  R++   L
Sbjct: 89  FAKYASIKLIESLLPVIDNFDRALQSSKD---------TKDFDALAKGIEMVYRQLDQVL 139

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
            + G+  I+A  + FNP  HQA+ +   +      I++ VQ GY + ++V+RP++V +S
Sbjct: 140 TQEGLSPIEAVGELFNPEFHQAIMQVESEDHEEGIIVEEVQKGYMLKDKVIRPSMVKVS 198


>gi|83594972|ref|YP_428724.1| GrpE protein [Rhodospirillum rubrum ATCC 11170]
 gi|83577886|gb|ABC24437.1| GrpE protein [Rhodospirillum rubrum ATCC 11170]
          Length = 221

 Score =  118 bits (295), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 55/175 (31%), Positives = 106/175 (60%), Gaps = 4/175 (2%)

Query: 28  SEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNL 87
                     + +   +++YLR +AE +N +R  D+  +D   Y+++ FA+ +L V+DNL
Sbjct: 44  DLEERITALEDDNRRLKEEYLRALAEAQNAKRMADKRIEDNSRYAVSNFAKAVLGVADNL 103

Query: 88  SRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMH 147
            RAL S P +     +    ++K+L  G+E+T +E+ + L +Y +++++A ++ F+P+ H
Sbjct: 104 GRALLSVPEEA----RGGNEMVKNLAFGVELTAKELENALAQYQIRRVEALNEAFDPHFH 159

Query: 148 QAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIE 202
           QA+ E  +  VP  TI+ V+QDGY I++R+LRPA+V +S+G  +   +   ++ +
Sbjct: 160 QAVQEVENTAVPNATIVSVLQDGYVIHDRLLRPAMVVVSRGGPKREPKPAADSAD 214


>gi|302037064|ref|YP_003797386.1| chaperone protein GrpE [Candidatus Nitrospira defluvii]
 gi|300605128|emb|CBK41461.1| Chaperone protein GrpE [Candidatus Nitrospira defluvii]
          Length = 184

 Score =  118 bits (295), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 50/193 (25%), Positives = 100/193 (51%), Gaps = 15/193 (7%)

Query: 5   MSEKNIDKEK------NPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLR 58
           MSE N +         +   ++ +         + +   ++ +   +KYLR+ AE +N +
Sbjct: 1   MSEDNKNIHSIDNLDGSSEASSGTMEGVNELQQVLDAKSDECKALNEKYLRLAAEFDNYK 60

Query: 59  RRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEM 118
           R   R++++   +   +  +++L V DNL RA+ S+              + +L EG+E+
Sbjct: 61  RLAQRDQREQIKFGNEQILKELLPVVDNLERAIKSSKG---------SGSVDALTEGVEL 111

Query: 119 TRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVL 178
           T ++++  L ++GVK +D+    F+P   QA+ + P DT+P N +++  Q GY + +R+L
Sbjct: 112 TLKQLVGALTKFGVKAVDSVGLAFDPATQQAVAQVPSDTIPENHVVEEYQKGYLLQDRIL 171

Query: 179 RPALVSISKGKTQ 191
           R A+V++S G   
Sbjct: 172 RAAMVTVSTGAAN 184


>gi|88809343|ref|ZP_01124851.1| Heat shock protein GrpE [Synechococcus sp. WH 7805]
 gi|88786562|gb|EAR17721.1| Heat shock protein GrpE [Synechococcus sp. WH 7805]
          Length = 237

 Score =  118 bits (295), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 43/211 (20%), Positives = 88/211 (41%), Gaps = 12/211 (5%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPE----ESLNQSEEFRDKYLRVIAEMENLR 58
           T   E     +         + + ++ +   E       ++ +  R +Y+R+ A+ +N R
Sbjct: 27  TDSVEAAASPDSGTVAEAPQSGDNEARLEQLEREHNSLRDEHDVLRGQYMRIAADFDNFR 86

Query: 59  RRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEM 118
           +R  R++ + +         ++L V DN  RA                   ++L    + 
Sbjct: 87  KRQSRDQDELKIQLTCSTLSEILPVVDNFERARQQLD--------PQGEEAQALHRSYQG 138

Query: 119 TRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVL 178
             ++++  L++ GV  +    Q+F+P +H+A+  EP D    + +I+ +Q GY +N +VL
Sbjct: 139 LYKQLVDVLKQLGVAPMRVVGQEFDPTLHEAVLREPSDAHAEDVVIEELQRGYHLNGKVL 198

Query: 179 RPALVSISKGKTQNPTEEKKETIEQPSPLDI 209
           R A+V +S G        +       S  D 
Sbjct: 199 RHAMVKVSMGPGPQNAPAEAGATSDDSAADE 229


>gi|194289242|ref|YP_002005149.1| heat shock protein grpe [Cupriavidus taiwanensis LMG 19424]
 gi|254799588|sp|B3R450|GRPE_CUPTR RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|193223077|emb|CAQ69082.1| Hsp 24 nucleotide exchange factor [Cupriavidus taiwanensis LMG
           19424]
          Length = 191

 Score =  117 bits (294), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 54/181 (29%), Positives = 89/181 (49%), Gaps = 12/181 (6%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
                      +++ A              ++ E  D Y+R +AE EN+RRR   +   A
Sbjct: 23  TAAASPETGAPDTAAAAVDDVAAQLAALEAKASEHYDLYMRAVAEGENIRRRAQEDVAKA 82

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
             ++I  FA ++L V D+L  AL     D           +  L EG+E+T R++ +  E
Sbjct: 83  HKFAIENFADNLLPVMDSLQAALADGSGD-----------IAKLREGVELTARQLAAAFE 131

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           R  + +++   +KF+P+ HQA+   P      NT++ V+Q GY I +RVLRPALV+++  
Sbjct: 132 RGKIVELNPVGEKFDPHRHQAISMVP-ADQEPNTVVTVLQRGYTIADRVLRPALVTVAAP 190

Query: 189 K 189
           K
Sbjct: 191 K 191


>gi|126173594|ref|YP_001049743.1| heat shock protein GrpE [Shewanella baltica OS155]
 gi|152999874|ref|YP_001365555.1| heat shock protein GrpE [Shewanella baltica OS185]
 gi|160874497|ref|YP_001553813.1| heat shock protein GrpE [Shewanella baltica OS195]
 gi|217974163|ref|YP_002358914.1| heat shock protein GrpE [Shewanella baltica OS223]
 gi|304409465|ref|ZP_07391085.1| GrpE protein [Shewanella baltica OS183]
 gi|307303823|ref|ZP_07583576.1| GrpE protein [Shewanella baltica BA175]
 gi|226737174|sp|A3D2B1|GRPE_SHEB5 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737175|sp|A6WL03|GRPE_SHEB8 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737176|sp|A9KTL2|GRPE_SHEB9 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|254799609|sp|B8EAU9|GRPE_SHEB2 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|125996799|gb|ABN60874.1| GrpE protein [Shewanella baltica OS155]
 gi|151364492|gb|ABS07492.1| GrpE protein [Shewanella baltica OS185]
 gi|160860019|gb|ABX48553.1| GrpE protein [Shewanella baltica OS195]
 gi|217499298|gb|ACK47491.1| GrpE protein [Shewanella baltica OS223]
 gi|304351983|gb|EFM16381.1| GrpE protein [Shewanella baltica OS183]
 gi|306912721|gb|EFN43144.1| GrpE protein [Shewanella baltica BA175]
 gi|315266736|gb|ADT93589.1| GrpE protein [Shewanella baltica OS678]
          Length = 206

 Score =  117 bits (294), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 61/193 (31%), Positives = 108/193 (55%), Gaps = 8/193 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   SE +  +         +    +    +  E+L + EE +D  +R  AE++N+RRR 
Sbjct: 15  EGVESEVSTAEASLIDELTQANFRIEELEQLLAEALAKVEEQKDSVIRAAAEVDNIRRRA 74

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
             + + A  +++ KFA ++L V DN+ RAL              +   KS+ +G+E+T++
Sbjct: 75  AMDVEKANKFALEKFANELLPVLDNMERALM--------GTNPEDEATKSIYQGVELTQK 126

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
            +++ + ++GVK+ID + Q FNP+ HQA+  +P    PANT++ V+Q GY +N R+LRPA
Sbjct: 127 SLLTAVAKFGVKQIDPQGQSFNPDQHQAIGMQPSAEFPANTVMLVMQKGYELNSRLLRPA 186

Query: 182 LVSISKGKTQNPT 194
           +V +S+G     +
Sbjct: 187 MVMVSQGGPNQES 199


>gi|255075395|ref|XP_002501372.1| mitochondrial protein translocase family [Micromonas sp. RCC299]
 gi|226516636|gb|ACO62630.1| mitochondrial protein translocase family [Micromonas sp. RCC299]
          Length = 304

 Score =  117 bits (294), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 36/157 (22%), Positives = 76/157 (48%), Gaps = 9/157 (5%)

Query: 36  SLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAP 95
             +Q++  +D+YLR+ A+ +N ++RT +EK+     + +KF   +L   DN   A  +  
Sbjct: 156 LKDQADTLKDQYLRLNADFDNFKKRTLKEKEQLSQTAKSKFFEALLPALDNFDLAQANLK 215

Query: 96  LDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPH 155
            +            + ++   +     +M+ L   G+  +      F+PN H+A+  E  
Sbjct: 216 PE--------NEEAQKIVSQYQGLVDGLMTILTNQGLSTVAGVGAPFDPNFHEAIMREES 267

Query: 156 DTVPANTIIKVVQDGYAINE-RVLRPALVSISKGKTQ 191
              P +TI++  + GY + E  ++RPA+V ++   ++
Sbjct: 268 ADAPEDTILEEFRKGYKMGENTLIRPAMVKVAAAPSE 304


>gi|320581976|gb|EFW96195.1| GrpE like-protein, mitochondrial [Pichia angusta DL-1]
          Length = 212

 Score =  117 bits (294), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 56/171 (32%), Positives = 91/171 (53%), Gaps = 4/171 (2%)

Query: 17  SNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKF 76
            +  S  +E  S          +  E +D+Y+R +A+  NL+  T RE + A+ +++ +F
Sbjct: 44  KSIASLESELASIKEKLLAKDKECAELKDRYVRSVADFRNLQETTKREMQKAKDFALQQF 103

Query: 77  ARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID 136
           A+D+L   DN   AL++   +   S       +  L EG++MTR     TL R+G+ KID
Sbjct: 104 AKDLLESIDNFGHALNAVKEETLKS----NQEVSQLYEGVKMTRDVFEKTLARHGLSKID 159

Query: 137 AKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
             D+ F+PN H+A F+ P +     T+  V Q G+ +N RVLRPA V + +
Sbjct: 160 PVDEPFDPNRHEATFQAPVEGKEPGTVFHVQQPGFELNGRVLRPAKVGVVR 210


>gi|120599629|ref|YP_964203.1| heat shock protein GrpE [Shewanella sp. W3-18-1]
 gi|146292377|ref|YP_001182801.1| heat shock protein GrpE [Shewanella putrefaciens CN-32]
 gi|226737179|sp|A4Y4W9|GRPE_SHEPC RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737182|sp|A1RLV4|GRPE_SHESW RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|120559722|gb|ABM25649.1| GrpE protein [Shewanella sp. W3-18-1]
 gi|145564067|gb|ABP75002.1| GrpE protein [Shewanella putrefaciens CN-32]
 gi|319425677|gb|ADV53751.1| heat shock protein, GrpE [Shewanella putrefaciens 200]
          Length = 206

 Score =  117 bits (294), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 59/193 (30%), Positives = 108/193 (55%), Gaps = 8/193 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   SE +  +         +    +    +  ++L + EE +D  +R  AE++N+RRR 
Sbjct: 15  EGVESEVSTAEASLVDELTQANFRIEELEQLLADALAKVEEQKDSVIRAAAEVDNIRRRA 74

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
             + + A  +++ KFA ++L V DN+ RAL              +   K++ +G+E+T++
Sbjct: 75  AMDVEKANKFALEKFANELLPVLDNMERALM--------GTNPEDEATKAIYQGVELTQK 126

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
            +++ + ++GVK+ID + + FNP+ HQA+  +P    PANT++ V+Q GY +N R+LRPA
Sbjct: 127 SLLTAVAKFGVKQIDPQGESFNPDQHQAIGMQPSADFPANTVMLVMQKGYELNSRLLRPA 186

Query: 182 LVSISKGKTQNPT 194
           +V +S+G     T
Sbjct: 187 MVMVSQGGPSQET 199


>gi|85706902|ref|ZP_01037992.1| co-chaperone GrpE [Roseovarius sp. 217]
 gi|85668513|gb|EAQ23384.1| co-chaperone GrpE [Roseovarius sp. 217]
          Length = 186

 Score =  117 bits (294), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 55/167 (32%), Positives = 96/167 (57%), Gaps = 8/167 (4%)

Query: 23  TAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLS 82
             +   E    +    + +  RDK++R +A+ EN R+R+++++++A++Y  +K +RDML 
Sbjct: 25  DEDISDEALELDALRAERDALRDKFMRALADAENARKRSEKDRREAENYGGSKLSRDMLP 84

Query: 83  VSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQK 141
           V DNL RAL++   +             +L EGIE+T RE+ +   ++G+  ID +   +
Sbjct: 85  VYDNLKRALETVTEEQRAGS-------AALFEGIELTLRELRNVFTKHGITVIDPQVGDR 137

Query: 142 FNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           F+P  H+AMFE P     A  II+V   G+ +++R+LRPA V +S  
Sbjct: 138 FDPQQHEAMFEVPLPGTKAGEIIQVSTQGFMLHDRILRPAQVGVSSN 184


>gi|156056012|ref|XP_001593930.1| hypothetical protein SS1G_05358 [Sclerotinia sclerotiorum 1980]
 gi|154703142|gb|EDO02881.1| hypothetical protein SS1G_05358 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 242

 Score =  117 bits (294), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 60/188 (31%), Positives = 97/188 (51%), Gaps = 6/188 (3%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +   K+  P         E       E    +  + +DK LR IA+  NL+ RT R+ + 
Sbjct: 55  EPEAKKDEPEAEKKEAEVEDPTKKALEAKDKEILDLKDKLLRSIADFRNLQERTKRDMQA 114

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDL----ANSEKKSESVLKSLIEGIEMTRREM 123
           A+ ++I KFA+D++   DNL RAL + P +     A    + +  L +L EG++MT   +
Sbjct: 115 AKDFAIQKFAKDLVDSVDNLDRALTTVPAEKLSVPAEKRNEHQQDLITLHEGLKMTEDIL 174

Query: 124 MSTLERYGVKKIDA--KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           MSTL+++G+++ D   + +KFNPN H+A F  P       T+    Q G+ +N R+LR A
Sbjct: 175 MSTLKKHGLERFDPSVESEKFNPNEHEATFMTPMPGKEDGTVFHTQQKGFKLNGRILRAA 234

Query: 182 LVSISKGK 189
            V + K  
Sbjct: 235 KVGVVKNP 242


>gi|152997962|ref|YP_001342797.1| GrpE protein [Marinomonas sp. MWYL1]
 gi|150838886|gb|ABR72862.1| GrpE protein [Marinomonas sp. MWYL1]
          Length = 192

 Score =  117 bits (294), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 62/186 (33%), Positives = 106/186 (56%), Gaps = 9/186 (4%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
              SE   +  +        T EE +E +   ++L +  ++++  LR  A+ +N+RRR +
Sbjct: 15  DLKSETQNETVEELLEPEVETLEEVTENDELAKALEEVAQYKEAALRAHADAQNVRRRAE 74

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           ++ + A  + + KFA+ +++V+DNL RAL SAP                + EG+E+T ++
Sbjct: 75  QDVEKAHKFGLEKFAKSIVNVADNLERALASAPDTGEPDP---------VREGVELTLKD 125

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           ++ TL R+ VK +D   + FNP +HQA+   P+  + ANT++ VVQ GY IN R+LRPA+
Sbjct: 126 LLETLARFEVKMVDPHGEPFNPELHQAITMVPNPELEANTVMDVVQKGYTINGRLLRPAM 185

Query: 183 VSISKG 188
           V +S  
Sbjct: 186 VVVSSA 191


>gi|302692146|ref|XP_003035752.1| hypothetical protein SCHCODRAFT_84403 [Schizophyllum commune H4-8]
 gi|300109448|gb|EFJ00850.1| hypothetical protein SCHCODRAFT_84403 [Schizophyllum commune H4-8]
          Length = 251

 Score =  117 bits (294), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 60/194 (30%), Positives = 93/194 (47%), Gaps = 15/194 (7%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           K    +     A  ++  EK  +   +    +  +   +   + A+  NL+R   REK+ 
Sbjct: 54  KEEPAKDEGKAAEGASPAEKECLEKLKTKEAEVVDLTSRLRYLQADFLNLQRNASREKEQ 113

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPL---------------DLANSEKKSESVLKSL 112
            + ++I KFA+D+L   D LS AL S P                     EK     L  L
Sbjct: 114 TRDFAITKFAKDLLETVDVLSLALKSIPSHHARPQADAPPPPQSADGKPEKGPAEYLHEL 173

Query: 113 IEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYA 172
             G+EMT+R++ STL +Y VK I+    KF+PNMH+A+++ P       T+I V + GY 
Sbjct: 174 YNGVEMTQRQLQSTLSKYNVKPIEPLGDKFDPNMHEALYQAPIPGKEPGTVIDVQKTGYM 233

Query: 173 INERVLRPALVSIS 186
           I +RVLR A V ++
Sbjct: 234 IKDRVLRAAQVGVA 247


>gi|158520086|ref|YP_001527956.1| GrpE protein [Desulfococcus oleovorans Hxd3]
 gi|158508912|gb|ABW65879.1| GrpE protein [Desulfococcus oleovorans Hxd3]
          Length = 217

 Score =  117 bits (294), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 57/196 (29%), Positives = 98/196 (50%), Gaps = 10/196 (5%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E    +   D   +         E        E +L + ++  DK LR  AE +N ++R 
Sbjct: 32  EEASPKAETDTGPDQEVQEEDPIEV--LDQQLEAALEEKKKVEDKLLRAAAEFDNYKKRL 89

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           +++  D + Y+     R++LSV DNL RA+ ++      +E         L+ G++MT  
Sbjct: 90  EKQWADFKKYAHEAVIRELLSVVDNLERAIVASKDTADQNEC--------LLSGVDMTLT 141

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           E++   E++GV +IDA  + F+PN H+A+     D   AN +I+  Q GY I++R+LRPA
Sbjct: 142 EILKVFEKFGVTRIDALGRSFDPNFHEAVARRETDDTDANIVIEEYQKGYMIHDRLLRPA 201

Query: 182 LVSISKGKTQNPTEEK 197
           +V +S G+    +   
Sbjct: 202 MVVVSAGRKNGNSAGG 217


>gi|30249898|ref|NP_841968.1| GrpE protein, molecular chaperone [Nitrosomonas europaea ATCC
           19718]
 gi|6226626|sp|O08384|GRPE_NITEU RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|3777486|dbj|BAA33934.1| GrpE [Nitrosomonas europaea]
 gi|30180935|emb|CAD85861.1| GrpE protein, molecular chaperone [Nitrosomonas europaea ATCC
           19718]
          Length = 195

 Score =  117 bits (294), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 56/190 (29%), Positives = 102/190 (53%), Gaps = 13/190 (6%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           M+  +  ++       +      A   S     +E+  ++ E  D +LR  AE EN+R+R
Sbjct: 18  MDDVLETEHSGTVAGNTERAGEDAAP-SLEQQLKEAEIRAAEHHDAWLRAKAETENIRKR 76

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
              +   A  Y+I  F+  +L+V D+L  AL +             S L++L +G+E+TR
Sbjct: 77  AQTDIASAHKYAIDNFSVQLLAVMDSLDAALAT-----------ENSTLENLRDGVELTR 125

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           +++ +  E++ +  ID + +KF+P+ H+AM          NT+I+V+Q GY +++RV+RP
Sbjct: 126 KQLAAVFEKFNIHTIDPQGEKFDPHQHEAMCAVE-SDFAPNTVIQVMQKGYMLHDRVIRP 184

Query: 181 ALVSISKGKT 190
           A+V++SK K 
Sbjct: 185 AMVTVSKAKG 194


>gi|261820283|ref|YP_003258389.1| heat shock protein GrpE [Pectobacterium wasabiae WPP163]
 gi|261604296|gb|ACX86782.1| GrpE protein [Pectobacterium wasabiae WPP163]
          Length = 195

 Score =  117 bits (294), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 60/191 (31%), Positives = 96/191 (50%), Gaps = 12/191 (6%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR----DKYLRVIAEMENL 57
           E  + +K   K +       +            E   Q  E +    D  LRV AE +N+
Sbjct: 11  EQVLDQKEAAKGQQADATPETADVADPRDARIAELETQLSELQQRERDNMLRVRAEADNV 70

Query: 58  RRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIE 117
           RRR + + + A  +++ KFA +ML V DNL RALD+A              L ++IEG+E
Sbjct: 71  RRRAEMDIEKAHKFAVEKFANEMLPVIDNLERALDTADKA--------NESLAAMIEGVE 122

Query: 118 MTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERV 177
           +T + ++  + ++G+  +      FNP +HQAM   P      N ++ V+Q GY +N R+
Sbjct: 123 LTLKSLLDAVHKFGIDVVGDVGVPFNPEVHQAMTMLPSADHQPNHVMMVMQKGYTLNGRL 182

Query: 178 LRPALVSISKG 188
           LRPA+V++SK 
Sbjct: 183 LRPAMVAVSKA 193


>gi|297792997|ref|XP_002864383.1| hypothetical protein ARALYDRAFT_495605 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297310218|gb|EFH40642.1| hypothetical protein ARALYDRAFT_495605 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 302

 Score =  117 bits (294), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 54/199 (27%), Positives = 105/199 (52%), Gaps = 5/199 (2%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           + + + + +  + +        + ++ +      +E +DK+LR  AE +NL  RT R  +
Sbjct: 104 DTDAEIDFDDMSRDDLVKLVGEKEDLLKVQQEDIKEMKDKFLRTYAEQQNLMDRTKRNAE 163

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPL-----DLANSEKKSESVLKSLIEGIEMTRR 121
           +A+ +++  FA  +L V+DNL RA           D +     +  +LK+L+EG+EMT +
Sbjct: 164 NAKKFAVQNFATSLLDVADNLERASSVVKESFSKIDTSKDSAGAAPLLKNLLEGVEMTEK 223

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           ++    ++ G+ K D  ++ F+PN H A+F+ P  + P  TI  V++ GY++ +RV+RPA
Sbjct: 224 QLAEVFKKSGLVKEDPLNEPFDPNKHNAVFQVPDASKPKGTIAHVLKPGYSLYDRVIRPA 283

Query: 182 LVSISKGKTQNPTEEKKET 200
            V ++        E++   
Sbjct: 284 EVGVTCAVENEEGEKESAA 302


>gi|94309949|ref|YP_583159.1| GrpE protein [Cupriavidus metallidurans CH34]
 gi|123081369|sp|Q1LPN6|GRPE_RALME RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|93353801|gb|ABF07890.1| heat shock/stress protein [Cupriavidus metallidurans CH34]
          Length = 180

 Score =  117 bits (294), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 61/191 (31%), Positives = 95/191 (49%), Gaps = 19/191 (9%)

Query: 5   MSEKNIDKEKNPSNANSST-------AEEKSEINIPEESLNQSEEFRDKYLRVIAEMENL 57
           M E+N     N   A  +         E         E   +++E  D +LR  AE EN+
Sbjct: 1   MEEQNQTPTPNTQAAEDAARTPEAGADEVGRLTQQVAELEAKAKEHYDMFLRATAEGENI 60

Query: 58  RRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIE 117
           RRR+  E   A  ++I  FA +++ V D+L  AL     D           L  L EG+E
Sbjct: 61  RRRSQDEVAKAHKFAIESFADNLVPVMDSLQAALADGTGD-----------LGKLREGVE 109

Query: 118 MTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERV 177
           +T R++ +  ER  + +++   +KF+P+ HQA+   P +    NT++ V+Q GY I +RV
Sbjct: 110 LTARQLAAAFERGRIVEVNPVGEKFDPHRHQAISMVPSEQ-EPNTVVNVLQRGYMIADRV 168

Query: 178 LRPALVSISKG 188
           LRPALV++S  
Sbjct: 169 LRPALVTVSAP 179


>gi|296284096|ref|ZP_06862094.1| molecular chaperone GrpE [Citromicrobium bathyomarinum JL354]
          Length = 207

 Score =  117 bits (294), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 65/177 (36%), Positives = 98/177 (55%), Gaps = 5/177 (2%)

Query: 13  EKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYS 72
           ++     + S            +   + E  R + L   AE +N+RRR +++  D ++YS
Sbjct: 35  DQGDDGDDESEQGVAKLAETVAKLNEELETARQEVLYARAETQNVRRRMEKDIADTRAYS 94

Query: 73  IAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGV 132
              FARD+LSVSDNLSRA+DS P +L           K LI GIE T+RE+     ++GV
Sbjct: 95  ATGFARDILSVSDNLSRAIDSIPEELRED-----GKFKGLIAGIEATQRELDRVFGQHGV 149

Query: 133 KKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
            ++ A     +PN+HQAM E P+D     T+++ +Q GY I +R+LRPALV ++K  
Sbjct: 150 TRVAAMGLPLDPNVHQAMMEIPNDEAEPGTVVQEMQAGYLIRDRLLRPALVGVAKKP 206


>gi|302556319|ref|ZP_07308661.1| co-chaperone GrpE [Streptomyces viridochromogenes DSM 40736]
 gi|302473937|gb|EFL37030.1| co-chaperone GrpE [Streptomyces viridochromogenes DSM 40736]
          Length = 205

 Score =  117 bits (293), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 43/172 (25%), Positives = 79/172 (45%), Gaps = 11/172 (6%)

Query: 16  PSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAK 75
            +N               +E   + +E  D++ R +A+++NLR+R  RE +  ++   ++
Sbjct: 43  DTNEEPGPDAAGGPAPSEDEHTAELKELEDRWRRALADLDNLRKRHARELERERTTERSR 102

Query: 76  FARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI 135
            A   L + DNL  AL  A  D             +++EG+   R + ++ LE  G  + 
Sbjct: 103 TAAAFLPILDNLELALTHAGSDPG-----------AIVEGVRAVRDQAVNVLELLGYPRH 151

Query: 136 DAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
                 F+P  H+ +        P  T+++V++ GY   ER LRPA V+++K
Sbjct: 152 AETGVAFDPARHEVVGVVQDPDAPPGTVVEVLRPGYGDGERQLRPAAVTVAK 203


>gi|126724516|ref|ZP_01740359.1| GrpE protein [Rhodobacterales bacterium HTCC2150]
 gi|126705680|gb|EBA04770.1| GrpE protein [Rhodobacterales bacterium HTCC2150]
          Length = 203

 Score =  117 bits (293), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 59/175 (33%), Positives = 98/175 (56%), Gaps = 8/175 (4%)

Query: 17  SNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKF 76
           S+      E  +E         + +E +D+ +R +AE EN R+R +R+++DA+ Y  ++ 
Sbjct: 35  SDEAMDEPEGDAEAEAFIALQQERDEMKDRLVRALAEAENTRKRGERDRRDAEKYGGSRL 94

Query: 77  ARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKK-I 135
           ARDM+ V D + RALDS P D             S+IEGI +T +E++S  +++G+    
Sbjct: 95  ARDMIPVYDAMKRALDSIPGDQK-------ESSASMIEGIALTMQELLSVFKKHGITPIF 147

Query: 136 DAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
             +  +F+ N+HQAMFE P     A  II+V++ G+ I++R+LR A V +S    
Sbjct: 148 PVEGDQFDANLHQAMFEAPVPGTTAGQIIQVMEQGFMIHDRLLRAANVGVSSTPK 202


>gi|303277531|ref|XP_003058059.1| mitochondrial protein translocase family [Micromonas pusilla
           CCMP1545]
 gi|226460716|gb|EEH58010.1| mitochondrial protein translocase family [Micromonas pusilla
           CCMP1545]
          Length = 150

 Score =  117 bits (293), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 59/150 (39%), Positives = 91/150 (60%), Gaps = 3/150 (2%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           Q ++  DK LR +A+MENLR RT R+ ++A+ ++I  F +D+L V+DNL RA  +   D 
Sbjct: 1   QVKDLNDKLLRTLADMENLRERTRRQAENAEKFAIQGFCKDLLDVADNLGRAAATVDADA 60

Query: 99  ANSEKKSESVLK---SLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPH 155
             +E   E + K   SL EG+ M  +++ ST  ++GV+K D   + F+PN H A+F  P 
Sbjct: 61  IAAESDGEKLKKMLTSLHEGVLMVEKQLGSTFGKHGVEKYDPTGEDFDPNAHMALFNVPD 120

Query: 156 DTVPANTIIKVVQDGYAINERVLRPALVSI 185
               A TI  V + GY +++RV+RPA V +
Sbjct: 121 AEKTAGTIASVTKAGYKLHDRVIRPAEVGV 150


>gi|315050720|ref|XP_003174734.1| grpE protein [Arthroderma gypseum CBS 118893]
 gi|311340049|gb|EFQ99251.1| grpE protein [Arthroderma gypseum CBS 118893]
          Length = 245

 Score =  117 bits (293), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 60/192 (31%), Positives = 102/192 (53%), Gaps = 8/192 (4%)

Query: 5   MSEKNIDK-EKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDR 63
            +E N DK +   +      +E  +     E    +  + +DKYLR +A+  NL+ RT R
Sbjct: 53  STEANGDKPKAEEATEAEKPSELDTLKKDLEAREKEVVDLKDKYLRSVADFRNLQERTRR 112

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL-ANSEKKSESVLKSLIEGIEMTRRE 122
           + + A++++I KFA D++   DNL RAL + P +    +  K    +  L  G++MT   
Sbjct: 113 DVEAARTFAIQKFAGDLIESIDNLERALGAVPPEKVDAANAKENKDVYDLFSGLKMTEGI 172

Query: 123 MMSTLERYGV------KKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINER 176
           +M+TL+++GV      + +D + QKF+P+ H+A+F  P +      I+ V   G+ +N R
Sbjct: 173 LMNTLKKHGVVRFDPSEPVDGQPQKFDPSRHEALFMSPMEGKQDGDIMHVQNKGFTLNGR 232

Query: 177 VLRPALVSISKG 188
           VLR A V + K 
Sbjct: 233 VLRAAKVGVVKN 244


>gi|157376462|ref|YP_001475062.1| GrpE protein [Shewanella sediminis HAW-EB3]
 gi|189041747|sp|A8FYL1|GRPE_SHESH RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|157318836|gb|ABV37934.1| GrpE protein [Shewanella sediminis HAW-EB3]
          Length = 209

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 59/197 (29%), Positives = 105/197 (53%), Gaps = 11/197 (5%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEE---KSEINIPEESLNQSEEFRDKYLRVIAEMENLR 58
           E     +N       S  +  T      +      E +  + +E +D  +R  AE++N+R
Sbjct: 20  EIITDNENETVTGEASLMDELTQANFRVEELEQALEAATAKVDEQKDSVIRAAAEVDNIR 79

Query: 59  RRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEM 118
           RR   + + A+ +++ KFA ++L V DN+ RAL     +            K++ EG+E+
Sbjct: 80  RRAAIDVEKARKFALEKFANELLPVIDNMERALQGTDAE--------AEATKAVYEGVEL 131

Query: 119 TRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVL 178
           T +  + T+E++G+  ++ + + FNP  HQA+  +P    PANT++ V+Q GY +NER+L
Sbjct: 132 TLKSFIGTVEKFGLTVVNPQGETFNPEHHQAIGMQPSPDFPANTVMMVMQKGYILNERLL 191

Query: 179 RPALVSISKGKTQNPTE 195
           RPA+V +S+G     T+
Sbjct: 192 RPAMVMVSQGGAAVDTQ 208


>gi|94496902|ref|ZP_01303476.1| GrpE protein [Sphingomonas sp. SKA58]
 gi|94423578|gb|EAT08605.1| GrpE protein [Sphingomonas sp. SKA58]
          Length = 184

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 67/188 (35%), Positives = 101/188 (53%), Gaps = 8/188 (4%)

Query: 5   MSEKNIDKEKNP---SNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           MSE N + EK     +      +   +  +       +    +   L   A+ +N+RRR 
Sbjct: 1   MSEDNQNLEKTEVVDALPEDGASSGNATADRIAALEAELATAKQDILYAHADTQNVRRRL 60

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           ++E  DA++Y+   FARDMLSV+DNL+RAL + P DL +         K L+ G+E T R
Sbjct: 61  EKELADARAYAATAFARDMLSVADNLTRALAAIPADLRDD-----EKFKGLVVGLEATGR 115

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           E+ S   R G+ K+++  Q  +PN HQAM E P       TI+  +Q GY I +R+LRPA
Sbjct: 116 ELESVFGRNGITKLESVGQPLDPNKHQAMMEVPSSDAEPGTILVEMQAGYMIKDRLLRPA 175

Query: 182 LVSISKGK 189
           +VS++K  
Sbjct: 176 MVSVAKKP 183


>gi|149184527|ref|ZP_01862845.1| molecular chaperone GrpE [Erythrobacter sp. SD-21]
 gi|148831847|gb|EDL50280.1| molecular chaperone GrpE [Erythrobacter sp. SD-21]
          Length = 200

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 63/204 (30%), Positives = 101/204 (49%), Gaps = 24/204 (11%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEE-------------------SLNQSEEFRD 45
           M+ +N ++ ++ +       E +       +                        E  + 
Sbjct: 1   MTNENTNEPQDKAVDEEVAREMEGVPEHLRDNGGEDEDAADEALDDALASLRGDLETAKQ 60

Query: 46  KYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKS 105
           + L   AE +N+RRR +++ +DA++Y+   FARD+LSV+DNL RALD+ P +        
Sbjct: 61  EVLYARAETQNVRRRMEKDVQDARNYAATGFARDILSVADNLGRALDAIPAEQRED---- 116

Query: 106 ESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIK 165
              LK  I GIE T+RE+     + G+ +I AK    +PN HQAM E P       TI++
Sbjct: 117 -EKLKGFIAGIEATQRELEKVFNQNGITRIAAKGMPLDPNQHQAMMEIPTADAEPGTIVQ 175

Query: 166 VVQDGYAINERVLRPALVSISKGK 189
            +Q GY I +R+LRPA+V ++K  
Sbjct: 176 EMQAGYMIKDRLLRPAMVGVAKKP 199


>gi|78356072|ref|YP_387521.1| heat shock protein GrpE [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78218477|gb|ABB37826.1| heat shock protein GrpE [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 194

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 49/149 (32%), Positives = 85/149 (57%), Gaps = 9/149 (6%)

Query: 38  NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD 97
           ++ ++  D  LR +AE+EN+++R +RE+++   Y+  K   D+L   D+L  AL     D
Sbjct: 54  DEHQKAEDIRLRALAELENVKKRLEREREEHLKYAAEKVLSDLLPTLDHLDLALQYGSSD 113

Query: 98  LANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157
                       K++  G+EMTR+  +  L  +G++ +  K Q F+P +H+A+ +E    
Sbjct: 114 ---------PACKNMAVGVEMTRKLFLDALAGHGLQPVGEKGQPFDPALHEAVSKEEAPG 164

Query: 158 VPANTIIKVVQDGYAINERVLRPALVSIS 186
             + TII V+Q GY + ER+LRPA V++S
Sbjct: 165 TESGTIIAVMQRGYRLKERLLRPAKVTVS 193


>gi|319792565|ref|YP_004154205.1| grpe protein [Variovorax paradoxus EPS]
 gi|315595028|gb|ADU36094.1| GrpE protein [Variovorax paradoxus EPS]
          Length = 176

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 55/159 (34%), Positives = 85/159 (53%), Gaps = 12/159 (7%)

Query: 32  IPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRAL 91
                  ++ E  D+YLR  A+++N RRR D E   A+ +++  FA  +L V+D+L   L
Sbjct: 29  ELAALQAKNAELADQYLRAQADVQNARRRADDEITKARKFAVEAFAESLLPVTDSLEAGL 88

Query: 92  DSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG-VKKIDAKDQKFNPNMHQAM 150
                         ++  + + EG E T R++ S LER   ++   A   +F+P+ HQA+
Sbjct: 89  AI-----------KDATPEQIREGAEATLRQLKSALERNKVIEVAPAAGTRFDPHQHQAI 137

Query: 151 FEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
              P      NT++ V+Q GY INERVLRPALV++S  K
Sbjct: 138 SVVPAPEQEPNTVVSVLQKGYTINERVLRPALVTVSAPK 176


>gi|256830644|ref|YP_003159372.1| GrpE protein [Desulfomicrobium baculatum DSM 4028]
 gi|256579820|gb|ACU90956.1| GrpE protein [Desulfomicrobium baculatum DSM 4028]
          Length = 181

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 51/186 (27%), Positives = 98/186 (52%), Gaps = 9/186 (4%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
            ++  + ++  +   +  A+E +      ++L   EE +   LRV+A+ EN ++R  REK
Sbjct: 5   EKEGQNPDEVQTEMQAEEAKELTLEEKYVQALADMEELKKDNLRVLADSENFKKRLLREK 64

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
           +D   ++ +    +++ V DNL  AL                  K L+ G+EMT    + 
Sbjct: 65  EDYFKFATSAILEEIIPVMDNLDLALAHGK---------QTEACKDLVTGVEMTMNIFLD 115

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
           T++++G+++I A D  F+P  H+A+ +   D V  NT+ +++Q GY + +R+LRPA V +
Sbjct: 116 TMKKHGLEQIGAVDVPFDPARHEALGQVERDDVDENTVCQMLQKGYMLKDRLLRPAKVMV 175

Query: 186 SKGKTQ 191
           S+   +
Sbjct: 176 SRKAGE 181


>gi|84387683|ref|ZP_00990700.1| GrpE [Vibrio splendidus 12B01]
 gi|84377528|gb|EAP94394.1| GrpE [Vibrio splendidus 12B01]
          Length = 221

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 58/173 (33%), Positives = 101/173 (58%), Gaps = 8/173 (4%)

Query: 15  NPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIA 74
           N   A+   ++          S ++ +E +D  LR  AE+EN+RRRT++E   A+ Y++ 
Sbjct: 57  NEDAADEQESKIAQLEAALLSSESKVKEQQDSVLRAKAEVENMRRRTEQEVDKARKYALN 116

Query: 75  KFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKK 134
           KFA  +L V DNL RA+ +A  +           +K ++EG+E+T +  + T+ ++G+ +
Sbjct: 117 KFAEGLLPVIDNLERAVQAADAE--------NEAVKPILEGVELTHKTFVDTVAKFGLTE 168

Query: 135 IDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           I+ + + FNP  HQAM  +      +NT++ V+Q GY +N RV+RPA+V ++K
Sbjct: 169 INPEGEAFNPEFHQAMSIQESPDHESNTVMFVMQKGYELNGRVIRPAMVMVAK 221


>gi|313893370|ref|ZP_07826942.1| co-chaperone GrpE [Veillonella sp. oral taxon 158 str. F0412]
 gi|313442011|gb|EFR60431.1| co-chaperone GrpE [Veillonella sp. oral taxon 158 str. F0412]
          Length = 177

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 53/185 (28%), Positives = 95/185 (51%), Gaps = 14/185 (7%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR----DKYLRVIAEMENLRRR 60
           M+E+   K++     N      ++   +  ++    EE +    ++Y R+ A+ EN +RR
Sbjct: 1   MAEEQDIKQETVDATNVEETTVEATEEVVADAAQVLEELKADFDNRYKRLQADFENFKRR 60

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T++EK+    Y       D+L V DN  RA+ S           +E   K  ++G  M  
Sbjct: 61  TNQEKEQLAGYVKGDVLTDLLPVLDNFERAVQS----------PAEGEAKLFLDGFIMIH 110

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + +M+ L ++G+  I+A  Q F+PN HQA+   P D   ++T+ +V+Q GY ++ R +RP
Sbjct: 111 QNLMAMLSKHGLAVIEAVGQPFDPNFHQAIMRVPSDEFESDTVCEVLQTGYTVDGRCIRP 170

Query: 181 ALVSI 185
           A+V +
Sbjct: 171 AMVKV 175


>gi|46447132|ref|YP_008497.1| heat shock protein GrpE [Candidatus Protochlamydia amoebophila
           UWE25]
 gi|52782876|sp|Q6MB27|GRPE_PARUW RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|46400773|emb|CAF24222.1| probable heat shock protein GrpE [Candidatus Protochlamydia
           amoebophila UWE25]
          Length = 211

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 45/197 (22%), Positives = 93/197 (47%), Gaps = 8/197 (4%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           E+  ++     +A +   +        +    ++ E++DKYLR++A+ EN R+R  +E++
Sbjct: 22  EQTGEENIEFPSAPNHPKQVLVTDEELKALKKEATEYKDKYLRLLADSENARKRLQKERQ 81

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
           +   Y++     D L   DNL  AL  A        +     +K+   G +M   +    
Sbjct: 82  EISRYALENMVVDFLKPLDNLENALKFA--------QGMSDEVKNWAFGFQMILTQFKDV 133

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           L   G+  ++++   F+P++H+A+     D+     I++    GY + +R++RPA V ++
Sbjct: 134 LASNGITALESQGTFFDPHLHEAIEMVETDSYAPGIIVEENVRGYKMGDRMIRPARVKVA 193

Query: 187 KGKTQNPTEEKKETIEQ 203
           K  +    ++K E  E 
Sbjct: 194 KAISAIDPQDKSELNEN 210


>gi|195047721|ref|XP_001992399.1| GH24729 [Drosophila grimshawi]
 gi|193893240|gb|EDV92106.1| GH24729 [Drosophila grimshawi]
          Length = 200

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 53/145 (36%), Positives = 92/145 (63%), Gaps = 4/145 (2%)

Query: 43  FRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE 102
              KY R +AE EN+R R +++  DA+ + I  F +D++ V+D L +A ++ P D  ++ 
Sbjct: 59  LLHKYKRTLAEGENMRNRLNKQIGDARIFGIQGFCKDLIDVADVLGQATEAVPKDRLDT- 117

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162
                 L+SL EG+++TR  +    +R+G++  D  +QKF+PN H+A+F+    TV A+T
Sbjct: 118 ---NPDLQSLYEGLQLTRASLQQVFKRHGLETRDPINQKFDPNQHEALFQTVGATVEADT 174

Query: 163 IIKVVQDGYAINERVLRPALVSISK 187
           +++V + GY ++ R +RPALV +SK
Sbjct: 175 VVQVTKLGYQLHNRCIRPALVGVSK 199


>gi|270265315|ref|ZP_06193576.1| protein GrpE [Serratia odorifera 4Rx13]
 gi|270040719|gb|EFA13822.1| protein GrpE [Serratia odorifera 4Rx13]
          Length = 190

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 63/184 (34%), Positives = 101/184 (54%), Gaps = 9/184 (4%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR-DKYLRVIAEMENLRRRTDREKK 66
           + +D+++             + I   E  L +S++   D  LR  AEMEN+RRRT+ + +
Sbjct: 15  EEMDQQEVLPEVAEGVDLRDARIAELETQLAESQQHERDSLLRAKAEMENVRRRTELDIE 74

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
            A  +++ KFA D+L V DNL RALD A              L ++IEGIE+T + +   
Sbjct: 75  KAHKFALEKFAGDLLPVIDNLERALDLADKS--------NPELTAMIEGIELTLKSLQDA 126

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           + +YG++ +   +  FNP++HQAM          N ++ V+Q GY +N R+LRPA+V++S
Sbjct: 127 VSKYGIEIVGDINVPFNPDVHQAMSLMESADHQPNHVMMVMQKGYTLNGRLLRPAMVAVS 186

Query: 187 KGKT 190
           K K 
Sbjct: 187 KAKA 190


>gi|194377212|dbj|BAG63167.1| unnamed protein product [Homo sapiens]
          Length = 196

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 53/168 (31%), Positives = 90/168 (53%), Gaps = 6/168 (3%)

Query: 23  TAEEKSEINIPEE---SLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARD 79
             ++K+     EE      Q +E  +KY R +A+ ENLR+R+ +  ++A+ Y I  F +D
Sbjct: 30  ATKQKNSGQNLEEDMGQSEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKD 89

Query: 80  MLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKD 139
           +L V+D L +A    P +    +      LK+L EG+ MT  ++     ++G+ K++   
Sbjct: 90  LLEVADVLEKATQCVPKEEIKDD---NPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVG 146

Query: 140 QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            KF+P  H+A+F  P +     T+  V + GY ++ R LRPALV + K
Sbjct: 147 AKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVK 194


>gi|254380628|ref|ZP_04995994.1| grpE 2 [Streptomyces sp. Mg1]
 gi|194339539|gb|EDX20505.1| grpE 2 [Streptomyces sp. Mg1]
          Length = 202

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 44/172 (25%), Positives = 77/172 (44%), Gaps = 11/172 (6%)

Query: 16  PSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAK 75
            +       +        +E     +E  D++ R +A++ENLR+R  RE +  +    ++
Sbjct: 40  EAANGEPGPDAAGPAPAEDEYTTAIQELEDRWRRALADLENLRKRHARELERERVAERSR 99

Query: 76  FARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI 135
            A   L V DNL  AL  A  D             +++EGI+  R + ++ LE  G  + 
Sbjct: 100 TAAAFLPVLDNLELALTHAGADPG-----------AIVEGIQAVRDQAVNVLELLGYPRH 148

Query: 136 DAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
                 F+P  H+ +        P  T+++V++ GY    R LRPA V+++K
Sbjct: 149 AETGVPFDPARHEVVGVVQDPDAPPGTVVEVMRPGYGDGGRQLRPAAVTVAK 200


>gi|23015825|ref|ZP_00055591.1| COG0576: Molecular chaperone GrpE (heat shock protein)
           [Magnetospirillum magnetotacticum MS-1]
          Length = 203

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 67/185 (36%), Positives = 111/185 (60%), Gaps = 4/185 (2%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   + ++ D+  +   A  S A   +E    +E   +  + ++  L   AE EN RRR 
Sbjct: 8   EQTPAAESADQSADQGPAAESAAAAPAESERIKELEAEIAKLKNDVLYAKAETENTRRRL 67

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           +++ +D   Y+I+  A+D+L V+DNL RALDS P     + ++    L +L  G+EMT R
Sbjct: 68  EQQAEDRGKYAISNIAKDVLGVADNLRRALDSVPQ----AAREGNESLTALTTGVEMTER 123

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           E+++T ERYG+K ++A+  KF+PN+HQAM E    +    T++ V+Q GY +++R+LRPA
Sbjct: 124 ELLATFERYGIKMVEAQGAKFDPNLHQAMMEMEDPSQIEGTVVLVMQAGYTLHDRLLRPA 183

Query: 182 LVSIS 186
           LV ++
Sbjct: 184 LVGVA 188


>gi|145349909|ref|XP_001419369.1| chloroplast GrpE-like protein [Ostreococcus lucimarinus CCE9901]
 gi|144579600|gb|ABO97662.1| chloroplast GrpE-like protein [Ostreococcus lucimarinus CCE9901]
          Length = 274

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 43/179 (24%), Positives = 80/179 (44%), Gaps = 8/179 (4%)

Query: 11  DKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQS 70
           D         S   E            +Q    +D+YLR+ A+ +N R+RT +EK++  S
Sbjct: 104 DNADAAELVASLKGEIGDANAKMVGMEDQVAAMKDQYLRLNADFDNFRKRTLKEKENLAS 163

Query: 71  YSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERY 130
            +   F + +L V DN   A  +        E         ++ G +   +++M  L   
Sbjct: 164 SAKGDFVKALLPVLDNFDLAEKNIKGSTEGEE--------KILTGYQNMHKQLMEILSSQ 215

Query: 131 GVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
           G++ +    + F+PN H+A+  E +D +  +TII+  + GY I   ++R ++V +S   
Sbjct: 216 GLQVVAGVGEPFDPNDHEAIMREENDEMDEDTIIEEFRKGYKIGSSLIRASMVKVSTKP 274


>gi|116074296|ref|ZP_01471558.1| molecular chaperone GrpE, heat shock protein [Synechococcus sp.
           RS9916]
 gi|116069601|gb|EAU75353.1| molecular chaperone GrpE, heat shock protein [Synechococcus sp.
           RS9916]
          Length = 252

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 44/207 (21%), Positives = 90/207 (43%), Gaps = 8/207 (3%)

Query: 13  EKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYS 72
           E+  ++A  + A  +           + E  R +Y+R+ A+ +N R+R  R++ D +   
Sbjct: 50  EQPATDARDNDARLEQLEREHSSLREEHETLRSQYMRIAADFDNFRKRQSRDQDDLKLQL 109

Query: 73  IAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGV 132
                 ++L V DN  RA      +            ++L    +   ++++  L++ GV
Sbjct: 110 TCNTLSEILPVVDNFERARQQLNPEG--------EEAQALHRSYQGLYKQLVEVLKQLGV 161

Query: 133 KKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQN 192
             +    Q+F+P +H+A+  EP +    + +I+ +Q GY +N RVLR A+V +S G    
Sbjct: 162 APMRVVGQEFDPTLHEAVLREPSEEHHEDVVIEELQRGYHLNGRVLRHAMVKVSMGPGPQ 221

Query: 193 PTEEKKETIEQPSPLDIEERNKTQTKN 219
                    +  +    ++ +     N
Sbjct: 222 GEAAAAPAADAVTDSGSDQASMEGEPN 248


>gi|159902557|ref|YP_001549901.1| heat shock protein GrpE [Prochlorococcus marinus str. MIT 9211]
 gi|226737158|sp|A9B9L4|GRPE_PROM4 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|159887733|gb|ABX07947.1| Heat shock protein GrpE [Prochlorococcus marinus str. MIT 9211]
          Length = 247

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 50/213 (23%), Positives = 98/213 (46%), Gaps = 9/213 (4%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           E   + +   S+A  S+++        E+   + E    +Y+R+ A+ +N R+R  R++ 
Sbjct: 43  EAGAETDVTSSDAKDSSSQALDNEARLEQLEREHETLNSQYMRIAADFDNFRKRQSRDQD 102

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
           D +          +L V DN  RA      +            ++L +  +   ++++  
Sbjct: 103 DLRLQLQCNTLSSILPVVDNFDRARQQLNPEG--------EEAQALHKSYQGLYKQLVDV 154

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           L++ GV  +    Q F+P++H+A+  EP D +  + I++ +Q GY +N RVLR ALV +S
Sbjct: 155 LKQLGVAPMRVVGQTFDPSLHEAVLREPSDELAEDIIVEELQRGYHLNGRVLRHALVKVS 214

Query: 187 KGKTQNPTEEKKETIEQPSPLDIEERNKTQTKN 219
            G      + ++   EQ    D     ++  K+
Sbjct: 215 MGPGPK-DDGEETITEQSLEGDNTTDQQSSEKS 246


>gi|241764686|ref|ZP_04762698.1| GrpE protein [Acidovorax delafieldii 2AN]
 gi|241365856|gb|EER60505.1| GrpE protein [Acidovorax delafieldii 2AN]
          Length = 213

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 63/189 (33%), Positives = 96/189 (50%), Gaps = 14/189 (7%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEIN-IPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           T  S++    E+  +   +  ++E + +     E   +S +  D++LR  AE EN RRR 
Sbjct: 37  TNASQQAPAPEEVEAAMAAHASDELARLQGELAELKAKSADLADQFLRAKAEAENARRRA 96

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           + E   A+ + I  FA  +L V+D+L  AL                  + L EG + T R
Sbjct: 97  EDEVSKARKFGIESFAESLLPVADSLDAALAIKEASP-----------QQLREGADATLR 145

Query: 122 EMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           +++S LER  V  I      KF+P+ HQA+   P     ANT++ V+Q GY I +RVLRP
Sbjct: 146 QLISALERNKVLAIQPAAGDKFDPHQHQAISVVP-ADQEANTVVAVLQKGYVIADRVLRP 204

Query: 181 ALVSISKGK 189
           ALV++S  K
Sbjct: 205 ALVTVSAPK 213


>gi|115475980|ref|NP_001061586.1| Os08g0338700 [Oryza sativa Japonica Group]
 gi|38636943|dbj|BAD03205.1| putative chaperone GrpE [Oryza sativa Japonica Group]
 gi|38637387|dbj|BAD03646.1| putative chaperone GrpE [Oryza sativa Japonica Group]
 gi|113623555|dbj|BAF23500.1| Os08g0338700 [Oryza sativa Japonica Group]
 gi|215704442|dbj|BAG93876.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215765184|dbj|BAG86881.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|218200983|gb|EEC83410.1| hypothetical protein OsI_28865 [Oryza sativa Indica Group]
 gi|222640387|gb|EEE68519.1| hypothetical protein OsJ_26957 [Oryza sativa Japonica Group]
          Length = 311

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 64/200 (32%), Positives = 111/200 (55%), Gaps = 5/200 (2%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
             D E    +    T     +  + +    + ++ +DK LR  AEMEN+  RT RE  +A
Sbjct: 112 QADTEDLDLSKEDLTKLVLEKEELLKSKDEEVKDMKDKVLRSYAEMENVIARTKRESDNA 171

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPL-----DLANSEKKSESVLKSLIEGIEMTRREM 123
           + Y++  F++ +L V+DNLSRA           D +N   ++  +L +L+EG+EMT +++
Sbjct: 172 KKYAVQGFSKSLLDVADNLSRASSVVKESFSKIDTSNESAEAVKLLNTLLEGVEMTEKQL 231

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
               +++GV+K D  ++KF+PN H A+F+ P  + P+ T+  VV+ GY +++RVLRPA V
Sbjct: 232 GEVFKKFGVEKFDPLNEKFDPNKHAALFQIPDPSKPSGTVAAVVKVGYMLHDRVLRPAEV 291

Query: 184 SISKGKTQNPTEEKKETIEQ 203
            +++G       E+K     
Sbjct: 292 GVTEGGPIEEEPEEKSDKSD 311


>gi|148657564|ref|YP_001277769.1| GrpE protein [Roseiflexus sp. RS-1]
 gi|148569674|gb|ABQ91819.1| GrpE protein [Roseiflexus sp. RS-1]
          Length = 204

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 53/196 (27%), Positives = 96/196 (48%), Gaps = 9/196 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           ET    +       P    ++    ++      E   ++ E RD +LR +A+ +N +RRT
Sbjct: 15  ETTTDGQEATTPAAPVEEGAAPLSVEALQARIAELERENAELRDNWLRAVADYKNFKRRT 74

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           D+E+ +    + A     +L V D+L RA+ S   ++A +             G ++  +
Sbjct: 75  DQERAELIRSASAALLLKLLPVMDDLERAMASVTPEVAETPW---------YGGFKLIPQ 125

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           ++ + LE  GV ++    + F+PN H+A+  EP +      +I  +Q GY + +RVLRPA
Sbjct: 126 KLQAILESEGVSRMQTVGEPFDPNRHEAIIYEPSEDGEDGRVIAELQHGYLLRDRVLRPA 185

Query: 182 LVSISKGKTQNPTEEK 197
           +V +S+GK Q+   E 
Sbjct: 186 MVKVSQGKKQSSDSET 201


>gi|332528802|ref|ZP_08404779.1| heat shock protein GrpE [Hylemonella gracilis ATCC 19624]
 gi|332041868|gb|EGI78217.1| heat shock protein GrpE [Hylemonella gracilis ATCC 19624]
          Length = 174

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 58/186 (31%), Positives = 91/186 (48%), Gaps = 13/186 (6%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           M++         ++ + +            E   +S E  D+YLR  A+++N RRR D E
Sbjct: 1   MTDPQATPSTESTHVDLNGDPLAQAHAELAELKAKSAELADQYLRAQADVQNARRRADEE 60

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
              A+ ++I  FA  +L V+D+L   L              ++    + EG E T R++ 
Sbjct: 61  ISKARKFAIEAFAESLLPVADSLEAGLAI-----------KDATPAQIREGAEATLRQLA 109

Query: 125 STLERYGVKKIDA-KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
           + LER  V  I      KF+P+ HQA+   P     ANT++ V+Q GY I +RVLRPALV
Sbjct: 110 AALERNKVIAIAPAPGTKFDPHQHQAISMVP-AEQEANTVVSVLQKGYTIADRVLRPALV 168

Query: 184 SISKGK 189
           +++  K
Sbjct: 169 TVAAPK 174


>gi|168063350|ref|XP_001783635.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162664825|gb|EDQ51530.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 251

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 39/207 (18%), Positives = 85/207 (41%), Gaps = 8/207 (3%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   ++         S   +   E  S        + +    +D+YLR+ A+ +N R+R+
Sbjct: 53  EAVAADDEGAISDVESQLEAIANERDSLGLKVNSLIEEISTNKDRYLRLNADFDNYRKRS 112

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           +R++         +    +L + DN  RA  S   +            + +    +   +
Sbjct: 113 ERDRLATAGNVRGEVIESLLPMVDNFERAKTSIKTETEAE--------QKIDNAYQGIYK 164

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           + +  ++  GV  ++   + F+PN+H+A+  E       + + +  + G+ I +R+LRPA
Sbjct: 165 QFVEIMKSLGVVAVETVGKPFDPNLHEAIMREDSTEFAEDVVSQEFRRGFRIGDRLLRPA 224

Query: 182 LVSISKGKTQNPTEEKKETIEQPSPLD 208
           +V +S G       +    IE+    +
Sbjct: 225 MVKVSSGPGPAAATDTDLPIEEALANE 251


>gi|303247468|ref|ZP_07333740.1| GrpE protein [Desulfovibrio fructosovorans JJ]
 gi|302491164|gb|EFL51056.1| GrpE protein [Desulfovibrio fructosovorans JJ]
          Length = 178

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 50/180 (27%), Positives = 89/180 (49%), Gaps = 9/180 (5%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
                ++ +    + A + S     E+   +     D+ LR +AE ENL++R  +EK++ 
Sbjct: 4   EPKNPEDAATPEETGATDLSPEAEIEQLRAELAAEADRRLRTLAETENLKKRLLKEKEEF 63

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
           Q Y+      ++L V D+L  AL            +     K  + G++MTR+  +  L 
Sbjct: 64  QKYATESLVSELLPVLDHLDLALAHG---------RGNEACKDFVVGVDMTRKAFVDILA 114

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           R+GV +  A+ + FNP  H+A+       +P + + +VVQ GY++  R+LRPA V ++K 
Sbjct: 115 RHGVAEFGAEGEAFNPETHEALGMAARPDLPDDAVAQVVQKGYSLRGRLLRPAKVMVNKA 174


>gi|258653743|ref|YP_003202899.1| GrpE protein [Nakamurella multipartita DSM 44233]
 gi|258556968|gb|ACV79910.1| GrpE protein [Nakamurella multipartita DSM 44233]
          Length = 177

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 48/182 (26%), Positives = 82/182 (45%), Gaps = 9/182 (4%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           MS+    + +  SN   S     +E     +   Q  E  D + R  AE+EN R+R  R+
Sbjct: 1   MSDPEAPRTQTASNRTGSDEAPANETPERVDQALQIAELEDAWRRTAAELENFRKRCARD 60

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
               +    A  A   L V DNL RAL+ A  D             +++EG+     + +
Sbjct: 61  MVRGREQERAAVATSWLPVLDNLERALEHASSDPDPD---------TVVEGVRAVLAQAV 111

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
             L   G  + D   + F+P +H+A+     + +   T+ +VV+ GY  ++++LRPA V 
Sbjct: 112 GVLADLGYPRRDDDGRAFDPAVHEAVGTVSGEGLVPGTVAQVVRPGYGPDDKILRPAAVV 171

Query: 185 IS 186
           ++
Sbjct: 172 VA 173


>gi|256082642|ref|XP_002577563.1| grpe protein [Schistosoma mansoni]
 gi|238662886|emb|CAZ33801.1| grpe protein, putative [Schistosoma mansoni]
          Length = 222

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 50/178 (28%), Positives = 88/178 (49%), Gaps = 8/178 (4%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEE----FRDKYLRVIAEMENLRRRTDREKKDAQ 69
              +   S+  E   EI   +  + +  E      DKY R +AE EN+R+R  ++  +A+
Sbjct: 44  STETVEESTPKESDKEIESLKTEMQKITENYHNLDDKYKRALAESENMRKRLMKQIDEAK 103

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
            + I    +D+L V+D L+ A  SAP D             +L  G+ +T  ++     R
Sbjct: 104 LFGIQSLCKDLLEVADILTSATKSAPQDQLKD--GVNPPFANLYHGLVLTESQLFKVFSR 161

Query: 130 YGVKKIDAK-DQKFNPNMHQAMFEEPHD-TVPANTIIKVVQDGYAINERVLRPALVSI 185
           + + +I  +  + F+PN+H+A+F+ P +     NT+  V + GY ++ R LRPA V +
Sbjct: 162 HNLVQISPEVGEHFDPNIHEAVFQAPLEAGKEKNTVAVVTKVGYQLHGRPLRPAFVGV 219


>gi|73954212|ref|XP_546313.2| PREDICTED: similar to GrpE protein homolog 2, mitochondrial
           precursor (Mt-GrpE#2) [Canis familiaris]
          Length = 281

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 41/174 (23%), Positives = 89/174 (51%), Gaps = 3/174 (1%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
           ++P +    +  E++      +   + ++   +Y R +A+ EN+RRRT R  +DA+ + I
Sbjct: 103 EDPPDELGPSLAERTLKLKAVKLEKEVQDLTMRYQRAVADGENIRRRTQRCVEDAKIFGI 162

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
             F +D++ V+D L +  +    +    ++K    L+ +  G+ +   ++ S   ++G++
Sbjct: 163 QSFCKDLVEVADILEKTTEYISEETEPGDQKLT--LEKIFRGLSLLEAKLKSVFAKHGLE 220

Query: 134 KIDAKDQKFNPNMHQAMFEEPHD-TVPANTIIKVVQDGYAINERVLRPALVSIS 186
           K+     K++P+ H+ +   P    V   T+  V QDGY ++ R +R A V ++
Sbjct: 221 KMTPIGDKYDPHEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVA 274


>gi|317052547|ref|YP_004113663.1| GrpE protein [Desulfurispirillum indicum S5]
 gi|316947631|gb|ADU67107.1| GrpE protein [Desulfurispirillum indicum S5]
          Length = 174

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 53/184 (28%), Positives = 102/184 (55%), Gaps = 10/184 (5%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           MSE N ++    + + +  A    E         + +E  ++ LR+ AE EN ++R ++E
Sbjct: 1   MSEHNTNEASEQAQSPAEGATPD-EGAALANLEKRVQEKEEQLLRLHAEFENFKKRNNKE 59

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
           + DA  ++  +  +D+L++ DNL  A+   P          +   K++ +G+EMTR++  
Sbjct: 60  RHDAVRFANQQIIKDLLTMLDNLDLAISHIPAG--------DEAYKAIRDGVEMTRKQFA 111

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
           + LE+YG++++     +F+PN H+A+ +E       N I+ V+Q GY +++RV+RPA+V 
Sbjct: 112 NLLEKYGLQEVPTDG-EFDPNHHEAVMQEASPDHENNHIVAVLQKGYLLHDRVVRPAMVK 170

Query: 185 ISKG 188
           + K 
Sbjct: 171 VCKK 174


>gi|254440319|ref|ZP_05053813.1| co-chaperone GrpE [Octadecabacter antarcticus 307]
 gi|198255765|gb|EDY80079.1| co-chaperone GrpE [Octadecabacter antarcticus 307]
          Length = 190

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 59/191 (30%), Positives = 108/191 (56%), Gaps = 13/191 (6%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           ++  M+++NI  E        +  E  +E +       +  E +D Y+R +A++EN R+R
Sbjct: 11  LDDIMADQNIGPED-----EMTLDEMVAEDDNVVALKTEVLELKDGYMRALADVENSRKR 65

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
            DR++++A++Y  ++ ARD+L + DNL RAL     D  + +       K+L+EG+E+T 
Sbjct: 66  ADRDRREAENYGGSRLARDLLPIYDNLERALKMNKEDGKDGD-------KALLEGVELTM 118

Query: 121 REMMSTLERYGVKKI-DAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
           R ++   +++G+  I     ++F+P +H+AMFE P     A  II+V   G+ +++R+LR
Sbjct: 119 RALIGVFKKHGIDPIVAEVGERFDPQIHEAMFEAPLPETKAGDIIQVASTGFMLHDRLLR 178

Query: 180 PALVSISKGKT 190
           PA V +S    
Sbjct: 179 PAQVGVSSTPK 189


>gi|318042988|ref|ZP_07974944.1| molecular chaperone GrpE, heat shock protein [Synechococcus sp.
           CB0101]
          Length = 226

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 41/165 (24%), Positives = 76/165 (46%), Gaps = 8/165 (4%)

Query: 28  SEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNL 87
                 E    + E  R +Y+R+ A+ +N R+R  R++ D +         ++L V DN 
Sbjct: 53  ELEAELEALKAEHETVRSQYMRIAADFDNFRKRQSRDQDDMRVQIACSTLSEILPVVDNF 112

Query: 88  SRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMH 147
            RA                   +++    +   ++++   ++ GV  +  + + F+PN+H
Sbjct: 113 ERARQQLE--------PQAEEAQTIHRSYQGLYKQLVDVFKQLGVSPMRVEGEPFDPNLH 164

Query: 148 QAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQN 192
           +A+  EP D    + +I  +Q GY +N RVLR ALV +S G   +
Sbjct: 165 EAVLREPSDEHVEDVVIAELQRGYHLNGRVLRHALVKVSMGPGPS 209


>gi|270159357|ref|ZP_06188013.1| co-chaperone GrpE [Legionella longbeachae D-4968]
 gi|289165827|ref|YP_003455965.1| Heat-shock protein GrpE(HSP-70 cofactor) [Legionella longbeachae
           NSW150]
 gi|269987696|gb|EEZ93951.1| co-chaperone GrpE [Legionella longbeachae D-4968]
 gi|288859000|emb|CBJ12926.1| Heat-shock protein GrpE(HSP-70 cofactor) [Legionella longbeachae
           NSW150]
          Length = 202

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 54/199 (27%), Positives = 95/199 (47%), Gaps = 22/199 (11%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEE------------SLNQSEEFRDKYLR 49
           E  ++E+   ++        +    + +    E             +  Q+ E  +K +R
Sbjct: 14  EKHLNEEPQSQDSEKEGLEVALDSLEPQEASLEHPSYVELSEKLTLTEQQAHESWEKAVR 73

Query: 50  VIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVL 109
             AE++N RRR +RE  +A  Y + K    +L V D+L +AL  A               
Sbjct: 74  AQAELDNFRRRAEREIANAHRYGVEKLISSLLPVIDSLEQALQLAIKAEDA--------- 124

Query: 110 KSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQD 169
            S+ EG+E+T +  +  L+++ V++ID     F+P +H+AM  +    V  NT++ V Q 
Sbjct: 125 -SMREGLELTLKLFVDALQKFEVQQIDPIGTPFDPQLHEAMSMQNAPDVEPNTVLAVFQK 183

Query: 170 GYAINERVLRPALVSISKG 188
           GY +++RV+RPA V +SK 
Sbjct: 184 GYKLSDRVIRPARVVVSKK 202


>gi|322834140|ref|YP_004214167.1| GrpE protein [Rahnella sp. Y9602]
 gi|321169341|gb|ADW75040.1| GrpE protein [Rahnella sp. Y9602]
          Length = 195

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 63/193 (32%), Positives = 102/193 (52%), Gaps = 12/193 (6%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR----DKYLRVIAEMENL 57
           E    E N ++E +      +            E   Q +E +    D  LR  AE+EN+
Sbjct: 11  EQVSEELNQEQELHTEAETQAADVVDPRDERIAELEAQLKELQQRERDSLLRAKAEVENI 70

Query: 58  RRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIE 117
           RRRT+++ + A  +++ KF+ ++L V DNL RALD A            S L  LIEG+E
Sbjct: 71  RRRTEQDIEKAHKFALEKFSGELLPVIDNLERALDLADKS--------NSELAGLIEGVE 122

Query: 118 MTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERV 177
           +T + ++  + ++G++ +      FNP +HQAM     D +  N ++ V+Q GY +N R+
Sbjct: 123 LTLKSLLDAVRKFGMEVVADIHVPFNPELHQAMTMMESDELEPNHVMMVMQKGYTLNGRL 182

Query: 178 LRPALVSISKGKT 190
           LRPA+V++SK K 
Sbjct: 183 LRPAMVAVSKAKA 195


>gi|320539200|ref|ZP_08038871.1| putative heat shock protein [Serratia symbiotica str. Tucson]
 gi|320030838|gb|EFW12846.1| putative heat shock protein [Serratia symbiotica str. Tucson]
          Length = 197

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 62/188 (32%), Positives = 100/188 (53%), Gaps = 12/188 (6%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR----DKYLRVIAEMENLRRRTD 62
           E+    E     A        + I   E  L ++++      D  LR  AEMEN+RRRT+
Sbjct: 18  EQQARYEDVLPEAVEDVDLRDARITELEAQLLEAQQHERDGRDSLLRAKAEMENVRRRTE 77

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
            + + A  +++ +F+ D+L V DNL RAL+ A          +   L ++IEGIE+T + 
Sbjct: 78  LDIEKAHKFALERFSGDLLPVLDNLERALELADK--------NNPELTAMIEGIELTLKS 129

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           +   + +YG++ +   D  FNP++HQAM          N ++ V+Q GY +N R+LRPA+
Sbjct: 130 LQDVVHKYGIEIVSDVDVPFNPDVHQAMSLIESADHQPNHVMMVMQKGYTLNGRLLRPAM 189

Query: 183 VSISKGKT 190
           V++SK K 
Sbjct: 190 VAVSKAKA 197


>gi|114326687|ref|YP_743844.1| grpE protein [Granulibacter bethesdensis CGDNIH1]
 gi|114314861|gb|ABI60921.1| grpE protein [Granulibacter bethesdensis CGDNIH1]
          Length = 226

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 57/187 (30%), Positives = 96/187 (51%), Gaps = 4/187 (2%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           +    E   D+E+  S      A   +          + ++FR++++R  AEM N+R R 
Sbjct: 44  DETQQELPKDQEETHSGEQPQNAATDTPEARIAALEAERDDFRERWMRAEAEMANVRARA 103

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
            R+  DA++Y++ KFA D++  ++NL R L + P           + L  + EG+E   R
Sbjct: 104 KRDADDARNYAVQKFAADIVEAAENLRRGLSALPAAEEGEP----ASLTRVREGLEGVER 159

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
             +S LER G+   D     F+PN+HQAM E+P    P  T+I+     + +N R+L+PA
Sbjct: 160 NFISILERNGISGTDPTGAVFDPNLHQAMSEQPSAEHPPGTVIQAWTSAWTLNGRLLKPA 219

Query: 182 LVSISKG 188
           +V ++K 
Sbjct: 220 MVVVAKA 226


>gi|153207464|ref|ZP_01946164.1| co-chaperone GrpE [Coxiella burnetii 'MSU Goat Q177']
 gi|165918963|ref|ZP_02219049.1| co-chaperone GrpE [Coxiella burnetii RSA 334]
 gi|120576595|gb|EAX33219.1| co-chaperone GrpE [Coxiella burnetii 'MSU Goat Q177']
 gi|165917360|gb|EDR35964.1| co-chaperone GrpE [Coxiella burnetii RSA 334]
          Length = 204

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 52/177 (29%), Positives = 91/177 (51%), Gaps = 9/177 (5%)

Query: 11  DKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQS 70
            +E  P          +           + +E++ +YLR  AEM+NLR+R +REK D   
Sbjct: 35  SQEMEPHREGLEFPSREKLEGQLTRMERKVDEYKTQYLRAQAEMDNLRKRIEREKADIIK 94

Query: 71  YSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERY 130
           +   +   D+L V+D+L   L+S   +        +  +KS+ +G+ +T   + +TL ++
Sbjct: 95  FGSKQLITDLLPVADSLIHGLESPASE--------DPQVKSMRDGMSLTLDLLHNTLAKH 146

Query: 131 GVKKIDA-KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           GV+ I+      F+P +H+AM  +       +TII+V+Q GY +N RVLR A V ++
Sbjct: 147 GVQVINPNPGDPFDPALHEAMSVQAVPDAKPDTIIQVLQKGYQLNGRVLRAARVIVA 203


>gi|253687130|ref|YP_003016320.1| GrpE protein [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|259647654|sp|C6D9J8|GRPE_PECCP RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|251753708|gb|ACT11784.1| GrpE protein [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 195

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 61/191 (31%), Positives = 99/191 (51%), Gaps = 12/191 (6%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR----DKYLRVIAEMENL 57
           E  + +K   K +    A  +            E   Q  E +    D  LRV AE +N+
Sbjct: 11  EQVLDQKEAAKGQQADAAPETADVADPRDARIAELEAQLSELQQRERDNMLRVRAEADNV 70

Query: 58  RRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIE 117
           RRR + + + A  +++ KFA +ML V DNL RALD+A              L ++IEG+E
Sbjct: 71  RRRAEMDVEKAHKFAVEKFASEMLPVIDNLERALDTADKA--------NESLAAMIEGVE 122

Query: 118 MTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERV 177
           +T + ++  + ++G++ +   +  FNP +HQAM   P      N ++ V+Q GY +N R+
Sbjct: 123 LTLKSLLDAVRKFGIEVVGDVNVPFNPEVHQAMTMLPSADHQPNHVMMVMQKGYTLNGRL 182

Query: 178 LRPALVSISKG 188
           LRPA+V++SK 
Sbjct: 183 LRPAMVAVSKA 193


>gi|302608228|emb|CBW44463.1| heat shock protein [Marinobacter hydrocarbonoclasticus]
          Length = 202

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 51/179 (28%), Positives = 103/179 (57%), Gaps = 5/179 (2%)

Query: 20  NSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARD 79
           N    +   + +  +    + +E++++ LR  AEM+N+RRR + + + A  +++ KF ++
Sbjct: 29  NQDAEQSPEQGSELDVLQQKLQEYQEQALRAQAEMQNVRRRAEIDVEKAHKFALEKFVKE 88

Query: 80  MLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKD 139
           +L V+D+L +A++S              ++ S+ EG+EMT    M++L+++ V++++   
Sbjct: 89  LLPVADSLEKAVESTEGHENAG-----ELVASIREGVEMTLTLFMNSLKKFNVEQLNPVG 143

Query: 140 QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKK 198
           + F+P  H+AM   P      NT++ VVQ GY +N RV+RPA+V ++K +     +E+ 
Sbjct: 144 EPFDPQQHEAMSMVPAPDAEPNTVVAVVQKGYLLNGRVVRPAMVVVAKAEDAPKIDEQA 202


>gi|290962748|ref|YP_003493930.1| GrpE heat shock protein [Streptomyces scabiei 87.22]
 gi|260652274|emb|CBG75407.1| putative GrpE heat shock protein [Streptomyces scabiei 87.22]
          Length = 194

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 49/182 (26%), Positives = 84/182 (46%), Gaps = 18/182 (9%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
            E + D+E  P  A      E       +E   + +E  D++ R +A+++NLR+R  RE 
Sbjct: 29  PESDADEEPGPDAAGGPAPSE-------DEHRVELKELEDRWRRALADLDNLRKRHTREL 81

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
              ++   ++ A   L V DNL  AL  A  D             +++EG+   R + ++
Sbjct: 82  ARERTSERSRTAAAFLPVLDNLELALTHAGSDPG-----------AIVEGVRAVRDQGVN 130

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
            LE  G  +       F+P  H+ +        P  T+++V++ GY   ER LRPA V++
Sbjct: 131 VLELLGYPRHAETGVAFDPARHEVVGVVQDPDAPPGTVVEVLRPGYGDGERQLRPAAVTV 190

Query: 186 SK 187
           +K
Sbjct: 191 AK 192


>gi|124485765|ref|YP_001030381.1| hypothetical protein Mlab_0944 [Methanocorpusculum labreanum Z]
 gi|124363306|gb|ABN07114.1| GrpE protein [Methanocorpusculum labreanum Z]
          Length = 201

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 52/183 (28%), Positives = 89/183 (48%), Gaps = 15/183 (8%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +  + + + +   +       E  + +E   + +E  DK+LR+ AE EN ++R  R+++ 
Sbjct: 34  EVKNVDASKAETQNPDENPVPETTVVDELTKKYDELNDKHLRLAAEFENYKKRAKRDQES 93

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A  Y+  KFA D++ V DN  RAL S                ++L +G+E   +  +S L
Sbjct: 94  AVRYANEKFALDIIDVLDNFERALKS--------------DDENLRDGLEQIHKLYLSIL 139

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            R G++ +      F+P  H+A+   P    P   II V   GY I ++VLR A V+++K
Sbjct: 140 SRNGIEPMKITGTTFDPAFHEAVACIP-ADAPEGAIIDVAVPGYMIRDKVLRHAKVAVAK 198

Query: 188 GKT 190
            K 
Sbjct: 199 KKE 201


>gi|220910049|ref|YP_002485360.1| GrpE protein [Cyanothece sp. PCC 7425]
 gi|219866660|gb|ACL46999.1| GrpE protein [Cyanothece sp. PCC 7425]
          Length = 246

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 45/190 (23%), Positives = 88/190 (46%), Gaps = 8/190 (4%)

Query: 12  KEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
            E+ P     + A         E    Q +E  ++Y R++A+ +N R+RT++EK+D  + 
Sbjct: 65  TEEVPGEGAEAEAILAQLAEKVESLQMQLDERTNQYKRLVADFDNFRKRTEKEKEDLDNQ 124

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
              K   ++L V D+   A                    S+ +  +   ++++  L+R G
Sbjct: 125 VKRKTLSELLPVVDSFDLARTQIK--------PQTEAETSIHKSYQGVYKQLVDCLKRIG 176

Query: 132 VKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQ 191
           V  +  + + F+P MH+A+  EP D  P  T+++ ++ GY + +RVLR A+V ++     
Sbjct: 177 VAPMRPEGKPFDPTMHEAVLREPTDEYPEGTVLEELKRGYLLGDRVLRYAMVKVAAAPEG 236

Query: 192 NPTEEKKETI 201
              E + +  
Sbjct: 237 TDKENESQAE 246


>gi|297568046|ref|YP_003689390.1| GrpE protein [Desulfurivibrio alkaliphilus AHT2]
 gi|296923961|gb|ADH84771.1| GrpE protein [Desulfurivibrio alkaliphilus AHT2]
          Length = 206

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 55/182 (30%), Positives = 96/182 (52%), Gaps = 9/182 (4%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
              + +  S       E    +    E+ +++ +  D+ LR+ AE EN ++R  RE++ A
Sbjct: 31  ESAEGELQSAEQEQGEETDDLLVQLSEARSEAHDLEDRMLRLAAEFENYKKRMQRERESA 90

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
             Y+     +++L   DNL RA++              +   +L+EG+EMT R +++ LE
Sbjct: 91  FKYAEEDLLKELLPALDNLERAIEQG---------HKTNDASALLEGVEMTYRGLLAGLE 141

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           ++G+K ++++ Q F+PN H+AM  E  D  PANT+I   Q GY   +R++R A V +S G
Sbjct: 142 KFGLKPLESRGQAFDPNYHEAMAMEASDEFPANTVISEFQRGYLYKDRLIRAAKVVVSNG 201

Query: 189 KT 190
             
Sbjct: 202 PG 203


>gi|85374031|ref|YP_458093.1| molecular chaperone GrpE [Erythrobacter litoralis HTCC2594]
 gi|123005038|sp|Q2NAJ5|GRPE_ERYLH RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|84787114|gb|ABC63296.1| molecular chaperone GrpE [Erythrobacter litoralis HTCC2594]
          Length = 197

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 63/187 (33%), Positives = 99/187 (52%), Gaps = 5/187 (2%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
               E     E    +  S            E   +  E  + + L   AE +N+RRR +
Sbjct: 15  EVEKEMEGVPEHLRDDRGSEEDASDDLSAALESLKSDLEAAKQETLYAKAETQNVRRRME 74

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           ++ +DA++Y+   FARD+LS++DNL+RA+D+ P +L           K L+ GIE T+RE
Sbjct: 75  KDIQDARTYAATGFARDILSIADNLARAIDAIPQELRED-----EKFKGLVAGIEATQRE 129

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           +     ++GV +I A     +PN HQAM E P D V   TI++ +Q GY I +R+LRP++
Sbjct: 130 LDKVFAQHGVSRIAAMGLPLDPNQHQAMMEVPTDEVEPGTIVQEMQAGYMIRDRLLRPSM 189

Query: 183 VSISKGK 189
           V ++K  
Sbjct: 190 VGVAKKP 196


>gi|171915642|ref|ZP_02931112.1| GrpE protein [Verrucomicrobium spinosum DSM 4136]
          Length = 190

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 52/191 (27%), Positives = 99/191 (51%), Gaps = 11/191 (5%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKS--EINIPEESLNQSEEFRDKYLRVIAEMENLRR 59
           E   ++++   E     A +++  + +    +   E   +  +++D  LR  AE++N R+
Sbjct: 7   EPIAAQESAAPEIETQAAEAASESQTAPAAADPISELQAEVAKWKDSALRTAAELDNYRK 66

Query: 60  RTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMT 119
           R  RE +++++Y+ A   RD+  + DN    LD+A  +   S          +  G+ M 
Sbjct: 67  RVARETQESRAYANADLLRDLFPILDNFEMGLDAAKAESEKSM---------IYIGLSMV 117

Query: 120 RREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
           RR++   L   GV+++  +  KF+PN+H+A+  E     P  TI+KV++ G+ + +R+LR
Sbjct: 118 RRQLADFLRDAGVEEVPGQGAKFDPNVHEAVSHEASADQPEGTILKVMRRGFKLKDRLLR 177

Query: 180 PALVSISKGKT 190
            A VS+S G  
Sbjct: 178 AATVSVSSGPP 188


>gi|284049925|ref|ZP_06380135.1| GrpE protein [Arthrospira platensis str. Paraca]
 gi|291567077|dbj|BAI89349.1| heat shock protein GrpE [Arthrospira platensis NIES-39]
          Length = 245

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 45/208 (21%), Positives = 87/208 (41%), Gaps = 13/208 (6%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
              ++  +  +           + ++     E    Q  +   +Y R+ A+ EN R+RT 
Sbjct: 51  EEATDAELSSDPIYIANEQLNEQLQTIAQARESLQTQLMDMTGQYQRLAADFENFRKRTQ 110

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           +EK+D +          +L V DN  RA                    ++ +  +   ++
Sbjct: 111 KEKEDLELNIKCSTIGQLLPVIDNFERARAHIK--------PQNDGEMNIHKSYQGVYKQ 162

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           M+  L++ GV  +  + + F+PN+H+A+  EP    P  T+I+ +  GY + +RVLR A+
Sbjct: 163 MVECLKQIGVSPMRPEGEPFDPNLHEAVMREPTSEYPEGTVIEELMRGYILGDRVLRHAM 222

Query: 183 VSISKGKTQNPTEEKKETIEQPSPLDIE 210
           V ++        E    T E P+    +
Sbjct: 223 VKVA-----TEPELSDTTEEPPAEGSED 245


>gi|189041738|sp|A9KG91|GRPE_COXBN RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
          Length = 204

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 52/177 (29%), Positives = 92/177 (51%), Gaps = 9/177 (5%)

Query: 11  DKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQS 70
            +E  P          +          ++ +E++ +YLR  AEM+NLR+R +REK D   
Sbjct: 35  SQEMEPHREGLEFPSREKLEGQLTRMEHKVDEYKTQYLRAQAEMDNLRKRIEREKADIIK 94

Query: 71  YSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERY 130
           +   +   D+L V+D+L   L+S   +        +  +KS+ +G+ +T   + +TL ++
Sbjct: 95  FGSKQLITDLLPVADSLIHGLESPASE--------DPQVKSMRDGMSLTLDLLHNTLAKH 146

Query: 131 GVKKIDA-KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           GV+ I+      F+P +H+AM  +       +TII+V+Q GY +N RVLR A V ++
Sbjct: 147 GVQVINPNPGDPFDPALHEAMSVQAVPDAKPDTIIQVLQKGYQLNGRVLRAARVIVA 203


>gi|260773329|ref|ZP_05882245.1| heat shock protein GrpE [Vibrio metschnikovii CIP 69.14]
 gi|260612468|gb|EEX37671.1| heat shock protein GrpE [Vibrio metschnikovii CIP 69.14]
          Length = 199

 Score =  116 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 54/182 (29%), Positives = 102/182 (56%), Gaps = 8/182 (4%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
           ++ +ID      +      +          S  +++E  +  LR +A++EN+RRR+++E 
Sbjct: 26  TDADIDWNHEVDSEEGQETKIAQLEAALLASEARAKENHEAMLRALADVENMRRRSEQEV 85

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
             A+ Y++ +F  ++L V DN+ RA+D+A  +          V+K  +EG+E+T +  + 
Sbjct: 86  DKARKYALGRFVEELLPVLDNIERAIDAADCE--------NEVIKPFLEGVELTHKSFVD 137

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
            + ++GV  I+ + + FNP  HQAM  +      +NT++ V+Q GY +N RV+RPA+V +
Sbjct: 138 AVTKFGVSVINPEGETFNPEFHQAMSIQESADHASNTVMFVMQKGYELNGRVVRPAMVMV 197

Query: 186 SK 187
           +K
Sbjct: 198 AK 199


>gi|298252188|ref|ZP_06975991.1| GrpE protein [Ktedonobacter racemifer DSM 44963]
 gi|297546780|gb|EFH80648.1| GrpE protein [Ktedonobacter racemifer DSM 44963]
          Length = 218

 Score =  116 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 54/193 (27%), Positives = 95/193 (49%), Gaps = 9/193 (4%)

Query: 19  ANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFAR 78
             ++  +   +    +E   ++EE+ D+  R  AE  N RRR  +E+ + +  + +    
Sbjct: 35  EATTAIQSVPQSEAVQEEQRKAEEYLDQLRRTQAEFVNYRRRMGKEQLEGRITAQSSLLY 94

Query: 79  DMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
            +L V D+L  AL SAP ++            S ++G+ +  R + S L++ GV+++ A 
Sbjct: 95  HLLPVLDDLELALRSAPAEMCP---------HSWVQGLFLVARRLESMLDQLGVQRVGAI 145

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKK 198
            ++FNP  H+A+  E     P  TI+ V+Q GY I + V+RPA VSI+    Q  T   +
Sbjct: 146 GEQFNPRWHEAITTEACADAPEGTILDVLQQGYIIEDHVIRPARVSIAGASPQRETPTAQ 205

Query: 199 ETIEQPSPLDIEE 211
           E  +  +     E
Sbjct: 206 EKTDPNNRQKQAE 218


>gi|255932039|ref|XP_002557576.1| Pc12g07410 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211582195|emb|CAP80368.1| Pc12g07410 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 244

 Score =  116 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 55/192 (28%), Positives = 102/192 (53%), Gaps = 7/192 (3%)

Query: 4   FMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDR 63
           + ++     E   +    +   E       E+   ++ EF+DK+LR +AE  NL  R  R
Sbjct: 52  YSTDTKEAAEAEKTENGENAEAEDPVKKELEQKTKEAIEFKDKWLRSVAESRNLVERNKR 111

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL-ANSEKKSESVLKSLIEGIEMTRRE 122
           +   A+ ++I  FA+D+L   DN  RAL + P +  A ++ +    L+ L++G+ MT++ 
Sbjct: 112 DMDAARKFAIQGFAKDLLDSIDNFDRALLAVPAEKLAAAKTEENKDLQDLVDGLHMTQKI 171

Query: 123 MMSTLERYGVKKIDAKD------QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINER 176
           +++TL+++G+++ D  +      QKF+ N+H+A F  P   +    ++ V   G+ +N R
Sbjct: 172 LLNTLQKHGLERFDPSEKVDGKAQKFDANLHEATFMAPAAGLEDGDVMHVQSKGFRLNGR 231

Query: 177 VLRPALVSISKG 188
           VLR A V + K 
Sbjct: 232 VLRAAKVGVVKN 243


>gi|239906374|ref|YP_002953115.1| protein GrpE [Desulfovibrio magneticus RS-1]
 gi|239796240|dbj|BAH75229.1| protein GrpE [Desulfovibrio magneticus RS-1]
          Length = 176

 Score =  116 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 48/184 (26%), Positives = 85/184 (46%), Gaps = 9/184 (4%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           M  +    +   +    +     +  +  E    +     DK LR +AE ENL++R  +E
Sbjct: 1   MVPEEKLPDAETAPETPAEETPATPEDTIERLRAEIAAEADKRLRALAETENLKKRLIKE 60

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
           K+D Q Y+      +++ V D+L  AL            +     K  + G++MTR+  +
Sbjct: 61  KEDFQKYATESLVSELIPVLDHLDLALAHG---------RGNEACKDFVVGVDMTRKAFI 111

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
             L R+GV +  A  + F+P  H+A+       +  + + +VVQ GY +  R+LRPA V 
Sbjct: 112 DILARHGVTEFGAVGEAFDPETHEAIGVASVAGLAEDAVAQVVQRGYLLRGRLLRPAKVM 171

Query: 185 ISKG 188
           ++K 
Sbjct: 172 VNKA 175


>gi|303322541|ref|XP_003071262.1| co-chaperone GrpE family protein [Coccidioides posadasii C735 delta
           SOWgp]
 gi|240110964|gb|EER29117.1| co-chaperone GrpE family protein [Coccidioides posadasii C735 delta
           SOWgp]
 gi|320033024|gb|EFW14974.1| mitochondrial co-chaperone GrpE [Coccidioides posadasii str.
           Silveira]
          Length = 252

 Score =  116 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 54/186 (29%), Positives = 97/186 (52%), Gaps = 8/186 (4%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           +    +   + +  +  E +     E+   +  + +DKYLR +A+  NL+ RT R+   A
Sbjct: 68  DGKNGEQKPSGSQLSEAEATLRKEVEKQEREIIDLKDKYLRSVADFRNLQERTKRDVDAA 127

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
           +S++I +F  D++   DN  RAL++ P +  N        L  L +G++MT + +M+TL+
Sbjct: 128 RSFAIQRFGADLIESIDNFERALEAVPSEKLN--NGENKDLADLYDGLKMTEKVIMNTLK 185

Query: 129 RYGVKKIDAKD------QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           ++G+++ D  +      QKF+P +H+A F  P        I+ V   G+ +N RVLR A 
Sbjct: 186 KHGLERFDPSELVEGKPQKFDPKLHEATFMAPAPGKEDGDILHVQTKGFILNGRVLRAAK 245

Query: 183 VSISKG 188
           V + K 
Sbjct: 246 VGVVKN 251


>gi|219670306|ref|YP_002460741.1| GrpE protein [Desulfitobacterium hafniense DCB-2]
 gi|219540566|gb|ACL22305.1| GrpE protein [Desulfitobacterium hafniense DCB-2]
          Length = 213

 Score =  116 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 51/187 (27%), Positives = 102/187 (54%), Gaps = 9/187 (4%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           +   + E+ +  E +P    S   +  +     +++ NQ+EE+     R+ AE +N R+R
Sbjct: 36  LSEAVQEEEVGNESSPEQDVSLEEKILTLQAELDQTKNQAEEYYTHLQRLQAEFDNYRKR 95

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T +EK+D   Y+  +    +L V DN  RA++++              +KS  +G+EM  
Sbjct: 96  TQKEKEDFAKYASERVVEGLLPVLDNFERAVEASKT---------TQDMKSFSQGVEMIF 146

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           +++   L + G+  I+A  Q F+PN+H+A+ +   +  P +T+++ +Q GY + E+V+RP
Sbjct: 147 KQLQGILAKEGLAAIEAVGQPFDPNLHEAVLQVDSEDYPESTVVEELQKGYYLKEKVIRP 206

Query: 181 ALVSISK 187
           ++V +S+
Sbjct: 207 SMVKVSR 213


>gi|292670283|ref|ZP_06603709.1| heat shock protein GrpE [Selenomonas noxia ATCC 43541]
 gi|292648014|gb|EFF65986.1| heat shock protein GrpE [Selenomonas noxia ATCC 43541]
          Length = 192

 Score =  116 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 50/177 (28%), Positives = 88/177 (49%), Gaps = 11/177 (6%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
            +  +   +  + TAE     +       + +E  D+ LR+ A+ EN RRRT +EK++  
Sbjct: 25  ENAAETTPSPETETAEAAPVEDKAAALEAELKEKSDRILRLQADFENFRRRTAKEKEELA 84

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
           +        D+L + DN  RA+     D            ++  +G+EM   ++   L++
Sbjct: 85  AVITQNILGDLLPLLDNFERAMAVEQTDG-----------EAFQKGVEMIFTQLREVLDK 133

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           +G++ I+A+ Q F+PN HQA+        P  TI +V+Q GY    RV+RPA+V ++
Sbjct: 134 HGLQSIEAEGQTFDPNFHQAVMRVEDSDAPDGTITQVLQKGYQAKGRVIRPAMVQVA 190


>gi|308234157|ref|ZP_07664894.1| GrpE protein [Atopobium vaginae DSM 15829]
 gi|328944413|ref|ZP_08241875.1| co-chaperone GrpE [Atopobium vaginae DSM 15829]
 gi|327490997|gb|EGF22774.1| co-chaperone GrpE [Atopobium vaginae DSM 15829]
          Length = 279

 Score =  116 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 47/203 (23%), Positives = 96/203 (47%), Gaps = 5/203 (2%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
            +   D +K     +  + + +   +  +    ++     K++R+ A+  N RRRT +E+
Sbjct: 80  EDIKADFDKLKKEHDELSGQLEDLQDTLDAKSKEAAAANQKFMRLQADWNNYRRRTAQER 139

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
            D Q+ +  K    +L V D++ RA + A      S    +      ++GI     +M++
Sbjct: 140 LDEQARAAEKLVLSLLPVIDDMERAANHA-----ASLDNKDDNFTQFLDGISQVHDKMLA 194

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
            L + GV+ ID   + F+P +HQA+  + +  V A+T+  V Q GY +  +V+R A+V++
Sbjct: 195 ILAKEGVEVIDPAGKAFDPLIHQAVGRQENKDVYADTVADVYQKGYRMGGKVIRNAMVTV 254

Query: 186 SKGKTQNPTEEKKETIEQPSPLD 208
           + G    P + + +        +
Sbjct: 255 TFGGPARPADTQDDATSSDGASE 277


>gi|219125360|ref|XP_002182951.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217405745|gb|EEC45687.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 157

 Score =  116 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 59/156 (37%), Positives = 94/156 (60%)

Query: 33  PEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALD 92
            E+   Q ++ +D+ LR +AE EN R    R+ ++ + Y+I  FA+ +L VSDNL+RA++
Sbjct: 1   EEQLEAQVQQLKDQLLRSLAEQENTRSIAKRDVENGKLYAIKSFAKSLLDVSDNLTRAME 60

Query: 93  SAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFE 152
           + P D    +++S  VL +L EGI MT R ++   E  G+ K     + F+PN H+A++E
Sbjct: 61  AVPEDARVDQQESNHVLHNLYEGIAMTERGLLKAFESNGLVKFGQAGEAFDPNRHEALYE 120

Query: 153 EPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
                    T+ +VV+DG+ +N+RVLRPA V I K 
Sbjct: 121 YVDPDKEPGTVGQVVKDGFLLNKRVLRPAEVGIVKK 156


>gi|260366307|ref|ZP_05778763.1| co-chaperone GrpE [Vibrio parahaemolyticus K5030]
 gi|308112720|gb|EFO50260.1| co-chaperone GrpE [Vibrio parahaemolyticus K5030]
          Length = 175

 Score =  116 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 57/168 (33%), Positives = 100/168 (59%), Gaps = 8/168 (4%)

Query: 20  NSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARD 79
           +   A+          S  + ++ +D  LR  AE+EN+RRRT++E   A+ Y++ KFA +
Sbjct: 16  DEKDAKIAQLEAALLSSETKVKDQQDAVLRAKAEVENMRRRTEQEIDKARKYALNKFAEE 75

Query: 80  MLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKD 139
           +L V DNL RA+ +A  +          V+K ++EG+E+T +  +  + ++G+K+I+ + 
Sbjct: 76  LLPVIDNLERAIQAADTE--------NEVIKPILEGVELTHKTFVDVVAKFGLKEINPEG 127

Query: 140 QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           + FNP  HQAM  +      +NT++ V+Q GY +N RV+RPA+V ++K
Sbjct: 128 ETFNPEFHQAMSIQESPDHESNTVMFVMQKGYELNGRVIRPAMVMVAK 175


>gi|159468500|ref|XP_001692412.1| GrpE nucleotide release factor [Chlamydomonas reinhardtii]
 gi|15384277|gb|AAK96223.1|AF406935_1 co-chaperone CGE1 precursor isoform a [Chlamydomonas reinhardtii]
 gi|158278125|gb|EDP03890.1| GrpE nucleotide release factor [Chlamydomonas reinhardtii]
          Length = 258

 Score =  116 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 36/185 (19%), Positives = 77/185 (41%), Gaps = 8/185 (4%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
           +  +      +      +  +         +D+YLR+ A+ +N RRRT  E         
Sbjct: 82  ELEAEMGRLQSAANEANDRAKSLEASLASAKDQYLRLNADFDNFRRRTREESAALTDSVR 141

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
               ++ML + DN   A      +            + +    +   ++M+  +   GV+
Sbjct: 142 GDVIKEMLPIVDNFELARTQVKAETEAE--------QKINNSYQGLYKQMVDLMRTQGVE 193

Query: 134 KIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNP 193
            +      F+PN+H A+  EP ++ P  T+++  + G+AI  +++RPA+V +S  +    
Sbjct: 194 AVPTTGTPFDPNIHDAIMREPSNSHPDGTVLQEFRKGFAIGGKLIRPAMVKVSYTEDGPA 253

Query: 194 TEEKK 198
              ++
Sbjct: 254 ASSEE 258


>gi|159468502|ref|XP_001692413.1| GrpE nucleotide release factor [Chlamydomonas reinhardtii]
 gi|15384279|gb|AAK96224.1|AF406936_1 co-chaperone CGE1 precursor isoform b [Chlamydomonas reinhardtii]
 gi|158278126|gb|EDP03891.1| GrpE nucleotide release factor [Chlamydomonas reinhardtii]
          Length = 260

 Score =  116 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 36/185 (19%), Positives = 77/185 (41%), Gaps = 8/185 (4%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
           +  +      +      +  +         +D+YLR+ A+ +N RRRT  E         
Sbjct: 84  ELEAEMGRLQSAANEANDRAKSLEASLASAKDQYLRLNADFDNFRRRTREESAALTDSVR 143

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
               ++ML + DN   A      +            + +    +   ++M+  +   GV+
Sbjct: 144 GDVIKEMLPIVDNFELARTQVKAETEAE--------QKINNSYQGLYKQMVDLMRTQGVE 195

Query: 134 KIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNP 193
            +      F+PN+H A+  EP ++ P  T+++  + G+AI  +++RPA+V +S  +    
Sbjct: 196 AVPTTGTPFDPNIHDAIMREPSNSHPDGTVLQEFRKGFAIGGKLIRPAMVKVSYTEDGPA 255

Query: 194 TEEKK 198
              ++
Sbjct: 256 ASSEE 260


>gi|319775015|ref|YP_004137503.1| GrpE nucleotide exchange factor [Haemophilus influenzae F3047]
 gi|319896485|ref|YP_004134678.1| grpe nucleotide exchange factor [Haemophilus influenzae F3031]
 gi|317431987|emb|CBY80335.1| GrpE nucleotide exchange factor [Haemophilus influenzae F3031]
 gi|317449606|emb|CBY85811.1| GrpE nucleotide exchange factor [Haemophilus influenzae F3047]
          Length = 234

 Score =  116 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 68/207 (32%), Positives = 112/207 (54%), Gaps = 29/207 (14%)

Query: 2   ETFMSEKNIDKEK-----------------NPSNANSSTAEEKSEINIPEESLN-QSEEF 43
           E  MSE+    +                  +PS       E  + +   EE L  Q EE 
Sbjct: 34  EKKMSEQEQKVKNPEVENQEEVVVEEAQQADPSQEFDPLEEAIARVQELEEQLKTQIEEA 93

Query: 44  RDK----YLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLA 99
            +K     LR  AE+ENLRRRT+++ + A  +++ KF++D+L+  DNL RAL +      
Sbjct: 94  ANKEQDILLRSRAEIENLRRRTEQDVEKAHKFALEKFSKDILNTIDNLERALAT------ 147

Query: 100 NSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVP 159
               K +  +K+L +G+E+T +E++ST+ R+GV+ +    + FNP++HQA+  +P +   
Sbjct: 148 -PANKEDESVKALFDGVELTLKELVSTVGRFGVEAVGVVGEAFNPDLHQAISMQPAEGFE 206

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
            N I  V+Q GY +N RV+RPA+V ++
Sbjct: 207 TNQISVVLQKGYTLNGRVIRPAMVMVA 233


>gi|227534941|ref|ZP_03964990.1| molecular chaperone GrpE (heat shock protein) [Lactobacillus
           paracasei subsp. paracasei ATCC 25302]
 gi|227187398|gb|EEI67465.1| molecular chaperone GrpE (heat shock protein) [Lactobacillus
           paracasei subsp. paracasei ATCC 25302]
          Length = 222

 Score =  116 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 55/182 (30%), Positives = 94/182 (51%), Gaps = 10/182 (5%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           E ++ ++    +      +  +  +  E+   + ++F DKYLR  AE++N+  R ++E++
Sbjct: 50  ETSLKEDILQESIADLNEQLSNSKHDGEQLKQERDDFEDKYLRAAAEIQNMNARFEKEQQ 109

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
               Y   K A+ +L V DNL RAL +   D             SL +G++M    +   
Sbjct: 110 KLLKYDGQKLAKAILPVVDNLERALATEAKD---------DSAVSLKKGVQMVYDHLERA 160

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDT-VPANTIIKVVQDGYAINERVLRPALVSI 185
           L+  G+  ID    KF+PN  QA+     D   PA+T+ +V+Q GY + +RVLRPA+V +
Sbjct: 161 LKENGITAIDGAGDKFDPNTQQAVQTVAADDQHPADTVAQVLQKGYYLKDRVLRPAMVVV 220

Query: 186 SK 187
           +K
Sbjct: 221 AK 222


>gi|224000333|ref|XP_002289839.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220975047|gb|EED93376.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 178

 Score =  116 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 63/178 (35%), Positives = 101/178 (56%), Gaps = 1/178 (0%)

Query: 11  DKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQS 70
               +   A++S++      N   +   Q ++ +D  LR +AE EN RR   R+   A+S
Sbjct: 1   TASTDEEAASASSSAADDTTNKLADLEKQVKDLKDNLLRSLAEQENTRRIAKRDVDQARS 60

Query: 71  YSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERY 130
           ++I+ FA+ +L  SDNLSRALD+ P +L +   ++  VL +L EGI MT   +     + 
Sbjct: 61  FAISSFAKSLLDTSDNLSRALDAVPEELRHD-HENHPVLANLYEGISMTDEGLTKAFAKN 119

Query: 131 GVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           G+KK     +KF+PN H+A+FE P     A  I +V++ G+ +N+RV+RPA V + K 
Sbjct: 120 GLKKFGVPGEKFDPNKHEALFEYPDPNGEAGNIGQVMKVGFMLNDRVVRPAEVGVVKA 177


>gi|119190135|ref|XP_001245674.1| hypothetical protein CIMG_05115 [Coccidioides immitis RS]
          Length = 252

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 54/186 (29%), Positives = 97/186 (52%), Gaps = 8/186 (4%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           +    +   + +  +  E +     E+   +  + +DKYLR +A+  NL+ RT R+   A
Sbjct: 68  DGKNGEQKPSESQLSEAEATLRKEVEKQEREIIDLKDKYLRSVADFRNLQERTKRDVDAA 127

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
           +S++I +F  D++   DN  RAL++ P +  N        L  L +G++MT + +M+TL+
Sbjct: 128 RSFAIQRFGADLIESIDNFERALEAVPSEKLN--NGENKDLADLYDGLKMTEKVIMNTLK 185

Query: 129 RYGVKKIDAKD------QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           ++G+++ D  +      QKF+P +H+A F  P        I+ V   G+ +N RVLR A 
Sbjct: 186 KHGLERFDPSELVEGKPQKFDPKLHEATFMAPAPGKEDGDILHVQTKGFILNGRVLRAAK 245

Query: 183 VSISKG 188
           V + K 
Sbjct: 246 VGVVKN 251


>gi|149176810|ref|ZP_01855421.1| GrpE protein [Planctomyces maris DSM 8797]
 gi|148844451|gb|EDL58803.1| GrpE protein [Planctomyces maris DSM 8797]
          Length = 182

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 55/186 (29%), Positives = 104/186 (55%), Gaps = 9/186 (4%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
            E     E+ P   +  T E  +     + ++++ +E +D++LR  AE++N+R+R  +E 
Sbjct: 5   EEIQNQTEEIPVEESEVTDEAPTVEEQLQSAISERDENQDRFLRSQAELDNVRKRHQKEM 64

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
           +  + Y+ A F +D+L   DNL RA+D+A              +  L +G+EM  ++++ 
Sbjct: 65  ELLRQYAAAPFIQDLLPALDNLKRAVDAAES---------ADQVGDLKQGVEMVAKQLLD 115

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
            L ++ V  IDA  + F+PN+H+A+ + P D  P  T+I+ ++ G+ +N+RV+RP  V +
Sbjct: 116 VLSKHNVTPIDALGKPFDPNLHEALQQMPSDEHPPMTVIQELEQGFILNDRVVRPTKVIV 175

Query: 186 SKGKTQ 191
           S G  +
Sbjct: 176 SSGPAE 181


>gi|260580624|ref|ZP_05848451.1| co-chaperone GrpE [Haemophilus influenzae RdAW]
 gi|1573022|gb|AAC21750.1| heat shock protein (grpE) [Haemophilus influenzae Rd KW20]
 gi|260092686|gb|EEW76622.1| co-chaperone GrpE [Haemophilus influenzae RdAW]
          Length = 234

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 65/207 (31%), Positives = 113/207 (54%), Gaps = 29/207 (14%)

Query: 2   ETFMSEKNIDKE-------KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKY------- 47
           E  MSE+    E       +      +  AE   E +  EE++ + +E  ++        
Sbjct: 34  EKKMSEQEQKVEIPEVEKQEEVVVEETQQAEHSQEFDPLEEAIARVQELEEQLKTQIEEA 93

Query: 48  --------LRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLA 99
                   LR  AE+ENLRRRT+++ + A  +++ KF++D+L+  DNL RAL +      
Sbjct: 94  ANKEQDILLRSRAEIENLRRRTEQDVEKAHKFALEKFSKDILNTIDNLERALAT------ 147

Query: 100 NSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVP 159
               K +  +K+L +G+E+T +E++ST+ R+GV+ +    + FNP++HQA+  +P +   
Sbjct: 148 -PANKEDESVKALFDGVELTLKELVSTVGRFGVEAVGVVGEAFNPDLHQAISMQPAEGFE 206

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
            N I  V+Q GY +N RV+RPA+V ++
Sbjct: 207 TNQISVVLQKGYTLNGRVIRPAMVMVA 233


>gi|315645955|ref|ZP_07899076.1| GrpE protein [Paenibacillus vortex V453]
 gi|315278716|gb|EFU42030.1| GrpE protein [Paenibacillus vortex V453]
          Length = 198

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 51/188 (27%), Positives = 89/188 (47%), Gaps = 11/188 (5%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEI--NIPEESLNQSEEFRDKYLRVIAEMENLRR 59
           ET  +     + +          E   E      E+   +  E + + LRV A+ +N RR
Sbjct: 20  ETLENTPGPGEGEVTPEQEIPVTESSDEAGSAELEKLQAEVLEHQQRALRVQADFDNFRR 79

Query: 60  RTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMT 119
           RT +EK++   Y+ +K   ++L V DN  RAL ++               +S  +G+ M 
Sbjct: 80  RTQKEKEELGKYASSKLITELLPVIDNFERALQASGD---------NPEFESFSKGVNMI 130

Query: 120 RREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
            R++ S L   G+  +++  + FNP  HQA+ +   D      +++ VQ GY + ++VLR
Sbjct: 131 FRQLESVLASEGLTAMNSIGEPFNPEYHQAIMQVESDEFEEGIVVEEVQKGYMLKDKVLR 190

Query: 180 PALVSISK 187
           PA+V +S 
Sbjct: 191 PAMVKVSM 198


>gi|146329795|ref|YP_001209724.1| co-chaperone GrpE [Dichelobacter nodosus VCS1703A]
 gi|166215261|sp|A5EYG2|GRPE_DICNV RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|146233265|gb|ABQ14243.1| co-chaperone GrpE [Dichelobacter nodosus VCS1703A]
          Length = 187

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 54/187 (28%), Positives = 92/187 (49%), Gaps = 7/187 (3%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           +ET + E    ++   +             +   +   +  E +D+ +   AE ENLR+R
Sbjct: 8   LETNIQETESQEKLPETPIIEEEPILTLPDDQINQLQQEVAELKDQLIWQKAENENLRKR 67

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
             RE ++A  ++  +  +D+L V D+L+  L +A              +K  I G EMT 
Sbjct: 68  QARELENAYKFASERLLKDLLPVIDSLNLGLQAALDTE-------NEAVKQFITGSEMTL 120

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
                TL R+G+++I+   +KFNP +H+A+   P +    NT+I+V Q GY +N R +R 
Sbjct: 121 TMFQETLARHGIEEINPVGEKFNPELHEAVTMTPSEAHEPNTVIQVTQKGYLLNGRTVRA 180

Query: 181 ALVSISK 187
           A V +SK
Sbjct: 181 AQVIVSK 187


>gi|308272163|emb|CBX28770.1| Protein grpE [uncultured Desulfobacterium sp.]
          Length = 208

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 55/186 (29%), Positives = 99/186 (53%), Gaps = 8/186 (4%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +    +    N        +      + +  ++++  +++LRV A+ EN ++R+ RE  +
Sbjct: 31  EETTDKCEMKNETKIPDTIEELKEKLKNAELEAKQSYERFLRVSADFENYKKRSSREVSE 90

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
            + Y+      ++L V DNL RA++S+  D   +          +++G+++T  E     
Sbjct: 91  FKKYANESILSELLCVMDNLERAINSSATDEKVNSC--------IVDGVKITLNEFKKVF 142

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           E YGVK I++  + F+PN HQAM +E  D  P NT++   Q GY I++R+LRP++V +SK
Sbjct: 143 ENYGVKPIESLCKPFDPNFHQAMMQEETDEHPENTVMSEFQKGYTIHDRLLRPSMVVVSK 202

Query: 188 GKTQNP 193
            KT N 
Sbjct: 203 AKTDNK 208


>gi|319940929|ref|ZP_08015267.1| grpE protein [Sutterella wadsworthensis 3_1_45B]
 gi|319805645|gb|EFW02433.1| grpE protein [Sutterella wadsworthensis 3_1_45B]
          Length = 213

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 54/179 (30%), Positives = 94/179 (52%), Gaps = 11/179 (6%)

Query: 11  DKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQS 70
           DK    +   ++    +      + +  +  E  D Y+R +A++EN RRR+  E    + 
Sbjct: 45  DKPAEAAKKETAEPTPQELKAQLKAAEQKVIEHYDLYVRAMADLENARRRSSEELVKTRK 104

Query: 71  YSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERY 130
           ++I KFA ++L V D+L +AL++   D  ++            EG+E T R++M  L+  
Sbjct: 105 FAIEKFAENLLPVVDSLEKALEATAADKDSAA----------REGMEATYRQLMHALDVS 154

Query: 131 GVKKIDAKDQKFNPNMHQAMFEEPHDT-VPANTIIKVVQDGYAINERVLRPALVSISKG 188
            +K ID K + F+P+ H A+   P    V    +++V Q G+ I  RVLRPA+VS+++G
Sbjct: 155 DMKPIDPKGEAFDPHFHMAITMVPAPEGVKPGMVVQVFQRGWNIAGRVLRPAMVSVAQG 213


>gi|83953085|ref|ZP_00961807.1| co-chaperone GrpE [Sulfitobacter sp. NAS-14.1]
 gi|83842053|gb|EAP81221.1| co-chaperone GrpE [Sulfitobacter sp. NAS-14.1]
          Length = 187

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 58/180 (32%), Positives = 103/180 (57%), Gaps = 8/180 (4%)

Query: 12  KEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
            +          +E   E    +E   + ++ +D+++R +A+ EN R+R+D+++++A++Y
Sbjct: 14  DDAEAEAYADEMSEIDDEALELDELRAERDQLKDRFMRALADAENARKRSDKDRREAENY 73

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
             +K ARDML V DN+ RAL++A  +              L+EGIE+T RE++S  +++G
Sbjct: 74  GGSKLARDMLPVYDNMKRALEAATEEQRTISGP-------LLEGIELTMRELLSVFKKHG 126

Query: 132 VKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ I      KF+P  HQAMFE P     +  II+V  +G+ +++R+LRPA V +S    
Sbjct: 127 IEVISPAVGDKFDPQHHQAMFEAPVPDTKSGDIIQVAAEGFMLHDRLLRPAQVGVSSTPA 186


>gi|283484357|gb|ADB23408.1| chloroplast CGE2 [Physcomitrella patens]
          Length = 307

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 38/200 (19%), Positives = 87/200 (43%), Gaps = 12/200 (6%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEE----SLNQSEEFRDKYLRVIAEMEN 56
           +E +     ++ E+  ++  S       E +   E     + +    +D+Y+R+ A+ +N
Sbjct: 106 LEAYREAVAVNDEEAITDVESQLEAIAIERDSLAENANALIGEVSTNKDRYIRLNADFDN 165

Query: 57  LRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGI 116
            R+R++R++         +    +L + DN  RA  S   +            + +    
Sbjct: 166 YRKRSERDRLATAGNIRGEVVESLLPIVDNFERAKTSIKTETEGE--------QKIDNAY 217

Query: 117 EMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINER 176
           +   ++ +  ++  GV  I+   + F+PN+H+A+  E       + + +  + G+ I +R
Sbjct: 218 QSIYKQFVEIMKSLGVVAIETVGKSFDPNLHEAIMREDSTEFAEDIVSQEFRRGFRIEDR 277

Query: 177 VLRPALVSISKGKTQNPTEE 196
           +LRPA+V +S G       +
Sbjct: 278 LLRPAMVKVSSGPGPAADTD 297


>gi|238019345|ref|ZP_04599771.1| hypothetical protein VEIDISOL_01209 [Veillonella dispar ATCC 17748]
 gi|237864044|gb|EEP65334.1| hypothetical protein VEIDISOL_01209 [Veillonella dispar ATCC 17748]
          Length = 181

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 55/186 (29%), Positives = 95/186 (51%), Gaps = 12/186 (6%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEE--SLNQSEEFRDKYLRVIAEMENLRR 59
           E  + ++ +D+  N +N      EE  E+             +F ++Y R+ A+ EN +R
Sbjct: 4   EQDIKQETVDETANATNVEEPAVEETEEVVADAAHVLDELKADFDNRYKRLQADFENFKR 63

Query: 60  RTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMT 119
           RT++EK+    Y       D+L V DN  RA+ S           +E   K  ++G  M 
Sbjct: 64  RTNQEKEQLAGYVKGDVLTDLLPVLDNFERAVQS----------PAEGDAKVFLDGFIMI 113

Query: 120 RREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
            + +M+ L ++G+  IDA  + F+PN HQA+   P D   ++T+ +V+Q GY ++ R +R
Sbjct: 114 HQNLMAMLSKHGLAVIDAVGKPFDPNFHQAIMRVPSDEYESDTVCEVLQTGYTVDGRCIR 173

Query: 180 PALVSI 185
           PA+V +
Sbjct: 174 PAMVKV 179


>gi|86740871|ref|YP_481271.1| GrpE protein [Frankia sp. CcI3]
 gi|86567733|gb|ABD11542.1| GrpE protein [Frankia sp. CcI3]
          Length = 224

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 48/159 (30%), Positives = 76/159 (47%), Gaps = 11/159 (6%)

Query: 35  ESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSA 94
               Q ++  D++ R  A+++NLR+RT RE +  ++   A  A   L V D+L  AL  A
Sbjct: 56  ALAMQVDKLTDRWRRAAADLDNLRKRTVRELERDRAAERAHAAAAWLPVLDHLDLALTHA 115

Query: 95  PLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEP 154
             D             SL+ G+   R + +  L R G  + D     F+P  H+A+    
Sbjct: 116 DADPT-----------SLVAGVRTVRDQAVDVLARLGYPRHDEVGVPFDPTRHEALAAVE 164

Query: 155 HDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNP 193
              VPA T++ V++ GY    R LRPA V++S+   + P
Sbjct: 165 EPNVPAGTVVAVIRPGYGDTGRQLRPAGVAVSRPPGEPP 203


>gi|114777594|ref|ZP_01452575.1| Molecular chaperone GrpE (heat shock protein) [Mariprofundus
           ferrooxydans PV-1]
 gi|114552065|gb|EAU54582.1| Molecular chaperone GrpE (heat shock protein) [Mariprofundus
           ferrooxydans PV-1]
          Length = 181

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 56/184 (30%), Positives = 102/184 (55%), Gaps = 12/184 (6%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           K  + ++  +  +         ++  E+   ++ E +D+ LR  AEMENLR+R++R+  D
Sbjct: 10  KQKESQELDAAVDVDEVTVDDAVDPLEQLQQENNELKDRLLRTHAEMENLRKRSERQVAD 69

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A  + I KFA  +L V+DN+ RAL+    +            ++L EG+++T       +
Sbjct: 70  AHKFGIEKFASALLDVADNMERALEVEAGNE-----------EALREGVQLTLNSWHDLM 118

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +R+ V++IDA  Q+F+PN H+A+ + P D  P  T++     GY+++ R++RPA V +S 
Sbjct: 119 KRFHVERIDAVGQQFDPNWHEALTQMPSDE-PEGTVVAQHVAGYSLHGRLIRPAKVLVSS 177

Query: 188 GKTQ 191
           G  +
Sbjct: 178 GPQK 181


>gi|115384182|ref|XP_001208638.1| hypothetical protein ATEG_01273 [Aspergillus terreus NIH2624]
 gi|114196330|gb|EAU38030.1| hypothetical protein ATEG_01273 [Aspergillus terreus NIH2624]
          Length = 247

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 62/194 (31%), Positives = 106/194 (54%), Gaps = 8/194 (4%)

Query: 3   TFMSEKNIDK-EKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           ++ +E    + EK  + A  +   E       EE   +  + +DKY+R +A+  NL+ RT
Sbjct: 53  SYSTENQAAEGEKKENGAEEAKEAEDPCQKELEEKKKEVVDLKDKYVRSVADFLNLQERT 112

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
            RE ++A++++I +FA D+L   DN  RAL + P D  +S+      L++ +EG++MT+ 
Sbjct: 113 KREMENARNFAIQRFAVDLLESVDNFDRALLAVPEDKLSSDSPEHKDLQNFVEGVKMTQN 172

Query: 122 EMMSTLERYGVKKIDAKD-------QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAIN 174
            MM+ L+++G+++ D  +       QKF+PN H+A F    D      I+ V   G+ +N
Sbjct: 173 IMMNALKKHGLERFDPSEPAEDGKAQKFDPNRHEATFMAKVDGKENGDIMYVQSKGFTLN 232

Query: 175 ERVLRPALVSISKG 188
            RVLR A V + K 
Sbjct: 233 GRVLRAAKVGVVKN 246


>gi|254228624|ref|ZP_04922048.1| co-chaperone GrpE [Vibrio sp. Ex25]
 gi|151938803|gb|EDN57637.1| co-chaperone GrpE [Vibrio sp. Ex25]
          Length = 219

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 56/168 (33%), Positives = 98/168 (58%), Gaps = 8/168 (4%)

Query: 20  NSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARD 79
           + + A+          S  + +E +D  LR  AE+EN+RRRT++E   A+ +++ KFA +
Sbjct: 60  DETDAKIAQLEAALLSSEAKVKEQQDAVLRSKAEVENMRRRTEQEIDKARKFALNKFAEE 119

Query: 80  MLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKD 139
           +L V DNL RA+ +A  +           +K  +EG+E+T +  +  + ++G+K I+ + 
Sbjct: 120 LLPVIDNLERAIQAADTE--------NETVKPFLEGVELTHKTFVDVVAKFGLKAINPEG 171

Query: 140 QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           + FNP  HQAM  +      +NT++ V+Q GY +N RV+RPA+V ++K
Sbjct: 172 EAFNPEFHQAMSIQESPDHESNTVMFVMQKGYELNGRVIRPAMVMVAK 219


>gi|67622776|ref|XP_667827.1| co-chaperone GrpE [Cryptosporidium hominis TU502]
 gi|54658997|gb|EAL37599.1| co-chaperone GrpE [Cryptosporidium hominis]
          Length = 234

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 59/184 (32%), Positives = 99/184 (53%), Gaps = 12/184 (6%)

Query: 12  KEKNPSNANSSTAEEKSEINIPEESLN-------QSEEFRDKYLRVIAEMENLRRRTDRE 64
           +E+  +   +  A+        +           + EEF++K LR +AE ENLR+R  ++
Sbjct: 56  EEEERAILEAEVAKIGVLQERIKTLEKDASGYIHKIEEFKEKLLRSLAENENLRQRHRKD 115

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
            + A+ YSI+ FA+ +L VSD+LSRAL S  ++  +      + +KSL  GI MT   + 
Sbjct: 116 LEAAREYSISGFAKSLLDVSDSLSRALLSVDIENVDK-----NSIKSLYNGISMTYSSLE 170

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
              E +G+K+  +  ++FNP  H+A+FE    + P   + + +  GY I++RVLR A V+
Sbjct: 171 KVFEAHGIKRFQSLGKQFNPKEHEAVFEVKDTSKPKGQVCEELLPGYKIHDRVLRAAKVA 230

Query: 185 ISKG 188
             K 
Sbjct: 231 TIKN 234


>gi|89895877|ref|YP_519364.1| hypothetical protein DSY3131 [Desulfitobacterium hafniense Y51]
 gi|89335325|dbj|BAE84920.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 212

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 51/187 (27%), Positives = 102/187 (54%), Gaps = 9/187 (4%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           +   + E+ +  E +P    S   +  +     +++ NQ+EE+     R+ AE +N R+R
Sbjct: 35  LSEAVQEEEVGNESSPEQDVSLEEKILTLQAELDQTKNQAEEYYTHLQRLQAEFDNYRKR 94

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T +EK+D   Y+  +    +L V DN  RA++++              +KS  +G+EM  
Sbjct: 95  TQKEKEDFAKYASERVVEGLLPVLDNFERAVEASKT---------TQDMKSFSQGVEMIF 145

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           +++   L + G+  I+A  Q F+PN+H+A+ +   +  P +T+++ +Q GY + E+V+RP
Sbjct: 146 KQLQGILAKEGLAAIEAVGQPFDPNLHEAVLQVDSEDYPESTVVEELQKGYYLKEKVIRP 205

Query: 181 ALVSISK 187
           ++V +S+
Sbjct: 206 SMVKVSR 212


>gi|260582010|ref|ZP_05849805.1| co-chaperone GrpE [Haemophilus influenzae NT127]
 gi|260094900|gb|EEW78793.1| co-chaperone GrpE [Haemophilus influenzae NT127]
          Length = 232

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 64/177 (36%), Positives = 106/177 (59%), Gaps = 12/177 (6%)

Query: 15  NPSNANSSTAEEKSEINIPEESLN-QSEEFRDK----YLRVIAEMENLRRRTDREKKDAQ 69
           +PS       E  + +   EE L  Q EE  +K     LR  AE+ENLRRRT+++ + A 
Sbjct: 62  DPSQEFDPLEEAIARVQELEEQLKTQIEEAANKEQDILLRSRAEIENLRRRTEQDVEKAH 121

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
            +++ KF++D+L+  DNL RAL +          K +  +K+L +G+E+T +E++ST+ R
Sbjct: 122 KFALEKFSKDILNTIDNLERALAT-------PANKEDESVKALFDGVELTLKELVSTVGR 174

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           +GV+ +    + FNP++HQA+  +P +    N I  V+Q GY +N RV+RPA+V ++
Sbjct: 175 FGVEAVGVVGEAFNPDLHQAISMQPAEGFETNQISVVLQKGYTLNGRVIRPAMVMVA 231


>gi|288941112|ref|YP_003443352.1| GrpE protein [Allochromatium vinosum DSM 180]
 gi|288896484|gb|ADC62320.1| GrpE protein [Allochromatium vinosum DSM 180]
          Length = 218

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 58/178 (32%), Positives = 96/178 (53%), Gaps = 8/178 (4%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           + D     S A +     +      + +  + E+ RD+ LR  AE+ENLRRR  +E + A
Sbjct: 43  SADGASAESEAQTEERSIEELSAALDAARAEIEDSRDQVLRARAELENLRRRHAQELEKA 102

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
             +++  F R++L V D+L    ++A            + +  L EG E+T + +   +E
Sbjct: 103 HKFALDGFVRELLQVRDSLELGCNAAQEA--------SADVDKLREGTELTLKLLGDVME 154

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           ++GV  +D  +Q F+P  HQAM  +P + VP NT++ V+Q GY +N R+ RPALV +S
Sbjct: 155 KFGVGVVDPANQPFDPEFHQAMSMQPREDVPPNTVVLVIQKGYTLNGRLARPALVMVS 212


>gi|116071788|ref|ZP_01469056.1| putative heat shock protein GrpE [Synechococcus sp. BL107]
 gi|116065411|gb|EAU71169.1| putative heat shock protein GrpE [Synechococcus sp. BL107]
          Length = 224

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 41/200 (20%), Positives = 85/200 (42%), Gaps = 10/200 (5%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
           +++              +           + E  + +Y+R+ A+ +N R+R  R++ D +
Sbjct: 35  VEETPTMDTEIDPANRLQQLEQELSSLKQEHETVQSQYMRIAADFDNFRKRQARDQDDLR 94

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
              +     ++L V DN  RA      +            ++L    +   ++++  L++
Sbjct: 95  QQLVCSTLTEILPVVDNFERARQQLNPEG--------EEAQALHRSYQGLYKQLVDVLKQ 146

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
            GV +++   Q+F+P +H+A+  E +     + + + +Q GY  + RVLR A+V +S G 
Sbjct: 147 QGVARMEVVGQEFDPTLHEAVLREENQEHAEDIVCEELQRGYHRDGRVLRHAMVKVSMGP 206

Query: 190 TQNPTEEKKETIEQPSPLDI 209
              P        EQP   D 
Sbjct: 207 G--PGSSSDAASEQPQEGDA 224


>gi|221126677|ref|XP_002159590.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
          Length = 163

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 48/142 (33%), Positives = 90/142 (63%), Gaps = 4/142 (2%)

Query: 45  DKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKK 104
           DKY+R +AE EN+RRR  +   DA+ +++  F++D+L V+D L +A+ S P+D       
Sbjct: 25  DKYIRSLAECENVRRRGVKMVSDAKLFAVQGFSKDLLEVADILEKAMLSVPIDELQK--- 81

Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTII 164
              +LK+L +G+ MT   +     ++G++K++  ++KF+PN H+A+F++      + T++
Sbjct: 82  -NELLKNLYDGLVMTEAHLQKVFLKHGLQKVNPINEKFDPNFHEALFQKSIPGKASGTVV 140

Query: 165 KVVQDGYAINERVLRPALVSIS 186
           +V + GY +N R +R ALV ++
Sbjct: 141 EVNKPGYLLNGRPVRAALVGVA 162


>gi|30995352|ref|NP_438245.2| heat shock protein GrpE [Haemophilus influenzae Rd KW20]
          Length = 230

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 65/207 (31%), Positives = 113/207 (54%), Gaps = 29/207 (14%)

Query: 2   ETFMSEKNIDKE-------KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKY------- 47
           E  MSE+    E       +      +  AE   E +  EE++ + +E  ++        
Sbjct: 30  EKKMSEQEQKVEIPEVEKQEEVVVEETQQAEHSQEFDPLEEAIARVQELEEQLKTQIEEA 89

Query: 48  --------LRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLA 99
                   LR  AE+ENLRRRT+++ + A  +++ KF++D+L+  DNL RAL +      
Sbjct: 90  ANKEQDILLRSRAEIENLRRRTEQDVEKAHKFALEKFSKDILNTIDNLERALAT------ 143

Query: 100 NSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVP 159
               K +  +K+L +G+E+T +E++ST+ R+GV+ +    + FNP++HQA+  +P +   
Sbjct: 144 -PANKEDESVKALFDGVELTLKELVSTVGRFGVEAVGVVGEAFNPDLHQAISMQPAEGFE 202

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
            N I  V+Q GY +N RV+RPA+V ++
Sbjct: 203 TNQISVVLQKGYTLNGRVIRPAMVMVA 229


>gi|83942036|ref|ZP_00954498.1| co-chaperone GrpE [Sulfitobacter sp. EE-36]
 gi|83847856|gb|EAP85731.1| co-chaperone GrpE [Sulfitobacter sp. EE-36]
          Length = 187

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 59/180 (32%), Positives = 103/180 (57%), Gaps = 8/180 (4%)

Query: 12  KEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
            +          +E   E    +E   + ++ +D+++R +A+ EN R+R+D+++++A++Y
Sbjct: 14  DDAEAEAYADEMSEIDDEALELDELRAERDQLKDRFMRALADAENARKRSDKDRREAENY 73

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
             +K ARDML V DN+ RAL++A  +              L+EGIE+T RE++S  +++G
Sbjct: 74  GGSKLARDMLPVYDNMKRALEAATEEQRTISGP-------LLEGIELTMRELLSVFKKHG 126

Query: 132 VKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ I      KF+P  HQAMFE P     A  II+V  +G+ +++R+LRPA V +S    
Sbjct: 127 IEVISPAVGDKFDPQHHQAMFEAPVPDTKAGDIIQVAAEGFMLHDRLLRPAQVGVSSTPA 186


>gi|154254009|ref|YP_001414833.1| GrpE protein [Parvibaculum lavamentivorans DS-1]
 gi|254799605|sp|A7HZ43|GRPE_PARL1 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|154157959|gb|ABS65176.1| GrpE protein [Parvibaculum lavamentivorans DS-1]
          Length = 213

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 69/196 (35%), Positives = 108/196 (55%), Gaps = 4/196 (2%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
            EK  +   +   A     +  +          +  + R++ LR  A+MEN R+R +REK
Sbjct: 19  EEKLAETLASEPAAQGEAEDAAAAGPDVAALEAEISDLRNRLLRAAADMENNRKRAEREK 78

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
           +DAQ Y+ A FARDML VSDNL RA+ +   D           +K++IEG+EMT R++++
Sbjct: 79  QDAQRYAAANFARDMLEVSDNLRRAIATLKEDERAEA---AESVKAMIEGVEMTDRQLVT 135

Query: 126 TLERYGV-KKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
             ER+G+ +      ++F+PN+H+AMFE P    PA T++ V+  GY I +R+LR A V 
Sbjct: 136 IFERHGIREITPQPGERFDPNLHEAMFEVPGTDQPAGTVVHVLGAGYMIGDRLLRAARVG 195

Query: 185 ISKGKTQNPTEEKKET 200
           ++K         K +T
Sbjct: 196 VAKADDGAAKGGKVDT 211


>gi|154150749|ref|YP_001404367.1| GrpE protein [Candidatus Methanoregula boonei 6A8]
 gi|153999301|gb|ABS55724.1| GrpE protein [Methanoregula boonei 6A8]
          Length = 180

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 53/196 (27%), Positives = 90/196 (45%), Gaps = 17/196 (8%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           ME    +     E   +   +S      + +       +  E  D+YLR+ A+ +N R+R
Sbjct: 1   MEDH--DTTPVPETPAAEPETSVPSPPGQNDELAGQKKRYAELNDRYLRLAADFDNYRKR 58

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
             R+ +     +  +FA D+L ++DNL RAL +                  L  G++  R
Sbjct: 59  IARDHETQVQLANERFAVDILEIADNLDRALKADE--------------DHLRTGVDQIR 104

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + +   L R+G+  IDA+   F+P +H+A+   P D     T+I VV  GY ++ +V+R 
Sbjct: 105 QLLAGVLARHGITPIDAQKISFDPGVHEAVAHIPSDEKE-GTVIDVVSPGYRMHNKVIRY 163

Query: 181 ALVSISKGKTQNPTEE 196
           A V++SKG   N    
Sbjct: 164 AKVAVSKGNPSNEETS 179


>gi|145630627|ref|ZP_01786406.1| anaerobic ribonucleoside triphosphate reductase [Haemophilus
           influenzae R3021]
 gi|144983753|gb|EDJ91203.1| anaerobic ribonucleoside triphosphate reductase [Haemophilus
           influenzae R3021]
          Length = 234

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 63/207 (30%), Positives = 111/207 (53%), Gaps = 29/207 (14%)

Query: 2   ETFMSEKNIDKEK-------NPSNANSSTAEEKSEINIPEESLNQSEEFRDKY------- 47
           E  MSE+    +              +  AE   E +  EE++ + +E  ++        
Sbjct: 34  EKKMSEQEQKVKNPEVENQEEVVVEETQQAEHSQEFDPLEEAIARVQELEEQLKTQIEEA 93

Query: 48  --------LRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLA 99
                   LR  AE+ENLRRRT+++ + A  +++ KF++D+L+  DNL RAL +      
Sbjct: 94  TNKEQDILLRSRAEIENLRRRTEQDVEKAHKFALEKFSKDILNTIDNLERALATPTNKE- 152

Query: 100 NSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVP 159
                 +  +K+L +G+E+T +E++ST+ R+GV+ +    + FNP++HQA+  +P +   
Sbjct: 153 ------DESVKALFDGVELTLKELVSTVGRFGVEAVGVVGEAFNPDLHQAISMQPAEGFE 206

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
            N I  V+Q GY +N RV+RPA+V ++
Sbjct: 207 TNQISVVLQKGYTLNGRVIRPAMVMVA 233


>gi|111222025|ref|YP_712819.1| Hsp 24 nucleotide exchange factor [Frankia alni ACN14a]
 gi|111149557|emb|CAJ61251.1| Hsp 24 nucleotide exchange factor [Frankia alni ACN14a]
          Length = 226

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 51/207 (24%), Positives = 92/207 (44%), Gaps = 18/207 (8%)

Query: 20  NSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARD 79
            + +  E+ E     +   + E+ +  +LR +A+ +N RRRT RE   A++    +    
Sbjct: 25  ENRSDAERPETTPAPDLAAKLEQCQASHLRTLADFDNYRRRTGREIGAAKAAERDRVVLA 84

Query: 80  MLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKD 139
            + V D+L  AL  A  D             SL++G+   R+  +  L   GV ++D + 
Sbjct: 85  WVPVLDHLELALSHADADPD-----------SLVDGVRGVRQLALGALRNSGVTRLDDET 133

Query: 140 QKFNPNMHQAMFEEPHDTV----PANTIIKVVQDGYAINERVLRPALVSISKGKTQN--- 192
             F+P  H+        +     PA T+++V++ GY  + RVLRPA V++S G   N   
Sbjct: 134 GAFDPTRHEVGAVVDSGSTSRPPPAGTVVEVLRPGYQADGRVLRPASVAVSAGPKPNNGP 193

Query: 193 PTEEKKETIEQPSPLDIEERNKTQTKN 219
            +   +++ + P      E  K    +
Sbjct: 194 ESNNGEKSNDGPRRDTGSEPGKGPEPD 220


>gi|54294924|ref|YP_127339.1| heat-shock protein GrpE(HSP-70 cofactor) [Legionella pneumophila
           str. Lens]
 gi|81679175|sp|Q5WV14|GRPE_LEGPL RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|53754756|emb|CAH16243.1| Heat-shock protein GrpE(HSP-70 cofactor) [Legionella pneumophila
           str. Lens]
 gi|307610752|emb|CBX00359.1| heat-shock protein GrpE(HSP-70 cofactor) [Legionella pneumophila
           130b]
          Length = 199

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 52/162 (32%), Positives = 88/162 (54%), Gaps = 10/162 (6%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
            +       +  ++ E  +K +R +AE+EN+RRR +RE  +A  Y + K    +L V D+
Sbjct: 48  TALEEQLTLAEQKAHENWEKSVRALAELENVRRRMEREVANAHKYGVEKLISALLPVVDS 107

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNM 146
           L +AL  A  +             S+ EG+E+T +  +  L+++ V++ID   Q F+P  
Sbjct: 108 LEQALQLADKNSDP----------SMHEGLELTMKLFLDALQKFDVEQIDPLGQTFDPQQ 157

Query: 147 HQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           H+AM  +P    P N++I V Q GY +++RV+RPA V +S  
Sbjct: 158 HEAMSMQPAPGAPPNSVITVFQKGYKLSDRVIRPARVIVSTK 199


>gi|326387913|ref|ZP_08209519.1| GrpE protein [Novosphingobium nitrogenifigens DSM 19370]
 gi|326207959|gb|EGD58770.1| GrpE protein [Novosphingobium nitrogenifigens DSM 19370]
          Length = 190

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 61/184 (33%), Positives = 100/184 (54%), Gaps = 5/184 (2%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           E   + E  P+        + +      +   + E  R   L   AE +N+RRR +++  
Sbjct: 12  EVKAELEGVPAEMIDLGGTDGTADAQLGKLAEELEVARQDILYAKAETQNVRRRLEKDIA 71

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
           DA++Y+   FARD+LSV+DNL+RAL+S P +L           K+L+ G+E T RE+   
Sbjct: 72  DARAYAATAFARDILSVADNLARALESIPAELRGD-----DKFKALVSGLEATGRELDKV 126

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
              +G+ +I AK    +P+ HQAM E P + V   T+++ +Q GY I +R+LR A+V+++
Sbjct: 127 FSSHGISRIAAKGLPLDPHQHQAMMEFPTNDVEPGTVVQELQAGYMIKDRLLRAAMVAVA 186

Query: 187 KGKT 190
           K   
Sbjct: 187 KKPE 190


>gi|315497105|ref|YP_004085909.1| grpe protein [Asticcacaulis excentricus CB 48]
 gi|315415117|gb|ADU11758.1| GrpE protein [Asticcacaulis excentricus CB 48]
          Length = 198

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 64/204 (31%), Positives = 109/204 (53%), Gaps = 8/204 (3%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
           + +E    +A  +     +     E+   ++   +++ LR  AE EN++RR +RE  DA+
Sbjct: 1   MSEEHTEQDAPFANDAIDTLNAALEQLQAENAALKEQALRYAAEAENVKRRAEREMNDAR 60

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
           +Y+I +F+RD+L V+D L RAL + P  + +         K+ + GIEMT +E+    E+
Sbjct: 61  AYAIQRFSRDLLGVADVLQRALQAVPGQVEDP------AFKNFVSGIEMTEKELAGAFEK 114

Query: 130 YGVKKIDA-KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
            GVKKI   K  KF+PN HQA+ E+P   V   +++ V+Q GY +  R +RPA+V ++  
Sbjct: 115 NGVKKIAPLKGDKFDPNFHQAVMEQPSTEVEGGSVLMVMQAGYELFGRTIRPAMV-VTAA 173

Query: 189 KTQNPTEEKKETIEQPSPLDIEER 212
           KT +         +  S   +  +
Sbjct: 174 KTASAANGAYNGSDTASGGTVNTQ 197


>gi|68248623|ref|YP_247735.1| heat shock protein GrpE [Haemophilus influenzae 86-028NP]
 gi|68056822|gb|AAX87075.1| GrpE [Haemophilus influenzae 86-028NP]
          Length = 234

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 68/207 (32%), Positives = 112/207 (54%), Gaps = 29/207 (14%)

Query: 2   ETFMSEKNIDKE-----------------KNPSNANSSTAEEKSEINIPEESLN-QSEEF 43
           E  MSE+    E                  +PS       E  + +   EE L  Q EE 
Sbjct: 34  EKKMSEQEQKVEIPEVENQEEVVVEEAQQADPSQEFDPLEEAIARVQELEEQLKTQIEEA 93

Query: 44  RDK----YLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLA 99
            +K     LR  AE+ENLRRRT+++ + A  +++ KF++D+L+  DNL RAL +      
Sbjct: 94  ANKEQDILLRSRAEIENLRRRTEQDVEKAHKFALEKFSKDILNTIDNLERALAT------ 147

Query: 100 NSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVP 159
               K +  +K+L +G+E+T +E++ST+ R+GV+ +    + FNP++HQA+  +P +   
Sbjct: 148 -PANKEDESVKALFDGVELTLKELVSTVGRFGVEAVGVVGEAFNPDLHQAISMQPAEGFE 206

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
            N I  V+Q GY ++ RV+RPA+V ++
Sbjct: 207 TNQISVVLQKGYTLSGRVIRPAMVMVA 233


>gi|39995143|ref|NP_951094.1| heat shock protein GrpE [Geobacter sulfurreducens PCA]
 gi|52782890|sp|Q74H60|GRPE_GEOSL RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|39981905|gb|AAR33367.1| GrpE protein [Geobacter sulfurreducens PCA]
 gi|298504173|gb|ADI82896.1| DnaJ adenine nucleotide exchange factor GrpE [Geobacter
           sulfurreducens KN400]
          Length = 200

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 54/150 (36%), Positives = 86/150 (57%), Gaps = 11/150 (7%)

Query: 45  DKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKK 104
           DK++R  A++EN RRRT +EK++   Y      +D+L V D++ RAL  A          
Sbjct: 61  DKFVRERADLENYRRRTQKEKEELLKYGNESLLQDILPVVDSMERALGHAD--------- 111

Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKID-AKDQKFNPNMHQAMFEEPHDTVPANTI 163
               L ++IEGI MT   ++ TL+++GV  ++  +   F+P  HQAM +     +P NT+
Sbjct: 112 -SESLSAVIEGIRMTHGMLLGTLKKFGVVAVEAERGTVFDPAYHQAMCQVEVSELPPNTV 170

Query: 164 IKVVQDGYAINERVLRPALVSISKGKTQNP 193
           ++V Q GY +NER+LRPA+VS++       
Sbjct: 171 VEVFQRGYLLNERLLRPAMVSVATVPKDAA 200


>gi|238753936|ref|ZP_04615296.1| hypothetical protein yruck0001_7110 [Yersinia ruckeri ATCC 29473]
 gi|238707924|gb|EEQ00282.1| hypothetical protein yruck0001_7110 [Yersinia ruckeri ATCC 29473]
          Length = 192

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 64/190 (33%), Positives = 100/190 (52%), Gaps = 9/190 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR-DKYLRVIAEMENLRRR 60
           E    E     E+    A   +      I   E  L  + +   D  LR  AE+EN+RRR
Sbjct: 11  EQVSEEMEQAVEQQAGAAQEMSDGVDPRIAELETQLADALQRERDSLLRAKAEVENIRRR 70

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+ + + A  +++ KF+  +L V DNL RALDSA          S + L  +IEG+E+TR
Sbjct: 71  TELDIEKAHKFALEKFSSSLLPVIDNLERALDSAD--------HSNTELAVMIEGVELTR 122

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + ++  +E++G++ +   +  FNP +HQAM          N ++ V+Q GY +N R+LRP
Sbjct: 123 KSLLDAVEKFGIEVVAESNVPFNPEVHQAMTMIESADHEPNHVMNVMQKGYTLNGRLLRP 182

Query: 181 ALVSISKGKT 190
           A+V +SK K 
Sbjct: 183 AMVVVSKAKA 192


>gi|3851640|gb|AAC72387.1| chaperone GrpE type 2 [Nicotiana tabacum]
          Length = 304

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 57/200 (28%), Positives = 104/200 (52%), Gaps = 9/200 (4%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLN----QSEEFRDKYLRVIAEMENLRRRTDREK 65
            D++      + S  +    +   EE L     + ++ +DK LR  AEMEN+  RT RE 
Sbjct: 105 QDEKDESDTEDLSRDDLVKLVAEKEELLKMKDGEFQKMQDKVLRTYAEMENVMNRTKREA 164

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPL-----DLANSEKKSESVLKSLIEGIEMTR 120
           ++++ ++I  F + +L VSDNL RA           D +     +  +LK+L+EG+EMT 
Sbjct: 165 ENSKKFAIQNFVKALLDVSDNLGRASSVVKESFSKIDESKDTAGAVPLLKTLLEGVEMTD 224

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           +++    +++GV K D  +++F+PN H A+F+ P        +   ++ GY ++ER++RP
Sbjct: 225 KQLAEVFKKFGVGKYDPTNEQFDPNKHNAIFQVPDPKKAPGVVAVCLKSGYTLHERIIRP 284

Query: 181 ALVSISKGKTQNPTEEKKET 200
           A V ++        ++  E 
Sbjct: 285 AEVGVTVAVESTQADQNTEA 304


>gi|298251341|ref|ZP_06975144.1| GrpE protein [Ktedonobacter racemifer DSM 44963]
 gi|297545933|gb|EFH79801.1| GrpE protein [Ktedonobacter racemifer DSM 44963]
          Length = 218

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 52/175 (29%), Positives = 89/175 (50%), Gaps = 9/175 (5%)

Query: 31  NIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRA 90
              +E   ++EE+ D+  R  A+  N RRR  +E+ + +  + +     ML V D+L  A
Sbjct: 47  EAEQEEHRKAEEYLDQLRRTQADFANYRRRMGKEQVEGRIAAQSSLLYQMLPVLDDLEIA 106

Query: 91  LDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM 150
           L SAP ++            S ++G+ +  R + STL++ GV+++ A  ++F P  H+A+
Sbjct: 107 LRSAPTEMCP---------HSWVQGLFLVARRLESTLDQLGVQRVGAIGEQFTPRWHEAI 157

Query: 151 FEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQPS 205
             E     P  TI+ V Q GY I + V+RPA VS++    Q  T   +E  +  +
Sbjct: 158 ATEARRDAPEGTILDVHQQGYIIEDHVIRPARVSVAGIPPQRQTPTAQEGTDDDN 212


>gi|224116576|ref|XP_002317335.1| predicted protein [Populus trichocarpa]
 gi|222860400|gb|EEE97947.1| predicted protein [Populus trichocarpa]
          Length = 244

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 57/170 (33%), Positives = 102/170 (60%), Gaps = 5/170 (2%)

Query: 28  SEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNL 87
            +  + +E   + E  +DK LR  AEMEN++ RT RE ++++ ++I  FA+ +L V+DNL
Sbjct: 75  EKEELLKEKHKEMETMQDKVLRTYAEMENVKERTKREAENSKKFAIQNFAKSLLDVADNL 134

Query: 88  SRALDSAPLDLANSEKKSESV-----LKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKF 142
            RA      + +     +++      LK+L+EG+EMT +++    ++YGV+K D  ++ F
Sbjct: 135 GRASSVVKGNFSKINVSNDAADVVPLLKTLLEGVEMTEKQLGEVFKKYGVEKFDPINEPF 194

Query: 143 NPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQN 192
           +P+ H AMFE P    P   +  V++ GY ++ERV+RPA V +++   ++
Sbjct: 195 DPHRHNAMFEVPDPLKPPGIVAAVLKVGYMLHERVIRPAEVGVTRAVEKD 244


>gi|302764904|ref|XP_002965873.1| hypothetical protein SELMODRAFT_83859 [Selaginella moellendorffii]
 gi|300166687|gb|EFJ33293.1| hypothetical protein SELMODRAFT_83859 [Selaginella moellendorffii]
          Length = 237

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 42/215 (19%), Positives = 85/215 (39%), Gaps = 8/215 (3%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E  +           +       E  S   +      +S   +++ LR+ A+ +N R+R+
Sbjct: 30  EAVLGNDQAAMSTIQAELEVIQKERDSLSQLVANLTEESALAKERLLRLNADFDNFRKRS 89

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
            REK   +          +L + DN  RA  +   +              +    +   +
Sbjct: 90  GREKDSLRETVKGDVVESLLPMIDNFERAKGAIKAETDGER--------KIDSSYQGIYK 141

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           + +  ++  GVK ID   ++FNP +H+A+  E         + +  + G+ + E++LR A
Sbjct: 142 QFVDIMKSLGVKVIDTVGKEFNPELHEAIMREESSEYDEGIVTQEFRRGFLLGEKLLRAA 201

Query: 182 LVSISKGKTQNPTEEKKETIEQPSPLDIEERNKTQ 216
           +V +S GK  N      +  E+ +P D    ++  
Sbjct: 202 MVKVSSGKPSNSPAAAPQDSEETTPSDETPVDENS 236


>gi|307546750|ref|YP_003899229.1| molecular chaperone GrpE [Halomonas elongata DSM 2581]
 gi|307218774|emb|CBV44044.1| K03687 molecular chaperone GrpE [Halomonas elongata DSM 2581]
          Length = 259

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 52/191 (27%), Positives = 102/191 (53%), Gaps = 11/191 (5%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKS-EINIPEESLNQSEEFRDKYLRVIAEMENLRR 59
           +E  + +   + E+      S+   E        EE      + +D+ LR  AE +N+RR
Sbjct: 79  VEGELEDAIENAEQTQEERESTDNPEAEVLAAKVEELEQSLADAKDQSLRAAAEAQNVRR 138

Query: 60  RTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMT 119
           R ++E + A+ +++ KF +++L V D+L +ALD+            E   ++  EG+ MT
Sbjct: 139 RAEQEAEKARKFALEKFVKELLPVVDSLEKALDA----------MQEGASETHREGVSMT 188

Query: 120 RREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
            +  +  L ++GV+ +D   + F+P  H+A+   P+  +  N++++V+Q GY +N R++R
Sbjct: 189 LKLQLDVLGKFGVEVVDPTGEPFDPQYHEAVTMVPNAELEPNSVMEVIQKGYLLNGRLVR 248

Query: 180 PALVSISKGKT 190
           PA+V +S+   
Sbjct: 249 PAMVVVSQSSE 259


>gi|145633366|ref|ZP_01789096.1| GrpE [Haemophilus influenzae 3655]
 gi|145635257|ref|ZP_01790961.1| GrpE [Haemophilus influenzae PittAA]
 gi|148827223|ref|YP_001291976.1| heat shock protein GrpE [Haemophilus influenzae PittGG]
 gi|229845410|ref|ZP_04465541.1| GrpE [Haemophilus influenzae 6P18H1]
 gi|144985929|gb|EDJ92531.1| GrpE [Haemophilus influenzae 3655]
 gi|145267536|gb|EDK07536.1| GrpE [Haemophilus influenzae PittAA]
 gi|148718465|gb|ABQ99592.1| GrpE [Haemophilus influenzae PittGG]
 gi|229811718|gb|EEP47416.1| GrpE [Haemophilus influenzae 6P18H1]
          Length = 234

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 64/207 (30%), Positives = 112/207 (54%), Gaps = 29/207 (14%)

Query: 2   ETFMSEKNIDKEK-------NPSNANSSTAEEKSEINIPEESLNQSEEFRDKY------- 47
           E  MSE+    +              +  AE   E +  EE++ + +E  ++        
Sbjct: 34  EKKMSEQEQKVKNPEVENQEEVVVEETQQAEHSQEFDPLEEAIARVQELEEQLKTQIEEA 93

Query: 48  --------LRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLA 99
                   LR  AE+ENLRRRT+++ + A  +++ KF++D+L+  DNL RAL +      
Sbjct: 94  TNKEQDILLRSRAEIENLRRRTEQDVEKAHKFALEKFSKDILNTIDNLERALAT------ 147

Query: 100 NSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVP 159
               K +  +K+L +G+E+T +E++ST+ R+GV+ +    + FNP++HQA+  +P +   
Sbjct: 148 -PANKEDESVKALFDGVELTLKELVSTVGRFGVEAVGVVGEAFNPDLHQAISMQPAEGFE 206

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
            N I  V+Q GY +N RV+RPA+V ++
Sbjct: 207 TNQISVVLQKGYTLNGRVIRPAMVMVA 233


>gi|209520589|ref|ZP_03269344.1| GrpE protein [Burkholderia sp. H160]
 gi|209498982|gb|EDZ99082.1| GrpE protein [Burkholderia sp. H160]
          Length = 198

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 52/159 (32%), Positives = 86/159 (54%), Gaps = 12/159 (7%)

Query: 31  NIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRA 90
               ++  +  E ++ +LR  AE EN+RRR   +   A  ++I  FA  +L V D+L  A
Sbjct: 52  QALADAQAKIAELQESFLRAKAETENVRRRAQEDVTKAHKFAIESFAEHLLPVIDSLEAA 111

Query: 91  LDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM 150
           +  +  D           L+ + EG+E+T R++   LE+  V  I+   +KF+P+ HQA+
Sbjct: 112 VTHSSDD-----------LQKVREGVELTLRQLNGALEKGRVVAINPVGEKFDPHRHQAI 160

Query: 151 FEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
              P      NT++ V+Q G+ I +RVLRPALV+++  K
Sbjct: 161 SMVP-ADQEPNTVVAVLQKGFVIADRVLRPALVTVAAPK 198


>gi|156098693|ref|XP_001615362.1| co-chaperone GrpE [Plasmodium vivax SaI-1]
 gi|148804236|gb|EDL45635.1| co-chaperone GrpE, putative [Plasmodium vivax]
          Length = 306

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 64/189 (33%), Positives = 101/189 (53%), Gaps = 6/189 (3%)

Query: 2   ETFMSEKNIDKEKNPSNANSST--AEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRR 59
           E    +K   KE N    N +    E K      EE +  ++  ++KYL V+AE ENLR 
Sbjct: 122 EGAEQKKEQMKETNYEKLNKADLINEIKKTKRDIEEKMVDNKILKEKYLSVLAENENLRH 181

Query: 60  RTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMT 119
           R  +E ++++ Y I+ FA+ +L V+DNLS A+ +   +           + ++ +GI+MT
Sbjct: 182 RYVKEIENSKLYCISNFAKSLLDVADNLSLAIKNINEESLK----QNEEISNIYKGIQMT 237

Query: 120 RREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
              + +   +YG+ K D  ++KFNP  H+A+FE   DT    T+  VVQ GY I +R+LR
Sbjct: 238 ETILHNIFNKYGIDKYDPINEKFNPLFHEALFEINDDTKEKGTVATVVQQGYKIKDRILR 297

Query: 180 PALVSISKG 188
            A V + K 
Sbjct: 298 AAKVGVVKN 306


>gi|329114977|ref|ZP_08243732.1| Protein GrpE [Acetobacter pomorum DM001]
 gi|326695420|gb|EGE47106.1| Protein GrpE [Acetobacter pomorum DM001]
          Length = 210

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 60/181 (33%), Positives = 97/181 (53%), Gaps = 4/181 (2%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +    E   +   +   + +       E      EF++K+LR  AE +NLR R  R+  D
Sbjct: 33  EQTAPEHEAAAEAAQNGQAEGPEARIHELEQSVAEFKEKWLRSEAENQNLRARAKRDLDD 92

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A+ Y++ KFARD++  ++NL RAL S P          +SVL  + EGIE T R  +S L
Sbjct: 93  ARQYAVQKFARDVVEAAENLRRALASLPPAQEGE----DSVLTKMREGIESTERSFISIL 148

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           ER+G+K  D   + F+ N+HQAM E+P       T+++     + ++ R+L+PA+V ++K
Sbjct: 149 ERHGIKCDDPAGKPFDANLHQAMAEQPSAEHEPGTVMQAWTPTWTLHGRLLKPAMVVVAK 208

Query: 188 G 188
            
Sbjct: 209 A 209


>gi|311695973|gb|ADP98846.1| GrpE nucleotide exchange factor [marine bacterium HP15]
          Length = 199

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 55/172 (31%), Positives = 104/172 (60%), Gaps = 5/172 (2%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
            +E +  E    Q +EF+++ LR +AEM+N+RRR + + + A  +++ KF +++L V+D+
Sbjct: 33  DNETSEVEALQAQVQEFQEQMLRSLAEMQNVRRRAEIDVEKAHKFALEKFVKELLPVADS 92

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNM 146
           L +A++S      +       ++ S+ EG+EMT    MS+L+++ V++I+   + F+P  
Sbjct: 93  LEKAVESTEGHDESG-----ELVASIREGVEMTLSLFMSSLKKFNVEQINPVGEPFDPQH 147

Query: 147 HQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKK 198
           H+AM   P      N+++ VVQ GY +N RV+RPA+V ++K +     +E+ 
Sbjct: 148 HEAMSMVPAPDAEPNSVVAVVQKGYLLNGRVVRPAMVVVAKAEDAPKIDEQA 199


>gi|302768152|ref|XP_002967496.1| hypothetical protein SELMODRAFT_35787 [Selaginella moellendorffii]
 gi|300165487|gb|EFJ32095.1| hypothetical protein SELMODRAFT_35787 [Selaginella moellendorffii]
          Length = 160

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 62/160 (38%), Positives = 101/160 (63%), Gaps = 2/160 (1%)

Query: 28  SEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNL 87
            + +I EE     +E +D  LR +AE+EN R R  RE++ ++ +++  F++D+L VSDNL
Sbjct: 3   EKDSIIEEKDELVKELKDSVLRGLAELENYRERAKREQESSRKFAVQSFSKDLLDVSDNL 62

Query: 88  SRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMH 147
           SRAL S        E K   +L +L+ G++MT +++M  L++YGV++ D   + F+PN+H
Sbjct: 63  SRALSSVGQPKDAEEAK--KLLDTLLAGVKMTEKQLMQVLKKYGVERFDPTGEPFDPNVH 120

Query: 148 QAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            A+ E    + PA T+  V + GY ++ERVLRPA V++ K
Sbjct: 121 LAVCEIADPSKPAGTVANVFKVGYLLHERVLRPAEVAVVK 160


>gi|21554173|gb|AAM63252.1| chaperone GrpE-like protein [Arabidopsis thaliana]
          Length = 302

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 58/206 (28%), Positives = 102/206 (49%), Gaps = 7/206 (3%)

Query: 2   ETFMSEKNIDKEKNPSNA--NSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRR 59
           E     K  D E +  +   +        + ++ +       E +DK+LR  AE +NL  
Sbjct: 97  ENVEVGKATDAEIDFDDLSRDDLVKLVSEKEDLLKVQQKDIMEMKDKFLRTYAEQQNLMD 156

Query: 60  RTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPL-----DLANSEKKSESVLKSLIE 114
           RT+R  + A+ +++  FA  +L V+DNL RA           D +     +  +LK+L+E
Sbjct: 157 RTNRNAESAKKFAVQNFATSLLDVADNLERASSVVKESFSKIDTSKDLAGATPLLKNLLE 216

Query: 115 GIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAIN 174
           G+EMT +++     + G+ K D  ++ FNPN H A+F+ P  + P  TI  V++ GY++ 
Sbjct: 217 GVEMTEKQLAEVFRKAGLVKEDPLNEPFNPNRHNAVFQVPDASKPKGTIAHVLKSGYSLY 276

Query: 175 ERVLRPALVSISKGKTQNPTEEKKET 200
           +RV+RPA V ++         ++   
Sbjct: 277 DRVIRPAEVGVTCAVENQEGGKESAA 302


>gi|332527897|ref|ZP_08403934.1| putative heat shock protein [Rubrivivax benzoatilyticus JA2]
 gi|332112474|gb|EGJ12267.1| putative heat shock protein [Rubrivivax benzoatilyticus JA2]
          Length = 176

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 59/188 (31%), Positives = 89/188 (47%), Gaps = 13/188 (6%)

Query: 4   FMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDR 63
             +  N     +P     +     S      E   +  E  D YLR  AE EN+RRR + 
Sbjct: 1   MNANPNSPDTPSPDATAPAAEATPSAEARLAELEAKHAEVADAYLRAKAETENIRRRAEE 60

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           E   A+ +++  FA  ML V D+L  A+               +  + L+EG   T R++
Sbjct: 61  EVSKARKFAVEAFAESMLPVKDSLEAAIAI-----------QNATPEQLLEGTHATLRQL 109

Query: 124 MSTLERYGVKKI-DAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
              LER  V +I      +F+P+ HQA+   P     ANT++ V+Q GY I +RVLRPAL
Sbjct: 110 TQALERNKVVQIAPPPGTRFDPHQHQAISVVP-ADQEANTVVAVLQKGYLIADRVLRPAL 168

Query: 183 VSISKGKT 190
           V+++  K+
Sbjct: 169 VTVAAPKS 176


>gi|317049192|ref|YP_004116840.1| GrpE protein [Pantoea sp. At-9b]
 gi|316950809|gb|ADU70284.1| GrpE protein [Pantoea sp. At-9b]
          Length = 192

 Score =  115 bits (287), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 65/190 (34%), Positives = 107/190 (56%), Gaps = 9/190 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEE-FRDKYLRVIAEMENLRRR 60
           E    E   D++   +   +        I   E  L QS+   RD  LR  AE+EN+RRR
Sbjct: 11  EQVSDEIQQDQQHVDAETATEVDPRDERIAQLEAELAQSQSGVRDAQLRAQAEIENIRRR 70

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+ + + A  +++ KFA ++L V D+L RAL+ A  +         S L S+IEGIE+T 
Sbjct: 71  TEMDVEKAHKFALEKFANELLPVIDSLERALEVADKE--------NSELASMIEGIELTL 122

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + ++  + ++GV+ +   +  FNP++HQAM     + V  N ++ V+Q GY +N R+LRP
Sbjct: 123 KSLLGAVRKFGVEVVGETNVPFNPDVHQAMSMMESEDVAPNHVMMVMQRGYTLNGRLLRP 182

Query: 181 ALVSISKGKT 190
           A+V+++K K+
Sbjct: 183 AMVAVAKAKS 192


>gi|258541388|ref|YP_003186821.1| heat shock protein GrpE [Acetobacter pasteurianus IFO 3283-01]
 gi|256632466|dbj|BAH98441.1| heat shock protein GrpE [Acetobacter pasteurianus IFO 3283-01]
 gi|256635523|dbj|BAI01492.1| heat shock protein GrpE [Acetobacter pasteurianus IFO 3283-03]
 gi|256638578|dbj|BAI04540.1| heat shock protein GrpE [Acetobacter pasteurianus IFO 3283-07]
 gi|256641632|dbj|BAI07587.1| heat shock protein GrpE [Acetobacter pasteurianus IFO 3283-22]
 gi|256644687|dbj|BAI10635.1| heat shock protein GrpE [Acetobacter pasteurianus IFO 3283-26]
 gi|256647742|dbj|BAI13683.1| heat shock protein GrpE [Acetobacter pasteurianus IFO 3283-32]
 gi|256650795|dbj|BAI16729.1| heat shock protein GrpE [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256653786|dbj|BAI19713.1| heat shock protein GrpE [Acetobacter pasteurianus IFO 3283-12]
          Length = 198

 Score =  114 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 59/181 (32%), Positives = 98/181 (54%), Gaps = 4/181 (2%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +    E   +   +   +        +E    + +F++K+LR  AE +NLR R  R+  D
Sbjct: 21  EQTAPEHEAAAEAAQNGQPSGPEARIQELEQTAADFKEKWLRSEAENQNLRARAKRDLDD 80

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A+ Y++ KFARD++  ++NL RAL S P          +SVL  + EGIE T R  +S L
Sbjct: 81  ARQYAVQKFARDVVEAAENLRRALASLPPAQEGE----DSVLTKMREGIESTERSFISIL 136

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           ER+G+K  D   + F+ N+HQAM E+P       T+++     + ++ R+L+PA+V ++K
Sbjct: 137 ERHGIKCDDPAGKPFDANLHQAMAEQPSPEHEPGTVMQAWTPTWTLHGRLLKPAMVVVAK 196

Query: 188 G 188
            
Sbjct: 197 A 197


>gi|113867157|ref|YP_725646.1| molecular chaperone GrpE [Ralstonia eutropha H16]
 gi|113525933|emb|CAJ92278.1| molecular chaperone GrpE [Ralstonia eutropha H16]
          Length = 186

 Score =  114 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 56/181 (30%), Positives = 89/181 (49%), Gaps = 12/181 (6%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           +     +       TA              ++ E  D Y+R +AE EN+RRR   +   A
Sbjct: 18  DEAANASQEAGAPETAAVDDVAAQLAALEAKAREHYDLYMRAVAEGENIRRRAQEDVAKA 77

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
             ++I  FA ++L V D+L  AL     D           +  L EG+E+T R++ +  E
Sbjct: 78  HKFAIENFADNLLPVMDSLQAALADGSGD-----------IAKLREGVELTARQLAAAFE 126

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           R  + +++   +KF+P+ HQA+   P      NT++ V+Q GY I ERVLRPALV+++  
Sbjct: 127 RGKIVELNPVGEKFDPHRHQAISMVP-ADQEPNTVVTVLQRGYTIAERVLRPALVTVAAP 185

Query: 189 K 189
           K
Sbjct: 186 K 186


>gi|301168665|emb|CBW28256.1| heat shock protein [Haemophilus influenzae 10810]
          Length = 234

 Score =  114 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 64/207 (30%), Positives = 112/207 (54%), Gaps = 29/207 (14%)

Query: 2   ETFMSEKNIDKEK-------NPSNANSSTAEEKSEINIPEESLNQSEEFRDKY------- 47
           E  MSE+    +              +  AE   E +  EE++ + +E  ++        
Sbjct: 34  EKKMSEQEQKVKNPEVENQEEVVVEETQQAEHSQEFDPLEEAIARVQELEEQLKTQIEEA 93

Query: 48  --------LRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLA 99
                   LR  AE+ENLRRRT+++ + A  +++ KF++D+L+  DNL RAL +      
Sbjct: 94  ANKEQDILLRSRAEIENLRRRTEQDVEKAHKFALEKFSKDILNTIDNLERALAT------ 147

Query: 100 NSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVP 159
               K +  +K+L +G+E+T +E++ST+ R+GV+ +    + FNP++HQA+  +P +   
Sbjct: 148 -PANKEDESVKALFDGVELTLKELVSTVGRFGVEAVGVVGEAFNPDLHQAISMQPAEGFE 206

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
            N I  V+Q GY +N RV+RPA+V ++
Sbjct: 207 TNQISVVLQKGYTLNGRVIRPAMVMVA 233


>gi|119503071|ref|ZP_01625156.1| GrpE protein [marine gamma proteobacterium HTCC2080]
 gi|119461417|gb|EAW42507.1| GrpE protein [marine gamma proteobacterium HTCC2080]
          Length = 187

 Score =  114 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 52/173 (30%), Positives = 98/173 (56%), Gaps = 9/173 (5%)

Query: 18  NANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFA 77
               + + E +  ++  +      E +D  LR  A+  N++RR ++E   A+ +++ +F 
Sbjct: 24  TDEDAESIELNLDDVAAQLEADLAEAKDAALRAQADAVNVQRRAEQEVDKARKFALERFV 83

Query: 78  RDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDA 137
            ++L V DN+ RAL++A  D           +K ++EG+E+T++ ++  L+++GV+ ID 
Sbjct: 84  SELLPVVDNMERALEAAGTD---------EAVKPIVEGVELTQKSLIDALQKHGVETIDP 134

Query: 138 KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
             + F+P + QAM    +  V  NT+I V+Q GY +N R++RPA+V +SK   
Sbjct: 135 MGEPFDPQIAQAMSMVENPEVEPNTVIAVMQKGYQLNGRLVRPAMVMVSKAAE 187


>gi|254787225|ref|YP_003074654.1| heat shock protein GrpE [Teredinibacter turnerae T7901]
 gi|259647658|sp|C5BQ34|GRPE_TERTT RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|237683570|gb|ACR10834.1| co-chaperone GrpE [Teredinibacter turnerae T7901]
          Length = 190

 Score =  114 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 55/187 (29%), Positives = 102/187 (54%), Gaps = 9/187 (4%)

Query: 2   ETFMSEKNIDKE-KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           E F  ++  D   +  S+ +S TA +   +   E    +  E +++ LR  AEM N+RRR
Sbjct: 12  EEFAEDQQADVALEEASSDSSETAADVDLVARIEALEAELTEAKEQALRAAAEMHNVRRR 71

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
            +++ + A  + + KF  DML V+DN              +     + + ++ EG+++T 
Sbjct: 72  AEQDVEKAHKFGLEKFVSDMLPVADN--------LGRALEAAAAEGADMTAVTEGVDLTL 123

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + +M +L+++GV+ ++ + + FNP +HQAM    +     NT+I V Q GY ++ R++RP
Sbjct: 124 KSLMDSLKKHGVESVNPEGEPFNPELHQAMTAVENPDAEPNTVINVYQVGYTLHGRLVRP 183

Query: 181 ALVSISK 187
           A+V +SK
Sbjct: 184 AMVVVSK 190


>gi|148359598|ref|YP_001250805.1| heat shock protein GrpE [Legionella pneumophila str. Corby]
 gi|296107640|ref|YP_003619341.1| Molecular chaperone GrpE (heat shock protein) [Legionella
           pneumophila 2300/99 Alcoy]
 gi|166215269|sp|A5IDK9|GRPE_LEGPC RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|148281371|gb|ABQ55459.1| heat shock protein GrpE [Legionella pneumophila str. Corby]
 gi|295649542|gb|ADG25389.1| Molecular chaperone GrpE (heat shock protein) [Legionella
           pneumophila 2300/99 Alcoy]
          Length = 199

 Score =  114 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 52/162 (32%), Positives = 88/162 (54%), Gaps = 10/162 (6%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
            +       +  ++ E  +K +R +AE+EN+RRR +RE  +A  Y + K    +L V D+
Sbjct: 48  TALEEQLTLAEQKAHENWEKSVRALAELENVRRRMEREVANAHKYGVEKLISALLPVVDS 107

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNM 146
           L +AL  A  +             S+ EG+E+T +  +  L+++ V++ID   Q F+P  
Sbjct: 108 LEQALQLADKNSDP----------SMHEGLELTMKLFLDALQKFDVEQIDPLGQTFDPQQ 157

Query: 147 HQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           H+AM  +P    P N++I V Q GY +++RV+RPA V +S  
Sbjct: 158 HEAMSMQPAPGAPPNSVITVFQKGYKLSDRVIRPARVIVSTK 199


>gi|225718608|gb|ACO15150.1| GrpE protein homolog, mitochondrial precursor [Caligus clemensi]
          Length = 201

 Score =  114 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 53/181 (29%), Positives = 96/181 (53%), Gaps = 11/181 (6%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           + D     S + S   E     +   E   ++ +  DKY R IAE EN+ +R  ++  DA
Sbjct: 31  STDSTNTESESVSEHPEVIQMSSEIAELKEKNSDLLDKYRRSIAENENMGKRLSKQIDDA 90

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
           + + I  F +D+L VSD LS+A+++ P D +            + +G+ +T  +++   +
Sbjct: 91  KVFGIQSFCKDLLDVSDVLSKAVETLPRDASPD----------IRDGMMLTESQLLQVFK 140

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDT-VPANTIIKVVQDGYAINERVLRPALVSISK 187
           R+G+ K +  ++KF+PN H+A F+ P    V  N ++ V + G+ +  R +RPA+V +SK
Sbjct: 141 RHGLVKENPLNEKFDPNKHEAAFQIPAPEGVETNIVLDVQKVGFILQGRTIRPAVVGVSK 200

Query: 188 G 188
            
Sbjct: 201 K 201


>gi|114762205|ref|ZP_01441673.1| co-chaperone GrpE [Pelagibaca bermudensis HTCC2601]
 gi|114545229|gb|EAU48232.1| co-chaperone GrpE [Roseovarius sp. HTCC2601]
          Length = 185

 Score =  114 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 60/165 (36%), Positives = 97/165 (58%), Gaps = 10/165 (6%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
            +E    +    + +EF+D+++R +A+ EN R+R D+++++AQ Y  ++ ARD+L V DN
Sbjct: 29  DTEAAEIDALRAERDEFKDRFMRALADAENARKRADKDRREAQQYGGSRLARDLLPVYDN 88

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPN 145
           L RAL  A  + A           +LIEGIE+T RE+ +T  ++G+  I  +   KF+P 
Sbjct: 89  LHRALGVAREENAAD---------ALIEGIELTLRELTNTFSKHGMTTISPQVGDKFDPQ 139

Query: 146 MHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
            H+AMFE P     A  II+V  +G+ + +R+LRPA V +S    
Sbjct: 140 QHEAMFEAPVPGTKAGEIIQVSAEGFYLYDRLLRPAQVGVSSMPA 184


>gi|91225097|ref|ZP_01260319.1| GrpE [Vibrio alginolyticus 12G01]
 gi|91190040|gb|EAS76311.1| GrpE [Vibrio alginolyticus 12G01]
          Length = 219

 Score =  114 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 56/168 (33%), Positives = 98/168 (58%), Gaps = 8/168 (4%)

Query: 20  NSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARD 79
           + + A+          S  + +E +D  LR  AE+EN+RRRT++E   A+ +++ KFA +
Sbjct: 60  DETDAKIAQLEAALLSSEAKVKEQQDAVLRSKAEVENMRRRTEQEIDKARKFALNKFAEE 119

Query: 80  MLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKD 139
           +L V DNL RA+ +A  +           +K  +EG+E+T +  +  + ++G+K I+ + 
Sbjct: 120 LLPVIDNLERAIQAADTE--------NETVKPFLEGVELTHKTFVDVVAKFGLKAINPEG 171

Query: 140 QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           + FNP  HQAM  +      +NT++ V+Q GY +N RV+RPA+V ++K
Sbjct: 172 EAFNPEFHQAMSIQESPDHESNTVMFVMQKGYELNGRVIRPAMVMVAK 219


>gi|264677148|ref|YP_003277054.1| GrpE protein [Comamonas testosteroni CNB-2]
 gi|262207660|gb|ACY31758.1| GrpE protein [Comamonas testosteroni CNB-2]
          Length = 181

 Score =  114 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 63/193 (32%), Positives = 97/193 (50%), Gaps = 21/193 (10%)

Query: 5   MSEKNIDKEKNPSNANSS--------TAEEKSEINIPEESLNQSEEFRDKYLRVIAEMEN 56
           M+E +     N ++            + E        EE   +S +  D+YLR  A+ EN
Sbjct: 1   MTENHNPNTINDASPEELEAALAANASDELGRLQAELEELKAKSADLADQYLRAKADAEN 60

Query: 57  LRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGI 116
           +RRR + E   A+ + I  FA  +L V D+L  AL               +  + L EG 
Sbjct: 61  MRRRAEEEVAKARKFGIESFAESLLPVIDSLDAALAI-----------QNATPEQLREGS 109

Query: 117 EMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINE 175
           + T R++ S LER  V  I+    +KF+P+ HQA+   P    PANT++ V+Q GY I +
Sbjct: 110 DATLRQLNSALERNKVLAINPAAGEKFDPHHHQAISMVP-ADQPANTVVAVLQKGYVIAD 168

Query: 176 RVLRPALVSISKG 188
           R+LRPALV++++G
Sbjct: 169 RILRPALVTVAQG 181


>gi|226941656|ref|YP_002796730.1| heat shock protein GrpE [Laribacter hongkongensis HLHK9]
 gi|226716583|gb|ACO75721.1| GrpE [Laribacter hongkongensis HLHK9]
          Length = 185

 Score =  114 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 53/179 (29%), Positives = 80/179 (44%), Gaps = 11/179 (6%)

Query: 12  KEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
           KE     A     E         E   +  E +D + R  AE EN RRR+  E   A  Y
Sbjct: 18  KETAAPEAGELIPETDEAQARIAELEAEVAELKDLFARARAETENQRRRSQEEVIAAGKY 77

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
           +I KFA+++L V D L  AL     ++   +   +  LK L+   E              
Sbjct: 78  AIGKFAQELLPVRDCLEMALMDQSGNVEAMKMGVDMTLKQLVGAFEKV----------NL 127

Query: 132 VKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
            +       + +P+ HQAM  EP   +  NT+++V+Q GY + +RVLRPA+V ++  K 
Sbjct: 128 TEIAPVAGDRLDPHRHQAMSMEP-ADLEPNTVVRVMQKGYLLADRVLRPAMVIVAAPKA 185


>gi|15240475|ref|NP_200331.1| co-chaperone grpE protein, putative [Arabidopsis thaliana]
 gi|9758117|dbj|BAB08589.1| chaperone GrpE-like protein [Arabidopsis thaliana]
 gi|14596129|gb|AAK68792.1| chaperone GrpE-like protein [Arabidopsis thaliana]
 gi|20148445|gb|AAM10113.1| chaperone GrpE-like protein [Arabidopsis thaliana]
 gi|332009216|gb|AED96599.1| co-chaperone GrpE family protein [Arabidopsis thaliana]
          Length = 302

 Score =  114 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 58/206 (28%), Positives = 102/206 (49%), Gaps = 7/206 (3%)

Query: 2   ETFMSEKNIDKEKNPSNA--NSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRR 59
           E     K  D E +  +   +        + ++ +       E +DK+LR  AE +NL  
Sbjct: 97  ENVEVGKATDAEIDFDDLSRDDLVKLVSEKEDLLKVQQKDIMEMKDKFLRTYAEQQNLMD 156

Query: 60  RTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPL-----DLANSEKKSESVLKSLIE 114
           RT+R  + A+ +++  FA  +L V+DNL RA           D +     +  +LK+L+E
Sbjct: 157 RTNRNAESAKKFAVQNFATSLLDVADNLERASSVVKESFSKIDTSKDLAGATPLLKNLLE 216

Query: 115 GIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAIN 174
           G+EMT +++     + G+ K D  ++ FNPN H A+F+ P  + P  TI  V++ GY++ 
Sbjct: 217 GVEMTEKQLAEVFRKAGLVKEDPLNEPFNPNRHNAVFQVPDASKPKGTIAHVLKSGYSLY 276

Query: 175 ERVLRPALVSISKGKTQNPTEEKKET 200
           +RV+RPA V ++         ++   
Sbjct: 277 DRVIRPAEVGVTCAVENQEGGKESAA 302


>gi|114563956|ref|YP_751470.1| GrpE protein [Shewanella frigidimarina NCIMB 400]
 gi|122299141|sp|Q07ZD3|GRPE_SHEFN RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|114335249|gb|ABI72631.1| GrpE protein [Shewanella frigidimarina NCIMB 400]
          Length = 201

 Score =  114 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 58/194 (29%), Positives = 104/194 (53%), Gaps = 8/194 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E    E  +D+         +    +    +  ES     E +D  +R  AE +N+R R 
Sbjct: 15  EAVTPEIVVDEASLMDELTQANFRIEELEQLLAESETALAERKDVEMRAAAETQNIRTRA 74

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
            ++ + A+ +++ KFA ++L V DN+ RAL              +   K++ EG+E+T +
Sbjct: 75  AKDVEQARKFALEKFANELLPVIDNMERALQ--------GTNPEDEATKAIYEGVELTMK 126

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
             ++++E++GV +++ + Q FNP  HQA+  +P    PANT++ V+Q GY +N+R+LRPA
Sbjct: 127 GFLTSVEKFGVTQVNPQGQAFNPEHHQAIGMQPSAEYPANTVMMVMQKGYLLNDRLLRPA 186

Query: 182 LVSISKGKTQNPTE 195
           +V +S+G      E
Sbjct: 187 MVMVSQGGGSVDVE 200


>gi|33864559|ref|NP_896118.1| heat shock protein GrpE [Synechococcus sp. WH 8102]
 gi|52782910|sp|Q7UA77|GRPE_SYNPX RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|33632082|emb|CAE06538.1| putative heat shock protein GrpE [Synechococcus sp. WH 8102]
          Length = 218

 Score =  114 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 40/187 (21%), Positives = 84/187 (44%), Gaps = 8/187 (4%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
             E    +     +        +   +  +    + E  + +Y+R+ A+ +N R+R  R+
Sbjct: 25  EPEVMSTETPAEGSLTDPAERLQQLEHELQTLKQEHETLQSQYMRIAADFDNFRKRQSRD 84

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
           ++D +   +     ++L V DN  RA      +            ++L    +   ++++
Sbjct: 85  QEDIRQQLVCSTLSEILPVVDNFERARQQLNPE--------SEEAQALHRSYQGLYKQLV 136

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
             L++ GV +++   Q F+P +H+A+  E     P + +I+ +Q GY +N +VLR ALV 
Sbjct: 137 DVLKQQGVARMEVVGQLFDPTLHEAVLREESTEQPEDVVIEELQRGYHLNGKVLRHALVK 196

Query: 185 ISKGKTQ 191
           +S G   
Sbjct: 197 VSMGPGP 203


>gi|110677818|ref|YP_680825.1| GrpE protein HSP-70 cofactor, putative [Roseobacter denitrificans
           OCh 114]
 gi|109453934|gb|ABG30139.1| GrpE protein HSP-70 cofactor, putative [Roseobacter denitrificans
           OCh 114]
          Length = 187

 Score =  114 bits (286), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 53/160 (33%), Positives = 98/160 (61%), Gaps = 8/160 (5%)

Query: 32  IPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRAL 91
             E+   + ++ +D+++R +A+ EN R+R++R++++A++Y  +K +RDML V DN+ RAL
Sbjct: 34  EVEQLRAERDQLKDRFMRALADAENARKRSERDRREAENYGGSKLSRDMLPVYDNMKRAL 93

Query: 92  DSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK-KIDAKDQKFNPNMHQAM 150
           ++   +             +L+EGIE+T RE++S  +++G++        +F+P  HQAM
Sbjct: 94  EAVTDEQR-------EQNAALLEGIELTMRELLSVFKKHGIEIVAPEVGDRFDPQYHQAM 146

Query: 151 FEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           FE P     A  II+V  +G+ +++R+LRPA V +S    
Sbjct: 147 FEAPLPGTKAGDIIQVSAEGFMLHDRLLRPAQVGVSSTPA 186


>gi|50419777|ref|XP_458420.1| DEHA2C16830p [Debaryomyces hansenii CBS767]
 gi|52782854|sp|Q6BTP9|GRPE_DEBHA RecName: Full=GrpE protein homolog, mitochondrial; Flags: Precursor
 gi|49654086|emb|CAG86502.1| DEHA2C16830p [Debaryomyces hansenii]
          Length = 243

 Score =  114 bits (286), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 58/189 (30%), Positives = 95/189 (50%), Gaps = 4/189 (2%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
           +   E   +  K    A    +E         +   +  + ++ Y R IA+  NL+  T 
Sbjct: 59  SQEPETAAETNKEAEGAKVEVSEIDELKAKLTKKDRELADMKNHYARAIADFRNLQESTK 118

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
            EK+ A+ +++ KFA+D+L   DN   AL++   D       + S +K+L +G++MTR  
Sbjct: 119 LEKQKARDFALQKFAKDLLESVDNFDLALNAVKEDTLK----NNSEVKNLYDGVDMTRNV 174

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
              TL R+G++K+D   ++F+PN H+A FE         T+  V Q+GY +N RVLRPA 
Sbjct: 175 FEKTLARHGIEKVDPIGEQFDPNQHEATFEIAQPDKEPGTVFHVQQNGYTLNSRVLRPAK 234

Query: 183 VSISKGKTQ 191
           V + K    
Sbjct: 235 VGVVKDAEN 243


>gi|294508387|ref|YP_003572445.1| Molecular chaperone GrpE (heat shock protein) [Salinibacter ruber
           M8]
 gi|294344715|emb|CBH25493.1| Molecular chaperone GrpE (heat shock protein) [Salinibacter ruber
           M8]
          Length = 223

 Score =  114 bits (286), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 56/192 (29%), Positives = 97/192 (50%), Gaps = 2/192 (1%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           ++       P +  + T E ++     +    + EE  ++ LR  AE+EN+RRR DREKK
Sbjct: 33  DEEGTASDLPDDVEALTDEVEALREEVDGLKAEREELNERLLRKAAELENVRRRMDREKK 92

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
                        ML V D+  R+LD+A     + +   ES  ++L  G+EM  R+    
Sbjct: 93  RRHVAGKETVLESMLEVLDDFERSLDAAQDLDVSEDP--ESAYETLKGGVEMVYRKFQDQ 150

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           L+  GV+ I+A+ Q F+  +H+AM  +P D V    +++ VQ GY + +RVLR + V ++
Sbjct: 151 LQSLGVEPIEAEGQPFDEQLHEAMMRQPSDDVEPGNVLQEVQKGYTMGDRVLRHSRVVVA 210

Query: 187 KGKTQNPTEEKK 198
              +++ +    
Sbjct: 211 AEPSESGSAADS 222


>gi|255008530|ref|ZP_05280656.1| putative GrpE protein (HSP70 cofactor) [Bacteroides fragilis
           3_1_12]
          Length = 245

 Score =  114 bits (286), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 51/179 (28%), Positives = 93/179 (51%), Gaps = 10/179 (5%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +   + +  +  ++    E+      EE+ +Q E+ +DKYLR+ AE +N R+RT +EK +
Sbjct: 74  EGQSQNEETTEESTPLTAEEKLEKELEEAHSQIEDQKDKYLRLSAEFDNYRKRTIKEKAE 133

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
                  K  + +L V D++ RAL +          ++ + + ++ EG+E+   + +S L
Sbjct: 134 LILNGGEKSIKSILPVIDDMERALTT---------METATDVAAVKEGVELIYNKFLSIL 184

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVP-ANTIIKVVQDGYAINERVLRPALVSI 185
            + GVK I+ KDQ  + + H+A+   P  T      I+  VQ GY +N +V+R A V +
Sbjct: 185 SQDGVKVIETKDQPLDTDYHEAIAVIPAPTEEQKGKILDCVQTGYTLNGKVIRHAKVVV 243


>gi|16124409|ref|NP_418973.1| grpE protein [Caulobacter crescentus CB15]
 gi|992695|gb|AAB01516.1| GrpE [Caulobacter crescentus CB15]
 gi|13421267|gb|AAK22141.1| grpE protein [Caulobacter crescentus CB15]
          Length = 198

 Score =  114 bits (286), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 70/194 (36%), Positives = 108/194 (55%), Gaps = 8/194 (4%)

Query: 25  EEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVS 84
           E        E    +  + +++ LR  AE EN +RR +RE  DA++Y+I KFARD+L  +
Sbjct: 4   EADDAAQEIEALKLEVAQLKEQALRYAAEAENTKRRAEREMNDARAYAIQKFARDLLGAA 63

Query: 85  DNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDA-KDQKFN 143
           DNL RA   +P D  +        +K+ I G+EMT +E+ S  ER G+KKID  K  KF+
Sbjct: 64  DNLGRATAHSPKDSTDP------AVKNFIIGVEMTEKELQSAFERNGLKKIDPAKGDKFD 117

Query: 144 PNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI-SKGKTQNPTEEKKETIE 202
           P++HQA+ E+P   V A  ++ V+Q GY +  R++RPA+V++ +KG T   + +      
Sbjct: 118 PHLHQAVTEQPSTEVAAGGVLMVMQAGYELMGRLVRPAMVAVAAKGSTGPASPDAPAASA 177

Query: 203 QPSPLDIEERNKTQ 216
            P      E + T 
Sbjct: 178 NPYAGAAAEGDSTG 191


>gi|86610353|ref|YP_479115.1| heat shock protein GrpE [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|123765407|sp|Q2JH51|GRPE_SYNJB RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|86558895|gb|ABD03852.1| co-chaperone GrpE [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 237

 Score =  114 bits (286), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 51/210 (24%), Positives = 93/210 (44%), Gaps = 9/210 (4%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEIN-IPEESLNQSEEFRDKYLRVIAEMENLRR 59
           +E   +E      +  +  +    E   ++    E    Q +E  D YLR+ A+ EN RR
Sbjct: 26  LEDSEAEAGTSSGETAAEPSPDPGEALKQLQHELEVVRQQLKEKEDAYLRLYADFENYRR 85

Query: 60  RTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMT 119
           RT REK++       KF  ++L V D+  RA     L+     +   S         +  
Sbjct: 86  RTQREKEEFSQKERQKFVLEILPVVDSFERAQQQLKLETDRERELHNS--------YQSV 137

Query: 120 RREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
            R ++  L++ GV ++ +  Q F+PN+H+A+  +P    P + +    Q GY + + V+R
Sbjct: 138 YRLLVECLKKMGVSRMKSVGQPFDPNLHEAIARQPSPDYPEDVVAVEYQPGYKLGDLVIR 197

Query: 180 PALVSISKGKTQNPTEEKKETIEQPSPLDI 209
            A+V++S G   +      +   +  P + 
Sbjct: 198 HAMVAVSAGSPSSEPSPPAQATIEAGPENT 227


>gi|89067433|ref|ZP_01154946.1| co-chaperone GrpE [Oceanicola granulosus HTCC2516]
 gi|89047002|gb|EAR53056.1| co-chaperone GrpE [Oceanicola granulosus HTCC2516]
          Length = 206

 Score =  114 bits (286), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 61/183 (33%), Positives = 110/183 (60%), Gaps = 8/183 (4%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
               E   S+  +   +  +  +  E    + ++ +D+++R +A+ EN R+R +R++++A
Sbjct: 30  ESAPEAQESDEAAPAGDAAAGADELEALRAERDDLKDRFVRALADAENTRKRAERDRREA 89

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
           ++Y  +K ARDML V DNLSRAL++A  +          + K+L+EG+E+T RE+++  +
Sbjct: 90  ETYGGSKLARDMLPVYDNLSRALETATEEQK-------EISKALLEGVELTMRELLNVFK 142

Query: 129 RYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           ++G++ I  +   KF+P MHQAMFE P     A  II+V+  G+ +++R+LRPA V +S 
Sbjct: 143 KHGIEPISPEVGDKFDPQMHQAMFEAPVPDTKAGDIIQVMATGFLLHDRLLRPAQVGVSS 202

Query: 188 GKT 190
              
Sbjct: 203 TPA 205


>gi|163732972|ref|ZP_02140416.1| GrpE protein HSP-70 cofactor, putative [Roseobacter litoralis Och
           149]
 gi|161393507|gb|EDQ17832.1| GrpE protein HSP-70 cofactor, putative [Roseobacter litoralis Och
           149]
          Length = 187

 Score =  114 bits (286), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 59/193 (30%), Positives = 111/193 (57%), Gaps = 10/193 (5%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPE--ESLNQSEEFRDKYLRVIAEMENLR 58
           M    +E  +D  ++      +   E+ +    E  +   + ++ +D+++R +A+ EN R
Sbjct: 1   MAEPKNEDFLDDIEDAEADAYAEEMEEIDEEALEVEQLRAERDQLKDRFMRALADAENAR 60

Query: 59  RRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEM 118
           +R+DR++++A++Y  +K +RDML V DN+ RAL++   +             +L+EGIE+
Sbjct: 61  KRSDRDRREAENYGGSKLSRDMLPVYDNMKRALEAVTDEQR-------EQNAALLEGIEL 113

Query: 119 TRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERV 177
           T RE++S  +++G++ I  +   +F+P  HQAMFE P     A  II+V  +G+ +++R+
Sbjct: 114 TMRELLSVFKKHGIEVIAPEVGDRFDPQHHQAMFEAPVPGTRAGDIIQVAAEGFMLHDRL 173

Query: 178 LRPALVSISKGKT 190
           LRPA V +S    
Sbjct: 174 LRPAQVGVSSTPA 186


>gi|309789618|ref|ZP_07684199.1| GrpE protein [Oscillochloris trichoides DG6]
 gi|308228354|gb|EFO82001.1| GrpE protein [Oscillochloris trichoides DG6]
          Length = 185

 Score =  114 bits (286), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 54/195 (27%), Positives = 97/195 (49%), Gaps = 21/195 (10%)

Query: 5   MSEKNIDKEKNPS-----------NANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAE 53
           MSE+ I+ +   +              SS A          ++  Q+ EF+D++LR  A+
Sbjct: 1   MSEEQINPQAENNGHAAAEVVDAAVGQSSGANLAELEARLAKAEAQAAEFKDQWLRATAD 60

Query: 54  MENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLI 113
            +N +RR+D E+ +    + A     +L V D+  RA+ + P ++A S            
Sbjct: 61  YKNFKRRSDTERAELIRSAGAGVLLKLLPVMDDFDRAIANIPPEIAESAW---------W 111

Query: 114 EGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAI 173
            G ++  +++ + LE  GVK I A   +F+PN+H+A+  E         +++ +Q GY +
Sbjct: 112 GGTQLIAQKLRTLLESEGVKAIPAVGTEFDPNVHEAVLYEDAAG-QDGMVVEELQRGYKL 170

Query: 174 NERVLRPALVSISKG 188
           +ERVLRPA+V + +G
Sbjct: 171 HERVLRPAMVKVGRG 185


>gi|154174607|ref|YP_001408034.1| co-chaperone GrpE [Campylobacter curvus 525.92]
 gi|166215257|sp|A7GXU2|GRPE_CAMC5 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|112802906|gb|EAU00250.1| co-chaperone GrpE [Campylobacter curvus 525.92]
          Length = 179

 Score =  114 bits (286), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 61/185 (32%), Positives = 97/185 (52%), Gaps = 9/185 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E    +   D +      +S   +  S+     E  N+  E  DKY R  AE EN+++R 
Sbjct: 3   EEIKEQNVQDAQNENLAPDSVNFDGLSDAAKVAELENKLNELTDKYYRANAEFENIKKRF 62

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           ++EK D  SY+  KFARD+L V D L  A +  P D        +   K++ EG+ +T  
Sbjct: 63  EKEKTDIASYANEKFARDLLPVIDALEIAANFDPDD--------DEFAKNVKEGVLITIN 114

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           +     E++G+ +ID    +F+PN+H A+     +   +  I++V+Q GY IN RVLRPA
Sbjct: 115 QFKKCFEKHGMSEIDTSG-EFDPNVHNAVLRVDSEDHTSGQIVQVMQKGYIINGRVLRPA 173

Query: 182 LVSIS 186
           +VS++
Sbjct: 174 MVSVA 178


>gi|308050611|ref|YP_003914177.1| GrpE protein [Ferrimonas balearica DSM 9799]
 gi|307632801|gb|ADN77103.1| GrpE protein [Ferrimonas balearica DSM 9799]
          Length = 204

 Score =  114 bits (286), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 61/201 (30%), Positives = 111/201 (55%), Gaps = 12/201 (5%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEE----FRDKYLRVIAEMENL 57
           E   + +    E++      +       I   E  L ++ +     +D  +R  AE+EN+
Sbjct: 12  EEIEATETDAVEQSAEEQVHAEDAAAERIAELEAELAKAHDTIAGQKDSVVRAAAEVENI 71

Query: 58  RRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIE 117
           RRRT ++ + A  +++ KFA ++L V DNL RAL+ +  D        +  +K ++EG+E
Sbjct: 72  RRRTAQDVEKAHKFALEKFANELLPVIDNLERALEVSNSD--------DEAIKPMLEGVE 123

Query: 118 MTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERV 177
           +T + M++++ ++G++ +D   + FNP  HQA+   P +   ANT+I V+Q GYA+N R+
Sbjct: 124 LTLKSMLASVAKFGIEVVDPVGEAFNPEFHQAISMLPSEEFAANTVISVMQKGYALNGRL 183

Query: 178 LRPALVSISKGKTQNPTEEKK 198
           LRPA+V +S+G      + + 
Sbjct: 184 LRPAMVIVSRGSDAPSVDTQA 204


>gi|319760664|ref|YP_004124602.1| protein grpE [Candidatus Blochmannia vafer str. BVAF]
 gi|318039378|gb|ADV33928.1| protein grpE [Candidatus Blochmannia vafer str. BVAF]
          Length = 196

 Score =  114 bits (286), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 57/182 (31%), Positives = 101/182 (55%), Gaps = 9/182 (4%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR-DKYLRVIAEMENLRRRTDREKKD 67
             +  ++ SN N+    +  +I   E  L+Q +E   D  LR+ AE+EN+RRR  +E + 
Sbjct: 22  KEESSESTSNINNIIDLKNDQIIKLELQLSQLKEHERDTVLRLQAEIENIRRRNIQEIEK 81

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A  +++ +F  ++L V DNL RAL            ++ +    ++EGI++T +  + T+
Sbjct: 82  AHKFALERFVAELLPVIDNLERALGMVD--------RTNNSFSMIVEGIDLTLKSFLDTV 133

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            ++GV+ I      FNP +HQA+         AN ++ ++Q GY +N R++RPA+V++SK
Sbjct: 134 YKFGVESIHEIHVPFNPEIHQAISTIESKECQANQVLTIIQKGYLLNGRLIRPAMVTVSK 193

Query: 188 GK 189
            K
Sbjct: 194 SK 195


>gi|154310391|ref|XP_001554527.1| hypothetical protein BC1G_07115 [Botryotinia fuckeliana B05.10]
 gi|150851447|gb|EDN26640.1| hypothetical protein BC1G_07115 [Botryotinia fuckeliana B05.10]
          Length = 242

 Score =  114 bits (286), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 61/188 (32%), Positives = 97/188 (51%), Gaps = 6/188 (3%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +   K+  P+        E       E    +  E +DK LR IAE  NL+ RT R+ + 
Sbjct: 55  EPQAKKDEPAAEKKDAEAEDPSKKALEAKDKEILELKDKLLRSIAEFRNLQERTKRDMQA 114

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDL----ANSEKKSESVLKSLIEGIEMTRREM 123
           A+ ++I KFA+D++   DN  RAL + P +     A    + +  L +L EG++MT   +
Sbjct: 115 AKDFAIQKFAKDLVDSVDNFDRALTTVPAEKLSVSAEERNEHQQDLITLHEGLKMTENIL 174

Query: 124 MSTLERYGVKKIDA--KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           MSTL+++G+++ D   + +KFNPN H+A F  P       T+    Q G+ +N R+LR A
Sbjct: 175 MSTLKKHGLERFDPSVESEKFNPNEHEATFMTPMAGKEDGTVFHTQQKGFKLNGRILRAA 234

Query: 182 LVSISKGK 189
            V + K  
Sbjct: 235 KVGVVKNP 242


>gi|83815828|ref|YP_446452.1| co-chaperone GrpE [Salinibacter ruber DSM 13855]
 gi|83757222|gb|ABC45335.1| co-chaperone GrpE [Salinibacter ruber DSM 13855]
          Length = 223

 Score =  114 bits (286), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 56/192 (29%), Positives = 97/192 (50%), Gaps = 2/192 (1%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           ++       P +  + T E ++     +    + EE  ++ LR  AE+EN+RRR DREKK
Sbjct: 33  DEEGTASDLPDDVEALTDEVEALREEVDGLKAEREELNERLLRKAAELENVRRRMDREKK 92

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
                        ML V D+  R+LD+A     + +   ES  ++L  G+EM  R+    
Sbjct: 93  RRHVAGKETVLESMLEVLDDFERSLDAAQDLDVSEDP--ESAYETLKGGVEMVYRKFQDQ 150

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           L+  GV+ I+A+ Q F+  +H+AM  +P D V    +++ VQ GY + +RVLR + V ++
Sbjct: 151 LQSLGVEPIEAEGQPFDEQLHEAMMRQPSDDVEPGNVLQEVQKGYTMGDRVLRHSRVVVA 210

Query: 187 KGKTQNPTEEKK 198
              +++ +    
Sbjct: 211 AEPSESGSAADS 222


>gi|54297953|ref|YP_124322.1| heat shock protein GrpE [Legionella pneumophila str. Paris]
 gi|81679429|sp|Q5X3M6|GRPE_LEGPA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|53751738|emb|CAH13160.1| Heat-shock protein GrpE(HSP-70 cofactor) [Legionella pneumophila
           str. Paris]
          Length = 199

 Score =  114 bits (286), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 55/188 (29%), Positives = 97/188 (51%), Gaps = 10/188 (5%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           +E  + E+ ID++              +       +  ++ E  +K +R +AE++N+RRR
Sbjct: 22  VENEILEEEIDEKSQHQEPALGHPSYTALEEQLTLAEQKAHENWEKSVRALAELDNVRRR 81

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
            +RE  +A  Y + K    +L V D+L +AL  A  +             S+ EG+E+T 
Sbjct: 82  MEREVANAHKYGVEKLISALLPVVDSLEQALQLADKNSDP----------SMHEGLELTM 131

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           +  +  L+++ V++ID   Q F+P  H+AM  +P    P N++I V Q GY +++RV+RP
Sbjct: 132 KLFLDALQKFDVEQIDPLGQTFDPQQHEAMSMQPAPGAPPNSVITVFQKGYKLSDRVIRP 191

Query: 181 ALVSISKG 188
           A V +S  
Sbjct: 192 ARVIVSTK 199


>gi|299530692|ref|ZP_07044107.1| heat shock protein GrpE [Comamonas testosteroni S44]
 gi|298721208|gb|EFI62150.1| heat shock protein GrpE [Comamonas testosteroni S44]
          Length = 181

 Score =  114 bits (285), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 62/193 (32%), Positives = 96/193 (49%), Gaps = 21/193 (10%)

Query: 5   MSEKNIDKEKNPSNANSS--------TAEEKSEINIPEESLNQSEEFRDKYLRVIAEMEN 56
           M+E +     N ++            + E        EE   +S +  D+YLR  A+ EN
Sbjct: 1   MTENHNPNTINDASPEELEAALAANASDELGRLQAELEELKAKSADLADQYLRAKADAEN 60

Query: 57  LRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGI 116
           +RRR + E   A+ + I  FA  +L V D+L  AL               +  + L EG 
Sbjct: 61  MRRRAEEEVAKARKFGIESFAESLLPVIDSLDAALAI-----------QNATPEQLREGS 109

Query: 117 EMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINE 175
           + T R++ S LER  V  I+    +KF+P+ HQA+   P    P NT++ V+Q GY I +
Sbjct: 110 DATLRQLNSALERNKVLAINPAAGEKFDPHHHQAISMVP-ADQPTNTVVAVLQKGYVIAD 168

Query: 176 RVLRPALVSISKG 188
           R+LRPALV++++G
Sbjct: 169 RILRPALVTVAQG 181


>gi|288922627|ref|ZP_06416804.1| GrpE protein [Frankia sp. EUN1f]
 gi|288346019|gb|EFC80371.1| GrpE protein [Frankia sp. EUN1f]
          Length = 198

 Score =  114 bits (285), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 47/203 (23%), Positives = 87/203 (42%), Gaps = 15/203 (7%)

Query: 20  NSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARD 79
            + +  E+ E     +   + E+ + + LR++A+ +N RRRT  E   A++    +    
Sbjct: 3   ENRSDAERPETAPAPDLAAELEQCQARNLRILADFDNYRRRTGLEIGAAKAAERDRVVLA 62

Query: 80  MLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKD 139
            + V D+L  AL  A  D             SL++G+    +  +  L   GV ++D + 
Sbjct: 63  WVPVLDHLELALSHADADPD-----------SLVDGVRGVYQLALDALRSSGVTRLDDET 111

Query: 140 QKFNPNMHQAMFEEPHDTV----PANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTE 195
             F+P  H+        +     PA T+++V++ GY  + RVLRPA V++S G       
Sbjct: 112 GAFDPTRHEVGAVVDSGSTPRPPPAGTVVEVLRPGYQADGRVLRPASVAVSAGPKPTNGA 171

Query: 196 EKKETIEQPSPLDIEERNKTQTK 218
           +      + S  +        T+
Sbjct: 172 KVTNGPRRDSGSEPGNGRGPDTE 194


>gi|260431974|ref|ZP_05785945.1| co-chaperone GrpE [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415802|gb|EEX09061.1| co-chaperone GrpE [Silicibacter lacuscaerulensis ITI-1157]
          Length = 187

 Score =  114 bits (285), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 59/165 (35%), Positives = 97/165 (58%), Gaps = 8/165 (4%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
             E    +    + +E RDK++R +A+ EN R+R DR +++A+ Y  +K ARDML V D+
Sbjct: 29  SEEALELDALKAERDELRDKFMRALADAENARKRGDRARREAEQYGGSKLARDMLPVYDS 88

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPN 145
           + RAL++A  +          V   LIEG+E+T R +    +++G++ I  +   KF+PN
Sbjct: 89  MKRALEAASDEQR-------EVAAGLIEGVELTMRMLRDVFKKHGIEVIAPEVGDKFDPN 141

Query: 146 MHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           +H+AMFE P     A  II+V  +G+ +++R+LRPA V +S    
Sbjct: 142 LHEAMFEAPVPGTKAGEIIQVSAEGFMLHDRLLRPAQVGVSSTPA 186


>gi|52842243|ref|YP_096042.1| heat shock protein GrpE [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
 gi|81680426|sp|Q5ZTY2|GRPE_LEGPH RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|52629354|gb|AAU28095.1| heat shock protein GrpE [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
          Length = 200

 Score =  114 bits (285), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 52/162 (32%), Positives = 88/162 (54%), Gaps = 10/162 (6%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
            +       +  ++ E  +K +R +AE+EN+RRR +RE  +A  Y + K    +L V D+
Sbjct: 49  TALEEQLTLAEQKAHENWEKSVRALAELENVRRRMEREVANAHKYGVEKLISALLPVVDS 108

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNM 146
           L +AL  A  +             S+ EG+E+T +  +  L+++ V++ID   Q F+P  
Sbjct: 109 LEQALQLADKNSDP----------SMHEGLELTMKLFLDALQKFDVEQIDPLGQTFDPQQ 158

Query: 147 HQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           H+AM  +P    P N++I V Q GY +++RV+RPA V +S  
Sbjct: 159 HEAMSMQPAPGAPPNSVITVFQKGYKLSDRVIRPARVIVSTK 200


>gi|296812551|ref|XP_002846613.1| grpE [Arthroderma otae CBS 113480]
 gi|238841869|gb|EEQ31531.1| grpE [Arthroderma otae CBS 113480]
          Length = 243

 Score =  114 bits (285), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 55/172 (31%), Positives = 95/172 (55%), Gaps = 7/172 (4%)

Query: 24  AEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSV 83
           +E  +     E    +  + +DKYLR +A+  NL+ RT R+ + A++++I KFA D++  
Sbjct: 71  SELDTLKKDLEAREKEVVDLKDKYLRSVADFRNLQERTRRDIEAARTFAIQKFAGDLIES 130

Query: 84  SDNLSRALDSAPLDL-ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKD--- 139
            DNL RAL++ P +    +  K    +  L  G++MT   +M+TL+++GV + D  +   
Sbjct: 131 IDNLERALEAVPAEKVDAANAKENKDVYELYSGLKMTEGILMNTLKKHGVVRFDPSELID 190

Query: 140 ---QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
              QKF+P+ H+A+F  P +      I+ V   G+ +N R+LR A V + K 
Sbjct: 191 GQPQKFDPSRHEALFMSPMEGKQDGEILHVQNKGFTLNGRILRAAKVGVVKN 242


>gi|3122168|sp|O32481|GRPE_LEGPN RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|2522263|dbj|BAA22782.1| GrpE [Legionella pneumophila]
          Length = 199

 Score =  114 bits (285), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 52/162 (32%), Positives = 88/162 (54%), Gaps = 10/162 (6%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
            +       +  ++ E  +K +R +AE+EN+RRR +RE  +A  Y + K    +L V D+
Sbjct: 48  TALEEQLTLAEQKAHENWEKSVRALAELENVRRRMEREVANAHKYGVEKLISALLPVVDS 107

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNM 146
           L +AL  A  +             S+ EG+E+T +  +  L+++ V++ID   Q F+P  
Sbjct: 108 LEQALQLADKNSDP----------SMHEGLELTMKLFLDALQKFDVEQIDPLGQTFDPQQ 157

Query: 147 HQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           H+AM  +P    P N++I V Q GY +++RV+RPA V +S  
Sbjct: 158 HEAMSMQPAPGAPPNSVITVFQKGYKLSDRVIRPARVIVSTK 199


>gi|147677212|ref|YP_001211427.1| molecular chaperone GrpE [Pelotomaculum thermopropionicum SI]
 gi|146273309|dbj|BAF59058.1| molecular chaperone GrpE [Pelotomaculum thermopropionicum SI]
          Length = 206

 Score =  114 bits (285), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 43/172 (25%), Positives = 89/172 (51%), Gaps = 11/172 (6%)

Query: 21  SSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDM 80
           +  A+      +  E   +++++ ++ +R+ A+ EN RRRT ++ ++   Y+  +  R +
Sbjct: 46  AEEADPGVLQKLLSEQTARADDYYNRLVRLQADFENFRRRTRQDMENFYKYASEQLIRAL 105

Query: 81  LSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQ 140
           L V DN  RAL +               + S   G+EM  R+++  L   G+  I A  +
Sbjct: 106 LPVLDNFERALAA-----------EGDTIDSFKAGVEMIYRQLLDVLAAEGLAAIPACGE 154

Query: 141 KFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQN 192
           +F+P  H+A+ +E     P NT+I+ ++ GY + ++V+RP++V +++     
Sbjct: 155 QFDPVRHEAVLQEESGDYPDNTVIEELRRGYFLKDKVIRPSMVKVARTSQNK 206


>gi|221136663|ref|XP_002167866.1| PREDICTED: similar to predicted protein, partial [Hydra
           magnipapillata]
          Length = 143

 Score =  114 bits (285), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 50/146 (34%), Positives = 93/146 (63%), Gaps = 4/146 (2%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
            EF+DKY+R +AE EN+RRR  +   DA+ +++  F++D+L V+D L +A+ S P+D   
Sbjct: 1   AEFKDKYIRSLAECENVRRRGVKMVSDAKLFAVQGFSKDLLEVADILEKAMLSVPIDELQ 60

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
                  +LK+L +G+ MT   +     ++G++K++  ++KF+PN H+A+F++      +
Sbjct: 61  K----NELLKNLYDGLVMTEAHLQKVFLKHGLQKVNPINEKFDPNFHEALFQKSIPGKAS 116

Query: 161 NTIIKVVQDGYAINERVLRPALVSIS 186
            T+++V + GY +N R +R ALV ++
Sbjct: 117 GTVVEVNKPGYLLNGRPVRAALVGVA 142


>gi|71892317|ref|YP_278051.1| heat shock protein 24 [Candidatus Blochmannia pennsylvanicus str.
           BPEN]
 gi|123734144|sp|Q492C7|GRPE_BLOPB RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|71796423|gb|AAZ41174.1| heat shock protein 24 [Candidatus Blochmannia pennsylvanicus str.
           BPEN]
          Length = 195

 Score =  114 bits (285), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 51/174 (29%), Positives = 96/174 (55%), Gaps = 9/174 (5%)

Query: 17  SNANSSTAEEKSEINIPEESLNQSEEFR-DKYLRVIAEMENLRRRTDREKKDAQSYSIAK 75
           S  ++    +  +I   +  L Q +E   +  LR+ AE+EN+RRR  +E +    + + +
Sbjct: 30  STVDNVIDPKNDQIIKLKIQLAQLQEHERNTVLRLTAEIENIRRRNTQEIEKIHKFGLER 89

Query: 76  FARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI 135
           F  ++L V DNL R +  +            ++L ++IEGIE+T +  + T+ ++G+K I
Sbjct: 90  FIFELLPVIDNLERTMSISDNS--------NTLLSAIIEGIELTLKSFLDTVHKFGLKSI 141

Query: 136 DAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
              +  FNP +HQA+     +    N ++ ++Q GY +N R++RPA+V++S+ K
Sbjct: 142 YEINVPFNPEIHQAISIIESEDHKPNQVLTMIQKGYILNGRLIRPAMVTVSQSK 195


>gi|116492661|ref|YP_804396.1| molecular chaperone GrpE (heat shock protein) [Pediococcus
           pentosaceus ATCC 25745]
 gi|122265875|sp|Q03FR8|GRPE_PEDPA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|116102811|gb|ABJ67954.1| Molecular chaperone GrpE (heat shock protein) [Pediococcus
           pentosaceus ATCC 25745]
          Length = 190

 Score =  114 bits (285), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 59/186 (31%), Positives = 106/186 (56%), Gaps = 13/186 (6%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   +E + D E   ++  ++  +  + ++  ++   + +E  DKY+R  AE+ N+RRR 
Sbjct: 16  EATSTEGSTDVESTNNDDLTTETQATTALDDIKKVEAERDELSDKYIRAQAEIVNMRRRN 75

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           ++E+     Y   K A+ +L   DNL RAL              ES  + L++G++M + 
Sbjct: 76  EKEQASLIKYDGQKLAKAILPALDNLERALAV------------ESASEQLLKGVKMVQT 123

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEP-HDTVPANTIIKVVQDGYAINERVLRP 180
           +++  L+   V +I+A+ Q F+PNMHQA+   P  D  PA+T+++V+Q GY + +RVLRP
Sbjct: 124 DLLKALKENHVAEIEAEGQAFDPNMHQAVQTVPADDDHPADTVVQVLQKGYILKDRVLRP 183

Query: 181 ALVSIS 186
           A+V ++
Sbjct: 184 AMVIVA 189


>gi|315126867|ref|YP_004068870.1| nucleotide exchange factor [Pseudoalteromonas sp. SM9913]
 gi|315015381|gb|ADT68719.1| nucleotide exchange factor [Pseudoalteromonas sp. SM9913]
          Length = 203

 Score =  114 bits (285), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 59/188 (31%), Positives = 104/188 (55%), Gaps = 8/188 (4%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           ME  +       E++     S  AE        E +     + +D  +R  A+++N+RRR
Sbjct: 21  MEADVEAAVEAAEQHAEQEQSPEAEIAMLYAELEAAKQTIADQKDSVVRAAADVDNMRRR 80

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
             ++ + A  +++ KFA ++L V DNL RA++ +  +           LK L+EGI+MT 
Sbjct: 81  AAQDVEKAHKFALEKFANELLPVIDNLERAIEFSDKE--------NETLKPLLEGIDMTV 132

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           +     + ++GV+ ++ + ++FNP+ HQAM  +P + V  NT++ V+Q GY +N R+LRP
Sbjct: 133 KSFNDAVAKFGVEIVNPQGEQFNPDFHQAMSIQPSNDVTPNTVLAVMQKGYTLNGRLLRP 192

Query: 181 ALVSISKG 188
           A+V +SK 
Sbjct: 193 AMVMVSKA 200


>gi|251792990|ref|YP_003007716.1| heat shock protein GrpE [Aggregatibacter aphrophilus NJ8700]
 gi|247534383|gb|ACS97629.1| co-chaperone GrpE [Aggregatibacter aphrophilus NJ8700]
          Length = 191

 Score =  114 bits (285), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 58/168 (34%), Positives = 104/168 (61%), Gaps = 8/168 (4%)

Query: 20  NSSTAEEKSEINIPEESLNQ-SEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFAR 78
                E  + +   E  L + +++ +D  LR  AE++N+RRRT+++ + A  +++ KFA+
Sbjct: 30  EDPLEEAIARVQELEAQLAETAKKEQDLLLRTRAEIDNIRRRTEQDVEKAHKFALEKFAK 89

Query: 79  DMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
           D+L+  DNL RAL +            E  +K+L +G+E+T +E+++T+ R+GV+ + A 
Sbjct: 90  DILNTIDNLERALAT-------PRNTEEECVKALFDGVELTLKELLATVARFGVEPVGAV 142

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
            + FNP++HQA+  +P D   +N I  V+Q GY +N RV+RPA+V ++
Sbjct: 143 GETFNPDLHQAISMQPTDGFESNQITTVLQKGYLLNGRVIRPAMVMVA 190


>gi|224063162|ref|XP_002301021.1| predicted protein [Populus trichocarpa]
 gi|222842747|gb|EEE80294.1| predicted protein [Populus trichocarpa]
          Length = 273

 Score =  114 bits (285), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 39/191 (20%), Positives = 84/191 (43%), Gaps = 9/191 (4%)

Query: 16  PSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAK 75
            + A +   E    +        +    ++KY+R+ A+ +N R+R+D+E+ + +S +  +
Sbjct: 85  EAKAATIEKENHEFLQKVSSLSAEITSGKEKYIRLQADFDNFRKRSDKERVNIRSDAQGE 144

Query: 76  FARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI 135
               +L + D+  RA      +            K +    +   ++++  +    V  +
Sbjct: 145 VIESLLPMVDSFERAKQQIQPETEKE--------KKIDSSYQGIYKQLVDIMRNLQVAAV 196

Query: 136 DAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTE 195
               + F+P++H+A+  E         II+  + G+ I  R++RPA+V +S G     + 
Sbjct: 197 PTVGKPFDPSLHEAIAREESQEYKEGIIIQEFRRGFLIGNRLIRPAMVKVSSGPGNKKSS 256

Query: 196 EKKET-IEQPS 205
              ET  EQP+
Sbjct: 257 VGTETRAEQPA 267


>gi|149204368|ref|ZP_01881335.1| GrpE protein [Roseovarius sp. TM1035]
 gi|149142253|gb|EDM30300.1| GrpE protein [Roseovarius sp. TM1035]
          Length = 186

 Score =  114 bits (285), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 57/178 (32%), Positives = 100/178 (56%), Gaps = 8/178 (4%)

Query: 12  KEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
           +E           +   E    +    + +  RDK++R +A+ EN R+R+++++++A++Y
Sbjct: 14  EEAAAQERERMDDDMSDEAVELDALRAERDALRDKFMRALADAENARKRSEKDRREAENY 73

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
             +K ARDML V DNL RAL++   +   +         +L EGIE+T RE+++   ++G
Sbjct: 74  GGSKLARDMLPVHDNLKRALETVNEEQRAAS-------AALFEGIELTLRELLNVFTKHG 126

Query: 132 VKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           +  ID +   +F+P  H+AMFE P     A  II+V   G+ +++R+LRPA V +S  
Sbjct: 127 ITVIDPQVGDRFDPQHHEAMFEAPLPGTKAGEIIQVSTQGFMLHDRILRPAQVGVSSN 184


>gi|294011055|ref|YP_003544515.1| molecular chaperone GrpE [Sphingobium japonicum UT26S]
 gi|292674385|dbj|BAI95903.1| molecular chaperone GrpE [Sphingobium japonicum UT26S]
          Length = 184

 Score =  114 bits (285), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 67/188 (35%), Positives = 96/188 (51%), Gaps = 8/188 (4%)

Query: 5   MSEKNIDKEKNP---SNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           MSE   + E           +     +         N+    R   L   AE +N+RRR 
Sbjct: 1   MSEDKQNIENTEVVDELPEDTAPAGDAAAERIASLENELATARQDVLYAHAETQNVRRRL 60

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           ++E  DA++Y+   FARDMLSV+DNL RAL + P DL           K L+ G+E T R
Sbjct: 61  EKELADARAYAATAFARDMLSVADNLGRALQAIPADLRED-----EKFKGLVAGLEATGR 115

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           E+ +   R G++K+ +  Q  +PN HQAM E P       T++  +Q GY I +R+LRPA
Sbjct: 116 ELEAVFGRNGIEKLVSVGQPLDPNKHQAMMEVPSADAEPGTVLVEMQAGYTIKDRLLRPA 175

Query: 182 LVSISKGK 189
           LVS++K  
Sbjct: 176 LVSVAKKP 183


>gi|95117615|gb|ABF57012.1| GrpE [Pseudoalteromonas sp. SM9913]
          Length = 203

 Score =  114 bits (285), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 59/188 (31%), Positives = 104/188 (55%), Gaps = 8/188 (4%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           ME  +       E++     S  AE        E +     + +D  +R  A+++N+RRR
Sbjct: 21  MEADVEAAVEAAEQHAEQEQSPEAEIAMLYAELEAAKQTIADQKDSVVRAAADVDNMRRR 80

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
             ++ + A  +++ KFA ++L V DNL RA++ +  +           LK L+EGI+MT 
Sbjct: 81  AAQDVEKAHKFALEKFANELLPVIDNLERAIEFSDKE--------NETLKPLLEGIDMTV 132

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           +     + ++GV+ ++ + ++FNP+ HQAM  +P + V  NT++ V+Q GY +N R+LRP
Sbjct: 133 KSFNDAVAKFGVEIVNPQGEQFNPDFHQAMSIQPSNDVTPNTVLAVMQKGYTLNGRLLRP 192

Query: 181 ALVSISKG 188
           A+V +SK 
Sbjct: 193 AMVMVSKA 200


>gi|226286659|gb|EEH42172.1| mitochondrial co-chaperone GrpE [Paracoccidioides brasiliensis
           Pb18]
          Length = 254

 Score =  114 bits (285), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 57/194 (29%), Positives = 92/194 (47%), Gaps = 7/194 (3%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E    E+     +           E       E    +  + +DKYLR +A+  NL+ RT
Sbjct: 60  EDSSKEEEAATPEENGKEEKPVESEDPVQKELEVMKKEIVDLKDKYLRSVADFRNLQERT 119

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK-KSESVLKSLIEGIEMTR 120
            RE + A++++I +FA D+L   DNL RAL + P +    E  K    L  L+ G+ MT 
Sbjct: 120 RREVEAARNFAIQRFATDLLDSIDNLDRALSAVPTEKITGEALKENKDLADLVSGLRMTE 179

Query: 121 REMMSTLERYGVKKIDAKD------QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAIN 174
           R + STL ++G+++ D  +      QKF+P +H+A F    +      ++     G+ +N
Sbjct: 180 RVLFSTLNKHGLERFDPSELVEGKPQKFDPKLHEATFMVAAEGKEDGDVLHAQSKGFTLN 239

Query: 175 ERVLRPALVSISKG 188
            R LR A V + K 
Sbjct: 240 GRTLRAAKVGVVKN 253


>gi|119602776|gb|EAW82370.1| GrpE-like 1, mitochondrial (E. coli), isoform CRA_a [Homo sapiens]
          Length = 174

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 53/173 (30%), Positives = 90/173 (52%), Gaps = 3/173 (1%)

Query: 15  NPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIA 74
                    A EK+ +    +   Q +E  +KY R +A+ ENLR+R+ +  ++A+ Y I 
Sbjct: 3   QSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQ 62

Query: 75  KFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKK 134
            F +D+L V+D L +A    P +    +      LK+L EG+ MT  ++     ++G+ K
Sbjct: 63  AFCKDLLEVADVLEKATQCVPKEEIKDD---NPHLKNLYEGLVMTEVQIQKVFTKHGLLK 119

Query: 135 IDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           ++    KF+P  H+A+F  P +     T+  V + GY ++ R LRPALV + K
Sbjct: 120 LNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVK 172


>gi|329123082|ref|ZP_08251652.1| co-chaperone GrpE [Haemophilus aegyptius ATCC 11116]
 gi|327471637|gb|EGF17079.1| co-chaperone GrpE [Haemophilus aegyptius ATCC 11116]
          Length = 234

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 67/207 (32%), Positives = 112/207 (54%), Gaps = 29/207 (14%)

Query: 2   ETFMSEKNIDKEK-----------------NPSNANSSTAEEKSEINIPEESLN-QSEEF 43
           E  MSE+    +                  +PS       E  + +   EE L  Q EE 
Sbjct: 34  EKKMSEQEQKVKNPEVENQEEVVVEEAQQADPSQEFDPLEEAIARVQELEEQLKTQIEEA 93

Query: 44  RDK----YLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLA 99
            +K     LR  AE+ENLRRRT+++ + A  +++ KF++D+L+  DNL RAL +      
Sbjct: 94  ANKEQDILLRSRAEIENLRRRTEQDVEKAHKFALEKFSKDILNTIDNLERALAT------ 147

Query: 100 NSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVP 159
               K +  +K+L +G+E+T +E++ST+ R+GV+ +    + FNP++HQA+  +P +   
Sbjct: 148 -PANKEDESVKALFDGVELTLKELVSTVGRFGVEAVGVVGEAFNPDLHQAISMQPAEGFE 206

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
            N I  V+Q GY ++ RV+RPA+V ++
Sbjct: 207 TNQISVVLQKGYTLSGRVIRPAMVMVA 233


>gi|167769483|ref|ZP_02441536.1| hypothetical protein ANACOL_00817 [Anaerotruncus colihominis DSM
           17241]
 gi|167668451|gb|EDS12581.1| hypothetical protein ANACOL_00817 [Anaerotruncus colihominis DSM
           17241]
          Length = 179

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 44/184 (23%), Positives = 80/184 (43%), Gaps = 12/184 (6%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
               E+    +  P    +     + E +   +   Q  +  D+ LR +AE +N R+R+ 
Sbjct: 7   NDQMEQEPQAQDVPEETPAQEQTAQEEQDGEAKLQAQVADLNDRLLRTMAEYDNFRKRSQ 66

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           REK+     + A      + V+D + RAL +   D                +G+EM  + 
Sbjct: 67  REKESIYPQATAAAVAQFVPVADTIERALAAPCADEE------------YKKGVEMILQN 114

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
               L + GV+   A    F+P +H A+     +   A +I++V Q GY + ER++R A+
Sbjct: 115 FNDILAKMGVEAFGAPGDTFDPQVHNAVMHIEDEAAGAGSIVEVFQKGYRLGERIIRHAM 174

Query: 183 VSIS 186
           V ++
Sbjct: 175 VKVA 178


>gi|17229937|ref|NP_486485.1| heat shock protein [Nostoc sp. PCC 7120]
 gi|52782966|sp|Q8YUA7|GRPE_ANASP RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|17131537|dbj|BAB74144.1| heat shock protein [Nostoc sp. PCC 7120]
          Length = 248

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 42/183 (22%), Positives = 88/183 (48%), Gaps = 8/183 (4%)

Query: 19  ANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFAR 78
             ++TA              Q +E   +Y+R+ A+ EN R+RT +EK++           
Sbjct: 70  QEANTAALAELTQQISSLKTQLDERSTQYMRIAADFENYRKRTQKEKEELDLQVKRNTIL 129

Query: 79  DMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
           ++L + DN  RA         +          ++ +  +   ++++ +L+R GV  +  +
Sbjct: 130 ELLPIVDNFERARSHLKPQTESEM--------TIHKSYQGVYKQLVDSLKRLGVSPMRPE 181

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKK 198
            Q+F+PN+H+A+  EP D  P  T+++ +  GY + +RVLR ++V ++  K      ++ 
Sbjct: 182 GQEFDPNLHEAVMREPTDEHPEGTVLEELVRGYYLGDRVLRHSMVKVAAPKEDTLPAQEN 241

Query: 199 ETI 201
           ++ 
Sbjct: 242 QSS 244


>gi|149918854|ref|ZP_01907340.1| heat-shock protein [Plesiocystis pacifica SIR-1]
 gi|149820228|gb|EDM79645.1| heat-shock protein [Plesiocystis pacifica SIR-1]
          Length = 243

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 45/207 (21%), Positives = 87/207 (42%), Gaps = 10/207 (4%)

Query: 4   FMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDR 63
             ++ +  + +       +             +  ++   +DK+LR IA+ EN ++R  R
Sbjct: 45  IEADLDGGEAEAEGEDAPAPDPVAELEAELAAAQAETAAMKDKWLRAIADHENYKKRVKR 104

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           +  DA   ++       L + DNL RAL  AP D              L++GI M ++E 
Sbjct: 105 DIDDAVHRAVQNLLSSFLPIGDNLERALSVAPADAN----------DQLVKGIGMVQQEF 154

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
            S L + G+  ++   + F+PN+H A+ +      P   +    + GY   +++LRPA V
Sbjct: 155 FSALAKQGITPVETLGKPFDPNVHDALQQIDSPDYPPGVVAIEYEKGYRRGDKLLRPARV 214

Query: 184 SISKGKTQNPTEEKKETIEQPSPLDIE 210
            ++   +     +  E     +  + E
Sbjct: 215 VVAGPGSTGEAPDASEGEGSDADAEPE 241


>gi|221068655|ref|ZP_03544760.1| GrpE protein [Comamonas testosteroni KF-1]
 gi|220713678|gb|EED69046.1| GrpE protein [Comamonas testosteroni KF-1]
          Length = 181

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 64/193 (33%), Positives = 98/193 (50%), Gaps = 21/193 (10%)

Query: 5   MSEKNIDKEKNPSNANSS--------TAEEKSEINIPEESLNQSEEFRDKYLRVIAEMEN 56
           M+E +     N ++            + E        EE   +S E  D+YLR  A+ EN
Sbjct: 1   MTENHNPNTINDASPEELEAALAANASDELGRLQAELEELKAKSAELADQYLRAKADAEN 60

Query: 57  LRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGI 116
           +RRR + E   A+ + I  FA  +L V D+L  AL               +  + L EG 
Sbjct: 61  MRRRAEEEVTKARKFGIESFAESLLPVIDSLDAALAI-----------QNATPEQLREGS 109

Query: 117 EMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINE 175
           + T R++ S LER  V+ I+    +KF+P+ HQA+   P    PANT++ V+Q GY I +
Sbjct: 110 DATLRQLTSALERNKVQAINPAAGEKFDPHHHQAISMVP-ADQPANTVVAVLQKGYVIAD 168

Query: 176 RVLRPALVSISKG 188
           R+LRPALV++++G
Sbjct: 169 RILRPALVTVAQG 181


>gi|262204254|ref|YP_003275462.1| GrpE protein [Gordonia bronchialis DSM 43247]
 gi|262087601|gb|ACY23569.1| GrpE protein [Gordonia bronchialis DSM 43247]
          Length = 174

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 43/182 (23%), Positives = 90/182 (49%), Gaps = 11/182 (6%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           E++ D        + +  ++        ++  +  +  D++ R +A+++NLR+R  ++  
Sbjct: 2   ERSADHSTTEPATDGTDGDQTETAPDRTDTGAELAQLEDRWRRAVADLDNLRKRYSKDLD 61

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
             ++  +AK +   L V DNL  AL  A  D            ++++EG++  R + +  
Sbjct: 62  RERAAEVAKVSAAWLPVLDNLELALAHAGSDP-----------QAVVEGVKAIRDQAVQI 110

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           L R+G ++ D     F+P +H+ +       +P+ T+I+V++ GY  + R LRPA V +S
Sbjct: 111 LSRFGFERHDEVGVPFSPELHEVVSVVTQPDLPSGTVIEVLRPGYGEDGRQLRPAAVVVS 170

Query: 187 KG 188
           + 
Sbjct: 171 RP 172


>gi|330830464|ref|YP_004393416.1| protein grpE [Aeromonas veronii B565]
 gi|328805600|gb|AEB50799.1| Protein grpE [Aeromonas veronii B565]
          Length = 191

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 66/179 (36%), Positives = 103/179 (57%), Gaps = 8/179 (4%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
           ++     S   +  A         E ++ ++ E R++ LR  AEMENLRRRT+ + + A 
Sbjct: 19  VEPTDVDSEVTAEQARIAELEAQLETAIQKAAEERERALRTAAEMENLRRRTELDVEKAH 78

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
            +++ KFA ++L V DNL RA++ A  +           LK +IEG+E+T + M S + +
Sbjct: 79  KFALEKFANELLPVLDNLERAIELADKE--------NEALKPMIEGVELTLKSMQSGVAK 130

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           +G+  +D  +Q F+PN HQAM   P   V  NT+I V+Q GY +N RV+RPA+V I+K 
Sbjct: 131 FGLVALDPINQPFDPNAHQAMSMVPSADVAPNTVIAVMQKGYDLNGRVIRPAMVMIAKA 189


>gi|119469574|ref|ZP_01612478.1| Hsp 24 DnaK nucleotide exchange factor; probable member of the
           DnaK/DnaJ/GrpE foldase complex [Alteromonadales
           bacterium TW-7]
 gi|119447109|gb|EAW28379.1| Hsp 24 DnaK nucleotide exchange factor; probable member of the
           DnaK/DnaJ/GrpE foldase complex [Alteromonadales
           bacterium TW-7]
          Length = 205

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 57/172 (33%), Positives = 98/172 (56%), Gaps = 8/172 (4%)

Query: 17  SNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKF 76
           S   S  AE        E +     + +D  +R  A+++N+RRR  ++ + A  +++ KF
Sbjct: 39  SEEQSPEAEIAMLYAELEAAKQTIADQKDGVIRAAADVDNIRRRAAQDVEKAHKFALEKF 98

Query: 77  ARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID 136
           A ++L V DNL RA++ +  +           LK L+EGI+MT +     + ++GV+ ++
Sbjct: 99  ANELLPVIDNLERAIEFSDKE--------NETLKPLLEGIDMTVKSFNDAVAKFGVEIVN 150

Query: 137 AKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
            + ++FNP  HQAM  +P + V  NT++ V+Q GY +N R+LRPA+V +SK 
Sbjct: 151 PQGEQFNPEFHQAMSIQPSNDVTPNTVLAVMQKGYTLNGRLLRPAMVMVSKA 202


>gi|145636722|ref|ZP_01792388.1| anaerobic ribonucleoside triphosphate reductase [Haemophilus
           influenzae PittHH]
 gi|145639639|ref|ZP_01795242.1| anaerobic ribonucleoside triphosphate reductase [Haemophilus
           influenzae PittII]
 gi|145270020|gb|EDK09957.1| anaerobic ribonucleoside triphosphate reductase [Haemophilus
           influenzae PittHH]
 gi|145271196|gb|EDK11110.1| anaerobic ribonucleoside triphosphate reductase [Haemophilus
           influenzae PittII]
          Length = 234

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 61/207 (29%), Positives = 111/207 (53%), Gaps = 29/207 (14%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTA-------EEKSEINIPEESLNQSEEFRDKY------- 47
           E  MSE+    + +                +   E +  EE++ + +E  ++        
Sbjct: 34  EKKMSEQEQKVKNSEVENQEEVVVEEAQQADPSQEFDPLEEAIARVQELEEQLKTQIEEA 93

Query: 48  --------LRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLA 99
                   LR  AE+ENLRRRT+++ + A  +++ KF++D+L+  DNL RAL +      
Sbjct: 94  ANKEQDILLRSRAEIENLRRRTEQDVEKAHKFALEKFSKDILNTIDNLERALAT------ 147

Query: 100 NSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVP 159
               K +  +K+L +G+E+T +E++ST+ R+GV+ +    + FNP++HQA+  +P +   
Sbjct: 148 -PANKEDESVKALFDGVELTLKELVSTVGRFGVEAVGVVGEAFNPDLHQAISMQPAEGFE 206

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
            N I  V+Q GY ++ RV+RPA+V ++
Sbjct: 207 TNQISVVLQKGYTLSGRVIRPAMVMVA 233


>gi|296193199|ref|XP_002744439.1| PREDICTED: grpE protein homolog 2, mitochondrial-like [Callithrix
           jacchus]
          Length = 240

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 41/174 (23%), Positives = 89/174 (51%), Gaps = 3/174 (1%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
           ++P +    +  E++      +   + ++   +Y R +A+ EN+RRRT R  +DA+ + I
Sbjct: 62  EDPPDELGPSLAERALRIKAVKLEKEVQDLTVRYQRAVADCENIRRRTQRCVEDAKIFGI 121

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
             F +D++ V+D L +  +    +    ++K    L+ +  G+ +   ++ S   ++G++
Sbjct: 122 QSFCKDLVEVADILEKTTECISEESEPGDQKLT--LEKVFRGLSLLEAKLKSVFAKHGLE 179

Query: 134 KIDAKDQKFNPNMHQAMFEEPHD-TVPANTIIKVVQDGYAINERVLRPALVSIS 186
           K+     K++P+ H+ +   P    V   T+  V QDGY ++ R +R A V ++
Sbjct: 180 KLTPIGDKYDPHQHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVA 233


>gi|126649229|ref|XP_001388287.1| co-chaperone GrpE [Cryptosporidium parvum Iowa II]
 gi|126117209|gb|EAZ51309.1| co-chaperone GrpE, putative [Cryptosporidium parvum Iowa II]
          Length = 234

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 58/184 (31%), Positives = 98/184 (53%), Gaps = 12/184 (6%)

Query: 12  KEKNPSNANSSTAEEKSEINIPEESLN-------QSEEFRDKYLRVIAEMENLRRRTDRE 64
           +E+  +   +  A+        +           + EE ++K LR +AE ENLR+R  ++
Sbjct: 56  EEEERAILEAEVAKIGVLQERIKTLEKDASGYIHKIEESKEKLLRSLAENENLRQRHRKD 115

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
            + A+ YSI+ FA+ +L VSD+LSRAL S  ++  +      + +KSL  GI MT   + 
Sbjct: 116 LEAAREYSISGFAKSLLDVSDSLSRALLSVDIENVDK-----NSIKSLYNGISMTYSSLE 170

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
              E +G+K+  +  ++FNP  H+A+FE    + P   + + +  GY I++RVLR A V+
Sbjct: 171 KVFEAHGIKRFQSLGKQFNPKEHEAVFEVKDTSKPKGQVCEELLPGYKIHDRVLRAAKVA 230

Query: 185 ISKG 188
             K 
Sbjct: 231 TIKN 234


>gi|298490997|ref|YP_003721174.1| GrpE protein ['Nostoc azollae' 0708]
 gi|298232915|gb|ADI64051.1| GrpE protein ['Nostoc azollae' 0708]
          Length = 223

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 53/212 (25%), Positives = 103/212 (48%), Gaps = 17/212 (8%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEIN---------IPEESLNQSEEFRDKYLRVIAE 53
             M+  N+ +E   +  NS  A E ++ +           E    Q E+   +Y+R+ A+
Sbjct: 20  EQMTAHNVPQEPELTEENSVAAAETTQADTAALADLTQQLELVKTQLEDRNSQYMRIAAD 79

Query: 54  MENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLI 113
            EN R+RT +EK+D +++       ++L V DN  RA                    ++ 
Sbjct: 80  FENYRKRTSKEKEDMETHMKRNTIMELLPVVDNFERARAHLKPQTEGEM--------TIH 131

Query: 114 EGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAI 173
           +  +   ++++  L+R GV  +  + Q+F+PN+H+A+  EP +     T+++ +  GY +
Sbjct: 132 KSYQGVYKQLVDCLKRLGVSPMRPEGQEFDPNLHEAVMREPTNEHQEGTVLEELVRGYFL 191

Query: 174 NERVLRPALVSISKGKTQNPTEEKKETIEQPS 205
            +RVLR A+V ++  K   PT E+ E  ++ +
Sbjct: 192 GDRVLRHAMVKVAAPKEDTPTPEEDELTQENT 223


>gi|229491321|ref|ZP_04385146.1| co-chaperone GrpE [Rhodococcus erythropolis SK121]
 gi|229321778|gb|EEN87574.1| co-chaperone GrpE [Rhodococcus erythropolis SK121]
          Length = 174

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 42/182 (23%), Positives = 90/182 (49%), Gaps = 11/182 (6%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           E++ D        + +  ++        ++  +  +  D++ R +A+++NLR+R  ++  
Sbjct: 2   ERSADHSTTEPATDGTDGDQTETAPDRTDTGAELAQLEDRWRRAVADLDNLRKRYAKDLD 61

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
             ++  +AK +   L V DNL  AL  A  D            ++++EG++  R + +  
Sbjct: 62  RERAAEVAKVSAAWLPVLDNLELALAHAGSDP-----------QAVVEGVKAIRDQAVQV 110

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           L R+G ++ D     F+P +H+ +       +P+ T+++V++ GY  + R LRPA V +S
Sbjct: 111 LSRFGFERHDEVGVPFSPELHEVVSVVTRPDLPSGTVVEVLRPGYGEDGRQLRPAAVVVS 170

Query: 187 KG 188
           + 
Sbjct: 171 RP 172


>gi|310764831|gb|ADP09781.1| heat shock protein GrpE [Erwinia sp. Ejp617]
          Length = 176

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 56/183 (30%), Positives = 99/183 (54%), Gaps = 12/183 (6%)

Query: 12  KEKNPSNANSSTAEEKSEINIPEESLNQSEE----FRDKYLRVIAEMENLRRRTDREKKD 67
           ++    +A ++            +   Q  E     RD  LR  AE+EN+RRR + + + 
Sbjct: 2   EQAQNQDAETAAEVVDPRDERIAQLEVQLAESQNGVRDAQLRAQAEIENIRRRAELDVEK 61

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A  +++ KF+ ++L V D+L RAL+ A              L ++IEGIE+T + ++  +
Sbjct: 62  AHKFALEKFSNELLPVIDSLERALEVADKS--------NPELAAMIEGIELTMKSLLGAV 113

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            ++GV+ +   +  FNP +HQAM     + V  N ++ V+Q GY +N R+LRPA+V+++K
Sbjct: 114 RKFGVEVVGDTNVPFNPELHQAMSMMESEEVEPNHVMMVMQRGYTLNGRLLRPAMVAVAK 173

Query: 188 GKT 190
            K+
Sbjct: 174 SKS 176


>gi|297529329|ref|YP_003670604.1| GrpE protein [Geobacillus sp. C56-T3]
 gi|297252581|gb|ADI26027.1| GrpE protein [Geobacillus sp. C56-T3]
          Length = 213

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 54/164 (32%), Positives = 87/164 (53%), Gaps = 9/164 (5%)

Query: 23  TAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLS 82
             E  +      E   +  E   +YLR+ A+ EN RRRT +E + A+ Y     A D+L 
Sbjct: 58  AEELAAAKAQIAELEAKLSEMEHRYLRLYADFENFRRRTRQEMEAAEKYRAQSLASDLLP 117

Query: 83  VSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKF 142
           V DN  RAL                  KS+++G+EM  R ++  L++ GV+ I+A  + F
Sbjct: 118 VLDNFERALKIETD---------NEQAKSILQGMEMVYRSLVDALKKEGVEAIEAVGKPF 168

Query: 143 NPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           +P +HQA+ +   +    NT+++ +Q GY + +RVLRPA+V +S
Sbjct: 169 DPYLHQAVMQAEAEGYEPNTVVEELQKGYKLKDRVLRPAMVKVS 212


>gi|315095464|gb|EFT67440.1| co-chaperone GrpE [Propionibacterium acnes HL038PA1]
          Length = 231

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 46/210 (21%), Positives = 93/210 (44%), Gaps = 19/210 (9%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           ++D + + S  +S   EE S  +  E  L +  E      R+ AE  N +RR DR++  +
Sbjct: 41  DVDIDADQSATDSPAPEELSRESQLEALLAERTE---DLQRLQAEYVNYKRRVDRDRALS 97

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
           +   + K   D++ V D+++ A     ++                 G ++   E+     
Sbjct: 98  RQSGVDKVITDLMPVLDSIAMARQHGEVEG----------------GFKLVVDELEKVAN 141

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
            +G+         F+PN+H+A+ + P + V   ++ +V+Q GY + +RVLRPA V++S  
Sbjct: 142 NHGLTSFGEVGDVFDPNLHEALMQMPMEGVSVTSVSQVMQPGYKLGDRVLRPARVAVSDP 201

Query: 189 KTQNPTEEKKETIEQPSPLDIEERNKTQTK 218
                + ++    +  S    E+    + +
Sbjct: 202 DPNATSADESSQADGESAQADEDDETPRNE 231


>gi|289207644|ref|YP_003459710.1| GrpE protein [Thioalkalivibrio sp. K90mix]
 gi|288943275|gb|ADC70974.1| GrpE protein [Thioalkalivibrio sp. K90mix]
          Length = 193

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 59/197 (29%), Positives = 97/197 (49%), Gaps = 9/197 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E     +  +   +            +     +E    +EE RD+ LR  AE+EN RRR 
Sbjct: 6   EPQEPAEASEAADSEHTQPEGAEAVDNTDARLQELEALAEERRDQALRAQAELENQRRRF 65

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           +RE ++A  Y++ KFA +ML V D+L   L +A              ++ +IEG E+T +
Sbjct: 66  ERELENAHKYAMEKFASEMLEVGDSLEMGLQAARE---------SKDVERIIEGAELTLK 116

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
            +    E++G++  D   ++F+P  HQAM  +     P NT++  +Q GY + +RVLRPA
Sbjct: 117 NLNRVFEKFGIQAEDPTGERFDPERHQAMSMQEDPENPPNTVVATMQKGYLLQDRVLRPA 176

Query: 182 LVSISKGKTQNPTEEKK 198
           +V +SK       +E  
Sbjct: 177 MVVVSKAPASPNIDESA 193


>gi|85859705|ref|YP_461907.1| grpE protein [Syntrophus aciditrophicus SB]
 gi|85722796|gb|ABC77739.1| grpE protein [Syntrophus aciditrophicus SB]
          Length = 213

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 55/191 (28%), Positives = 99/191 (51%), Gaps = 10/191 (5%)

Query: 2   ETFMSEKNIDKEKNPSNANS-STAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           ET + E + ++ +  +   + +  + +S     E    +  E  D YLR +A++EN ++R
Sbjct: 32  ETIVPESSEEQIQKIAEGEAGAGDDRESLKAELELKEKEVAENYDNYLRALADLENYKKR 91

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
             REK D   +      RD+L + D+L RAL++A            +   S  EG+++ R
Sbjct: 92  ASREKSDLIKFGNENLLRDILPIMDSLDRALETAIK---------SNDFDSFREGLKLVR 142

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
            +++  LE+YGV+ I A  Q F+P++H+AM E   D      ++   + GY +  R+LRP
Sbjct: 143 DQLLCCLEKYGVEPIPACGQDFDPHVHEAMLEVESDQHEDRKVVDEYERGYLLKGRLLRP 202

Query: 181 ALVSISKGKTQ 191
           + VS+ K + +
Sbjct: 203 SKVSVCKRREK 213


>gi|254512466|ref|ZP_05124533.1| co-chaperone GrpE [Rhodobacteraceae bacterium KLH11]
 gi|221536177|gb|EEE39165.1| co-chaperone GrpE [Rhodobacteraceae bacterium KLH11]
          Length = 187

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 57/165 (34%), Positives = 99/165 (60%), Gaps = 8/165 (4%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
             E    ++   + ++F+DK++R +A+ EN R+R D+ ++DA+ Y  +K ARDML V DN
Sbjct: 29  SDEALEVDQLRAERDDFKDKFMRALADAENARKRGDKARRDAEQYGGSKLARDMLPVYDN 88

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPN 145
           + RAL++A  +          V   L+EG+E+T R +    +++G++ I  +   +F+PN
Sbjct: 89  MKRALEAATDEQK-------EVAAGLLEGVELTMRALKDVFQKHGIEVITPEVGDRFDPN 141

Query: 146 MHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           +H+AMFE P     A  II+V  +G+ +++R+LRPA V +S    
Sbjct: 142 VHEAMFEAPVPGTRAGDIIQVSAEGFMLHDRLLRPAQVGVSSTPA 186


>gi|309750609|gb|ADO80593.1| Hsp 24 nucleotide exchange factor GrpE [Haemophilus influenzae
           R2866]
          Length = 230

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 61/207 (29%), Positives = 111/207 (53%), Gaps = 29/207 (14%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTA-------EEKSEINIPEESLNQSEEFRDKY------- 47
           E  MSE+    + +                +   E +  EE++ + +E  ++        
Sbjct: 30  EKKMSEQEQKVKNSEVENQEEVVVEEAQQADPSQEFDPLEEAIARVQELEEQLKTQIEEA 89

Query: 48  --------LRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLA 99
                   LR  AE+ENLRRRT+++ + A  +++ KF++D+L+  DNL RAL +      
Sbjct: 90  ANKEQDILLRSRAEIENLRRRTEQDVEKAHKFALEKFSKDILNTIDNLERALAT------ 143

Query: 100 NSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVP 159
               K +  +K+L +G+E+T +E++ST+ R+GV+ +    + FNP++HQA+  +P +   
Sbjct: 144 -PANKEDESVKALFDGVELTLKELVSTVGRFGVEAVGVVGEAFNPDLHQAISMQPAEGFE 202

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
            N I  V+Q GY ++ RV+RPA+V ++
Sbjct: 203 TNQISVVLQKGYTLSGRVIRPAMVMVA 229


>gi|255722459|ref|XP_002546164.1| hypothetical protein CTRG_00946 [Candida tropicalis MYA-3404]
 gi|240136653|gb|EER36206.1| hypothetical protein CTRG_00946 [Candida tropicalis MYA-3404]
          Length = 242

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 56/180 (31%), Positives = 89/180 (49%), Gaps = 4/180 (2%)

Query: 13  EKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYS 72
           +     A              E    +    ++ Y R IA+  +L+  T  E + A+ ++
Sbjct: 67  KTEGETAAEEVDPVAELQEKLETKDKELASMKNHYARAIADFRHLQETTKVEVQKAKDFA 126

Query: 73  IAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGV 132
           + KFA+D+L   DN + AL     +   +     + +K+L EG++MT+     TL +YG+
Sbjct: 127 LQKFAKDLLDSLDNFNLALGHVKEETLKT----NAEVKNLYEGVDMTKNVFEKTLNKYGI 182

Query: 133 KKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQN 192
            KID  D+ F+PN+H+A F+  H      TI  V Q GY +NERVLRPA V + K   + 
Sbjct: 183 NKIDPIDEPFDPNLHEATFQMVHPDKQPGTIFHVQQVGYTLNERVLRPAKVGVVKESDEE 242


>gi|163737984|ref|ZP_02145400.1| DNA mismatch repair protein [Phaeobacter gallaeciensis BS107]
 gi|163742620|ref|ZP_02150006.1| co-chaperone GrpE [Phaeobacter gallaeciensis 2.10]
 gi|161384205|gb|EDQ08588.1| co-chaperone GrpE [Phaeobacter gallaeciensis 2.10]
 gi|161388600|gb|EDQ12953.1| DNA mismatch repair protein [Phaeobacter gallaeciensis BS107]
          Length = 187

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 58/180 (32%), Positives = 103/180 (57%), Gaps = 8/180 (4%)

Query: 12  KEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
            E      ++ T E        +    + +E +D+++R +A+ EN R+R D+ +++A+ Y
Sbjct: 14  TEAEAEELSAQTEEFDDAALELDSLRAERDELKDRFMRALADAENARKRGDKARREAEQY 73

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
             +K ARDML V DN+ RA+++A  +          V  +LIEG+E+T R ++   E++G
Sbjct: 74  GGSKLARDMLPVYDNMKRAIEAASDEQR-------EVSAALIEGVELTMRALLGVFEKHG 126

Query: 132 VKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ I  +  Q+F+P +H+AMFE P     A  II+V  +G+ +++R+LRPA V +S    
Sbjct: 127 MQVIAPEVGQRFDPQVHEAMFEAPVPGTKAGDIIQVSAEGFMLHDRLLRPAQVGVSSTPA 186


>gi|326469661|gb|EGD93670.1| mitochondrial co-chaperone GrpE [Trichophyton tonsurans CBS 112818]
 gi|326478808|gb|EGE02818.1| HSP-70 cofactor [Trichophyton equinum CBS 127.97]
          Length = 245

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 55/172 (31%), Positives = 96/172 (55%), Gaps = 7/172 (4%)

Query: 24  AEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSV 83
           +E ++     E    +  + +DKYLR +A+  NL+ RT R+ + A++++I KFA D++  
Sbjct: 73  SELETLKKNLEAREKEVVDLKDKYLRSVADFRNLQERTRRDIEAARTFAIQKFAADLIES 132

Query: 84  SDNLSRALDSAPLDL-ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGV------KKID 136
            DNL RAL + P +    +  K    +  L  G++MT   +M+TL+++GV      + +D
Sbjct: 133 IDNLERALAAVPPEKVDAANAKENKDVYELFSGLKMTEGVLMNTLKKHGVVRFDPSEPVD 192

Query: 137 AKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
            + QKF+P+ H+A+F  P +      I+ V   G+ +N R+LR A V + K 
Sbjct: 193 GQPQKFDPSRHEALFMSPMEGKQDGDIMHVQNKGFTLNGRILRAAKVGVVKN 244


>gi|224367523|ref|YP_002601686.1| GrpE [Desulfobacterium autotrophicum HRM2]
 gi|223690239|gb|ACN13522.1| GrpE [Desulfobacterium autotrophicum HRM2]
          Length = 200

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 60/179 (33%), Positives = 103/179 (57%), Gaps = 8/179 (4%)

Query: 19  ANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFAR 78
            N  T   K E +  EE  +Q    +DK LR+ AE EN ++R+ +E  + + ++     +
Sbjct: 30  ENPDTNSCKQEKSEIEECQDQLTAEKDKVLRLSAEFENYKKRSSKELSEFRKFANETLLK 89

Query: 79  DMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
             LSV DN+ RA+D+A  +  +         K+L+EGIE+T +EM   L  + V  ++A+
Sbjct: 90  QFLSVVDNMERAIDAAKKNGNDG--------KALLEGIELTYKEMQRILTAFNVVPVEAQ 141

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEK 197
            + F+P  HQA+ ++     P NT++  +Q GY  ++R++RP++V +SK  T+N TE+K
Sbjct: 142 GKDFDPVFHQAVTQQESVDHPENTVVAELQKGYLFHDRLIRPSMVVVSKAMTENETEKK 200


>gi|111023667|ref|YP_706639.1| heat shock protein GrpE [Rhodococcus jostii RHA1]
 gi|110823197|gb|ABG98481.1| heat shock protein GrpE [Rhodococcus jostii RHA1]
          Length = 174

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 43/182 (23%), Positives = 90/182 (49%), Gaps = 11/182 (6%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           E++ D        + +  ++        ++  +  +  D++ R +A+++NLR+R  ++  
Sbjct: 2   ERSADHSTTEPATDGTDRDQTETAPDRTDTGAELAQLEDRWRRALADLDNLRKRYAKDLD 61

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
             ++  +AK +   L V DNL  AL  A  D            ++++EG++  R + +  
Sbjct: 62  RERAAEVAKVSAAWLPVLDNLELALAHAGSDP-----------QTVVEGVKAIRDQAVQV 110

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           L R+G ++ D     F+P +H+ +       +P+ T+I+V++ GY  + R LRPA V +S
Sbjct: 111 LSRFGFERHDEVGVPFSPELHEVVSVVAQPDLPSGTVIEVLRPGYGEDGRQLRPAAVVVS 170

Query: 187 KG 188
           + 
Sbjct: 171 RP 172


>gi|302753576|ref|XP_002960212.1| hypothetical protein SELMODRAFT_71278 [Selaginella moellendorffii]
 gi|300171151|gb|EFJ37751.1| hypothetical protein SELMODRAFT_71278 [Selaginella moellendorffii]
          Length = 161

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 62/163 (38%), Positives = 101/163 (61%), Gaps = 2/163 (1%)

Query: 28  SEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNL 87
            + +I EE     +E +D  LR +AE+EN R R  RE++ ++ +++  F++D+L VSDNL
Sbjct: 1   EKDSIIEEKDELVKELKDSVLRGLAELENYRERAKREQESSRKFAVQSFSKDLLDVSDNL 60

Query: 88  SRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMH 147
           SRAL S        E K   +L +L+ G++MT +++M  L++YGV++ D   + F+PN+H
Sbjct: 61  SRALSSVGQPKDAEEAK--KLLDTLLAGVKMTEKQLMQVLKKYGVERFDPTGEPFDPNVH 118

Query: 148 QAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
            A+ E    + PA T+  V + GY ++ERVLRPA V++ K   
Sbjct: 119 LAVCEIADPSKPAGTVANVFKVGYLLHERVLRPAEVAVVKAVE 161


>gi|187922742|ref|YP_001894384.1| GrpE protein [Burkholderia phytofirmans PsJN]
 gi|226737117|sp|B2SXC5|GRPE_BURPP RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|187713936|gb|ACD15160.1| GrpE protein [Burkholderia phytofirmans PsJN]
          Length = 194

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 53/167 (31%), Positives = 90/167 (53%), Gaps = 12/167 (7%)

Query: 23  TAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLS 82
            +   +E +   E+  +  E ++ +LR  AE EN+RRR   +   A  ++I  FA  +L 
Sbjct: 40  DSPVNAEQSALAEAEAKIAELQESFLRAKAETENVRRRAQEDVAKAHKFAIESFAEHLLP 99

Query: 83  VSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKF 142
           V D+L  A+  +  D           L+ + EG+E+T R++   LE+  V  ++   +KF
Sbjct: 100 VIDSLEAAVAHSSDD-----------LQKVREGVELTLRQLTGALEKGRVVALNPVGEKF 148

Query: 143 NPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
           +P+ HQA+   P      NT++ V+Q G+ I +RVLRPALV+++  K
Sbjct: 149 DPHRHQAISMVP-AEQEPNTVVAVLQKGFVIADRVLRPALVTVAAPK 194


>gi|94265731|ref|ZP_01289468.1| GrpE protein [delta proteobacterium MLMS-1]
 gi|93453744|gb|EAT04120.1| GrpE protein [delta proteobacterium MLMS-1]
          Length = 234

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 54/176 (30%), Positives = 91/176 (51%), Gaps = 9/176 (5%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
                A  + A +       +E+  +     ++ +R+ AE EN ++R  RE++    Y+ 
Sbjct: 68  DEAGEAAGTEAGDDGLWRQLQEAREELRAKEEQMMRLAAEFENYKKRMQRERETTLKYAE 127

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
            +  RD+L   DNL RA++                + +L+EG+EMT    ++TL+++G+K
Sbjct: 128 EELLRDLLPTLDNLERAIEQGRN---------TEDVTALLEGVEMTYEGFLATLQKFGIK 178

Query: 134 KIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
            +  + + F+PN H+AM  E  D VPANT+I   Q GY   +R+LR A V +S G 
Sbjct: 179 PLAGEGEAFDPNFHEAMAMEDSDQVPANTVINEYQKGYLYKDRLLRAAKVVVSGGG 234


>gi|117619528|ref|YP_857488.1| co-chaperone GrpE [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
 gi|226737101|sp|A0KMI7|GRPE_AERHH RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|117560935|gb|ABK37883.1| co-chaperone GrpE [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
          Length = 191

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 67/196 (34%), Positives = 105/196 (53%), Gaps = 15/196 (7%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSE-------EFRDKYLRVIAEM 54
           E    E     E  P       +E  +E     E   Q +       E R++ +R +AEM
Sbjct: 4   EEQKVEAMEQVEAQPVEPTDVDSEVTAEQARIAELEAQLDAAQQASLEERERAIRAVAEM 63

Query: 55  ENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIE 114
           ENLRRR  ++ + A  +++ KFA ++L V DNL RA++ A  +           LK +IE
Sbjct: 64  ENLRRRAAQDVEKAHKFALEKFAAELLPVLDNLERAIELADKE--------NEALKPMIE 115

Query: 115 GIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAIN 174
           G+E+T + M S++ ++G+  +D  +Q F+PN HQAM    +  +  NT+I V+Q GY +N
Sbjct: 116 GVELTLKSMQSSVGKFGLNPLDPLNQPFDPNAHQAMSMIENAELAPNTVIAVMQKGYELN 175

Query: 175 ERVLRPALVSISKGKT 190
            RV+RPA+V +SK   
Sbjct: 176 GRVIRPAMVMVSKAPA 191


>gi|327303558|ref|XP_003236471.1| mitochondrial co-chaperone GrpE [Trichophyton rubrum CBS 118892]
 gi|326461813|gb|EGD87266.1| mitochondrial co-chaperone GrpE [Trichophyton rubrum CBS 118892]
          Length = 245

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 55/172 (31%), Positives = 94/172 (54%), Gaps = 7/172 (4%)

Query: 24  AEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSV 83
           +E ++     E    +  + +DKYLR +A+  NL+ RT R+   A++++I KFA D++  
Sbjct: 73  SEVETLKKDLEAREKEVVDLKDKYLRSVADFRNLQERTRRDIDAARTFAIQKFAADLIES 132

Query: 84  SDNLSRALDSAPLDL-ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKD--- 139
            DNL RAL + P +    +  K    +  L  G++MT   +M+TL+++GV + D  +   
Sbjct: 133 IDNLERALAAVPPEKVDAANAKENKDVYELFSGLKMTEGVLMNTLKKHGVVRFDPSELVD 192

Query: 140 ---QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
              QKF+P+ H+A+F  P +      I+ V   G+ +N R+LR A V + K 
Sbjct: 193 GQPQKFDPSRHEALFMSPMEGKQDGDIMHVQNKGFTLNGRILRAAKVGVVKN 244


>gi|167624994|ref|YP_001675288.1| heat shock protein GrpE [Shewanella halifaxensis HAW-EB4]
 gi|226737177|sp|B0TQ37|GRPE_SHEHH RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|167355016|gb|ABZ77629.1| GrpE protein [Shewanella halifaxensis HAW-EB4]
          Length = 200

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 57/196 (29%), Positives = 109/196 (55%), Gaps = 16/196 (8%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEE--------KSEINIPEESLNQSEEFRDKYLRVIA 52
           +E  +  + +++    +   +S  +E        +      +E+  + E  +D  +R  A
Sbjct: 13  VEEIVEGELLNENGTEATGEASLMDELTQANFRVEELEKALQEAETKVESQKDSVIRAAA 72

Query: 53  EMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSL 112
           E++N+RRR+  + + A  +++ KF  ++L V DN+ RAL     +            K++
Sbjct: 73  EVDNIRRRSAIDVEKAHKFALEKFINELLPVLDNMERALQGTDAE--------AEATKAI 124

Query: 113 IEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYA 172
            EG+E+T +  +ST+E++G+ ++D     FNP +HQA+  +P    PANT++ V+Q GY 
Sbjct: 125 YEGVELTAKSFVSTVEKFGLTQVDPLGDTFNPELHQAIGMQPSADFPANTVMMVMQKGYT 184

Query: 173 INERVLRPALVSISKG 188
           +N+R+LRPA+V +S+G
Sbjct: 185 LNDRLLRPAMVMVSQG 200


>gi|329297614|ref|ZP_08254950.1| heat shock protein GrpE [Plautia stali symbiont]
          Length = 192

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 62/190 (32%), Positives = 106/190 (55%), Gaps = 9/190 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEE-FRDKYLRVIAEMENLRRR 60
           E    E   ++++  +   +        I   E  L Q++   RD  LR  AE+EN+RRR
Sbjct: 11  EQVSDEIQQEQQQPEAETATEVDPSDERIAQLEAELAQAQGGVRDAQLRAQAEIENIRRR 70

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
            + + + A  +++ KFA ++L V D+L RAL+ A  +         + L S+IEGIE+T 
Sbjct: 71  AEMDVEKAHKFALEKFANELLPVIDSLERALEVADKE--------NTELASMIEGIELTL 122

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + ++  + ++GV+ +   +  FNP++HQAM     + V  N ++ V+Q GY +N R+LRP
Sbjct: 123 KSLLGAVRKFGVEVVGETNVPFNPDVHQAMSMMESEEVAPNHVLMVMQRGYTLNGRLLRP 182

Query: 181 ALVSISKGKT 190
           A+V++SK K 
Sbjct: 183 AMVAVSKAKG 192


>gi|312885005|ref|ZP_07744694.1| heat shock protein GrpE [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309367337|gb|EFP94900.1| heat shock protein GrpE [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 198

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 60/174 (34%), Positives = 98/174 (56%), Gaps = 8/174 (4%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
              +  +    +          S  + +E +D  LR  AE+EN+RRRT+ E   A+ Y++
Sbjct: 33  NEETELDEQEGKVAQLEAALLTSEAKVQEQQDSVLRAKAEVENMRRRTEGEIDKARKYAL 92

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
            KFA ++L V DNL RA+ +A  D            K L+EG+E+T +  + T+ ++G+K
Sbjct: 93  NKFAEELLPVIDNLERAIQAADTD--------NEATKPLLEGVELTHKTFVDTVSKFGLK 144

Query: 134 KIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +I+ + + FNP MHQAM  +       NT++ V+Q GY +N RV+RPA+V ++K
Sbjct: 145 EINPEGETFNPEMHQAMSIQESPDHEPNTVMFVMQKGYELNGRVIRPAMVMVAK 198


>gi|115767169|ref|XP_798953.2| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
 gi|115951747|ref|XP_001179550.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
          Length = 168

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 55/164 (33%), Positives = 92/164 (56%), Gaps = 2/164 (1%)

Query: 26  EKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSD 85
           E+       +   Q  E+ DKY R +AE EN+R R  ++  D++ YSI+ F +D+L V+D
Sbjct: 5   EQKLTEEKAKLTAQVAEYTDKYKRALAETENVRMRFTKQLNDSKIYSISGFCKDLLEVAD 64

Query: 86  NLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDA-KDQKFNP 144
            L +A  S P D  +        LK+L EG+ MT  ++     +  ++ I+   ++KF+P
Sbjct: 65  ILGKATTSVPKDAVSGADA-NIHLKNLFEGLVMTETQLQKVFAKNKLEVINPVNNEKFDP 123

Query: 145 NMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           ++H+A+F+ P       T+  V + GY ++ER LRPALV ++K 
Sbjct: 124 HIHEALFQIPVPDKEPGTVAVVEKLGYKLHERTLRPALVGVTKA 167


>gi|119775571|ref|YP_928311.1| heat shock protein GrpE [Shewanella amazonensis SB2B]
 gi|226737173|sp|A1S8D5|GRPE_SHEAM RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|119768071|gb|ABM00642.1| heat shock protein GrpE [Shewanella amazonensis SB2B]
          Length = 200

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 61/203 (30%), Positives = 107/203 (52%), Gaps = 25/203 (12%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLN-----------------QSEEFRDKY 47
           MS ++ + ++ P      T     E  + +E                    + EE +D  
Sbjct: 1   MSNESTNPQQEPLEQVQDTEVVTDEAALVDELTQANFRIEELEQALAAAEAKVEEQKDSV 60

Query: 48  LRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSES 107
           +R  AE++N+RRR   + + A  +++ KFA ++L V DN+ RAL     +        + 
Sbjct: 61  VRAAAEVDNIRRRAAMDVEKANKFALEKFANELLPVLDNMERALAGTNAE--------DE 112

Query: 108 VLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVV 167
             K++ EG+ +T + +++ +E++GVK +D   Q FNP  HQA+  +P+  VPAN ++ V+
Sbjct: 113 ATKAMYEGVSLTMKTLVNAVEKFGVKVVDPMGQPFNPEQHQAIGMQPNPEVPANHVMVVL 172

Query: 168 QDGYAINERVLRPALVSISKGKT 190
           Q GY +N R+LRPA+V +S+G  
Sbjct: 173 QKGYELNGRLLRPAMVMVSQGGG 195


>gi|237753211|ref|ZP_04583691.1| grpE [Helicobacter winghamensis ATCC BAA-430]
 gi|229375478|gb|EEO25569.1| grpE [Helicobacter winghamensis ATCC BAA-430]
          Length = 185

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 52/187 (27%), Positives = 90/187 (48%), Gaps = 2/187 (1%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           M+        + ++              +    E    Q  E +++Y+R  A+ EN ++R
Sbjct: 1   MQDNQHNDQDNLQETQMQDLQDCDNTAEDSANTEALQTQIAELKEQYVRAYADFENTKKR 60

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
            +R+K  A  Y+  K A+D+L   D L  AL S   D   ++    ++   + EGI +T 
Sbjct: 61  LERDKDQALEYAYEKIAKDLLPSIDTLEIALKSI-QDSKTNDATQNAIFSKIEEGIALTL 119

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
             ++ +L ++G++ I      F+PN H A+ +       A  I+ V+Q GY   ERVLRP
Sbjct: 120 DNLLKSLAKHGIEPIATDG-AFDPNFHDAIMQVESAEHNAGDIVAVMQKGYTYKERVLRP 178

Query: 181 ALVSISK 187
           ++VSI+K
Sbjct: 179 SMVSIAK 185


>gi|301162721|emb|CBW22268.1| putative GrpE protein (HSP70 cofactor) [Bacteroides fragilis 638R]
          Length = 235

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 51/179 (28%), Positives = 91/179 (50%), Gaps = 10/179 (5%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +   + +  + A      E+      +E+  Q E+ +DKYLR+ AE +N R+RT +EK +
Sbjct: 64  EGQSQNEEATEATEPLTAEEKLEKELKEAQAQIEDQKDKYLRLSAEFDNYRKRTVKEKAE 123

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
                  K  + +L V D++ RAL +          ++ + + ++ EG+E+   + +S L
Sbjct: 124 LILNGGEKSIKSILPVIDDMERALTT---------METATDVNAVKEGVELIYNKFLSIL 174

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVP-ANTIIKVVQDGYAINERVLRPALVSI 185
            + GVK I+ KDQ  + + H+A+   P  T      I+  VQ GY +N +V+R A V +
Sbjct: 175 SQDGVKVIETKDQPLDTDYHEAIAVIPAPTEEQKGKILDCVQTGYTLNGKVIRHAKVVV 233


>gi|295662873|ref|XP_002791990.1| mitochondrial co-chaperone GrpE [Paracoccidioides brasiliensis
           Pb01]
 gi|226279642|gb|EEH35208.1| mitochondrial co-chaperone GrpE [Paracoccidioides brasiliensis
           Pb01]
          Length = 253

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 57/193 (29%), Positives = 92/193 (47%), Gaps = 7/193 (3%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
              S+K     +           E       E    +  + +DKYLR +A+  NL+ RT 
Sbjct: 60  EDSSKKEAATPEENGKEEKPEESEDPVQKELEVMKKEIIDLKDKYLRSVADFRNLQERTR 119

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK-KSESVLKSLIEGIEMTRR 121
           RE + A++++I +FA D+L   DNL RAL + P +    E  K    L  L+ G+ MT R
Sbjct: 120 REVESARNFAIQRFATDLLDSIDNLDRALSAVPAEKITGEALKENKDLADLVSGLRMTER 179

Query: 122 EMMSTLERYGVKKIDAKD------QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINE 175
            + STL ++G+++ D  +      QKF+P +H+A F    +      ++     G+ +N 
Sbjct: 180 VLFSTLNKHGLERFDPSELVEGKPQKFDPKLHEATFMVAAEGKEDGDVLHAQSKGFTLNG 239

Query: 176 RVLRPALVSISKG 188
           R LR A V + K 
Sbjct: 240 RTLRAAKVGVVKN 252


>gi|302802734|ref|XP_002983121.1| hypothetical protein SELMODRAFT_117407 [Selaginella moellendorffii]
 gi|300149274|gb|EFJ15930.1| hypothetical protein SELMODRAFT_117407 [Selaginella moellendorffii]
          Length = 237

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 42/215 (19%), Positives = 85/215 (39%), Gaps = 8/215 (3%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E  +           +       E  S   +      +S   +++ LR+ A+ +N R+R+
Sbjct: 30  EAVLGNDQAAMSTIQAELEVIQKERDSLSQLVANLTEESALAKERLLRLNADFDNFRKRS 89

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
            REK   +          +L + DN  RA  +   +              +    +   +
Sbjct: 90  GREKDSLRETVKGDVVESLLPMIDNFERAKGAIKAETDGER--------KIDSSYQGIYK 141

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           + +  ++  GVK ID   ++FNP +H+A+  E         + +  + G+ + E++LR A
Sbjct: 142 QFVDIMKSLGVKVIDTVGKEFNPELHEAIMREESSEYDEGIVTQEFRRGFLLGEKLLRAA 201

Query: 182 LVSISKGKTQNPTEEKKETIEQPSPLDIEERNKTQ 216
           +V +S GK  N      +  E+ +P D    ++  
Sbjct: 202 MVKVSSGKQSNSPAAAPQDSEETTPSDETPVDENS 236


>gi|261856069|ref|YP_003263352.1| GrpE protein [Halothiobacillus neapolitanus c2]
 gi|261836538|gb|ACX96305.1| GrpE protein [Halothiobacillus neapolitanus c2]
          Length = 190

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 57/188 (30%), Positives = 103/188 (54%), Gaps = 10/188 (5%)

Query: 2   ETFMSEKNIDKEKN-PSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           E    + N D  ++      +  +   +E   P     Q  E   + LR+ AEMENLR+R
Sbjct: 11  ENMTQDLNQDSNQDMNKEEQAEQSVTANETLDPRVLAEQLAERDQEILRLHAEMENLRKR 70

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
            +R+ ++A+ +++ +F   +L V D+L   + ++  +         + L+ + EG EMT 
Sbjct: 71  VERDIENARKFALERFVDGLLPVIDSLEMGIQASENE--------NTSLEKIREGSEMTL 122

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
              + T+E++GV  +    ++FNP+ HQA+  +PH+  PA+ +I V+Q GY + +R++RP
Sbjct: 123 NLFLQTMEKFGVHPVHPVGERFNPDHHQAISVQPHEG-PADHVISVMQKGYLLRDRLVRP 181

Query: 181 ALVSISKG 188
           ALV +SK 
Sbjct: 182 ALVVVSKN 189


>gi|78183603|ref|YP_376037.1| heat shock protein GrpE [Synechococcus sp. CC9902]
 gi|123757149|sp|Q3B0Y4|GRPE_SYNS9 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|78167897|gb|ABB24994.1| putative heat shock protein GrpE [Synechococcus sp. CC9902]
          Length = 224

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 41/200 (20%), Positives = 85/200 (42%), Gaps = 10/200 (5%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
           +++              +           + E  + +Y+R+ A+ +N R+R  R++ D +
Sbjct: 35  VEETPTLDTEIDPANRLQQLEQELNSLKQEHEAVQSQYMRIAADFDNFRKRQARDQDDLR 94

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
              +     ++L V DN  RA      +            ++L    +   ++++  L++
Sbjct: 95  QQLVCSTLTEILPVVDNFERARQQLNPEG--------EEAQALHRSYQGLYKQLVDVLKQ 146

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
            GV +++   Q+F+P +H+A+  E +     + + + +Q GY  + RVLR A+V +S G 
Sbjct: 147 QGVARMEVVGQEFDPTLHEAVLREENQEHAEDIVCEELQRGYHRDGRVLRHAMVKVSMGP 206

Query: 190 TQNPTEEKKETIEQPSPLDI 209
              P        EQP   D 
Sbjct: 207 G--PESSSDAASEQPQEGDA 224


>gi|294496265|ref|YP_003542758.1| GrpE protein [Methanohalophilus mahii DSM 5219]
 gi|292667264|gb|ADE37113.1| GrpE protein [Methanohalophilus mahii DSM 5219]
          Length = 180

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 54/186 (29%), Positives = 108/186 (58%), Gaps = 9/186 (4%)

Query: 11  DKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQS 70
             ++  +N++ +    +    + +E   +    ++  LR  AE +N R+RT +E+++ ++
Sbjct: 4   KDKQEDNNSSDAGNSPEELEQLVQEKEAEIASLKEDLLRKRAEFDNFRKRTRKEQEEFRN 63

Query: 71  YSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERY 130
           +++     ++L V DN  RA++SA          +   + S++EG+EM  ++ +S LE+ 
Sbjct: 64  FAVENLMVELLDVYDNFERAIESA---------HNTDDVNSVVEGVEMVFKQFVSILEKE 114

Query: 131 GVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           G+K+I+ + ++F+P+ H+AM    H   P NTII V + GY +N RV+RPA+V++SK  +
Sbjct: 115 GLKRIECEGEEFDPSKHEAMMHVEHADHPDNTIIDVCKPGYKLNSRVIRPAMVAVSKNTS 174

Query: 191 QNPTEE 196
            +  E+
Sbjct: 175 SDKEEK 180


>gi|320585997|gb|EFW98676.1| mitochondrial co-chaperone [Grosmannia clavigera kw1407]
          Length = 280

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 61/198 (30%), Positives = 103/198 (52%), Gaps = 18/198 (9%)

Query: 10  IDKEKNPSNANSSTAEEKSEI-NIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
             KE   +     +AEE + +    E    +  +++DKYLR +A+  NL+ RT RE K A
Sbjct: 83  ESKEAGEAAGEPLSAEEAATLRKELETKTKEVVDWKDKYLRAVADFRNLQERTQREMKAA 142

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSES-----------------VLKS 111
           + ++I +FA+D++   DNL RAL   P +   + +   +                  L +
Sbjct: 143 RDFAITQFAKDLVDSVDNLDRALTIVPAEKLAAAEGETAGETAASPEAEVALAVRRDLAN 202

Query: 112 LIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGY 171
           L++G++MT   ++ TL+++G+++ D   +KFNPN H+A F  P+     NT+    Q G+
Sbjct: 203 LVDGLKMTETVLLQTLKKHGLERFDPVGEKFNPNEHEATFMTPNKDHDHNTVFHTQQKGF 262

Query: 172 AINERVLRPALVSISKGK 189
            +N RVLR A V +   K
Sbjct: 263 RLNGRVLRAAKVGVVNNK 280


>gi|221233092|ref|YP_002515528.1| heat shock protein GrpE [Caulobacter crescentus NA1000]
 gi|239977310|sp|B8GXP4|GRPE_CAUCN RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|239977311|sp|P0CAV1|GRPE_CAUCR RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|220962264|gb|ACL93620.1| GrpE protein [Caulobacter crescentus NA1000]
          Length = 208

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 118/214 (55%), Gaps = 15/214 (7%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           M+++    E+ P  A+ +  E        E    +  + +++ LR  AE EN +RR +RE
Sbjct: 1   MTDEQTPAEEMPFEADDAAQE-------IEALKLEVAQLKEQALRYAAEAENTKRRAERE 53

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
             DA++Y+I KFARD+L  +DNL RA   +P D  +        +K+ I G+EMT +E+ 
Sbjct: 54  MNDARAYAIQKFARDLLGAADNLGRATAHSPKDSTDP------AVKNFIIGVEMTEKELQ 107

Query: 125 STLERYGVKKIDA-KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
           S  ER G+KKID  K  KF+P++HQA+ E+P   V A  ++ V+Q GY +  R++RPA+V
Sbjct: 108 SAFERNGLKKIDPAKGDKFDPHLHQAVTEQPSTEVAAGGVLMVMQAGYELMGRLVRPAMV 167

Query: 184 SI-SKGKTQNPTEEKKETIEQPSPLDIEERNKTQ 216
           ++ +KG T   + +       P      E + T 
Sbjct: 168 AVAAKGSTGPASPDAPAASANPYAGAAAEGDSTG 201


>gi|75906602|ref|YP_320898.1| heat shock protein GrpE [Anabaena variabilis ATCC 29413]
 gi|123731640|sp|Q3MG83|GRPE_ANAVT RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|75700327|gb|ABA20003.1| GrpE protein [Anabaena variabilis ATCC 29413]
          Length = 248

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 42/183 (22%), Positives = 88/183 (48%), Gaps = 8/183 (4%)

Query: 19  ANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFAR 78
             ++TA              Q +E   +Y+R+ A+ EN R+RT +EK++           
Sbjct: 70  QEANTAALAELTQQINSLKTQLDERSTQYMRIAADFENYRKRTQKEKEELDLQVKRNTIL 129

Query: 79  DMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
           ++L + DN  RA         +          ++ +  +   ++++ +L+R GV  +  +
Sbjct: 130 ELLPIVDNFERARSHLKPQTESEM--------TIHKSYQGVYKQLVDSLKRLGVSPMRPE 181

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKK 198
            Q+F+PN+H+A+  EP D  P  T+++ +  GY + +RVLR ++V ++  K      ++ 
Sbjct: 182 GQEFDPNLHEAVMREPTDEHPEGTVLEELVRGYYLGDRVLRHSMVKVAAPKEDTLPAQEN 241

Query: 199 ETI 201
           ++ 
Sbjct: 242 QSS 244


>gi|261418477|ref|YP_003252159.1| heat shock protein GrpE [Geobacillus sp. Y412MC61]
 gi|319767562|ref|YP_004133063.1| GrpE protein [Geobacillus sp. Y412MC52]
 gi|261374934|gb|ACX77677.1| GrpE protein [Geobacillus sp. Y412MC61]
 gi|317112428|gb|ADU94920.1| GrpE protein [Geobacillus sp. Y412MC52]
          Length = 213

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 54/164 (32%), Positives = 87/164 (53%), Gaps = 9/164 (5%)

Query: 23  TAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLS 82
             E  +      E   +  E   +YLR+ A+ EN RRRT +E + A+ Y     A D+L 
Sbjct: 58  AEELAAAKAQIAELEAKLSEMEHRYLRLYADFENFRRRTRQEMEAAEKYRAQSLASDLLP 117

Query: 83  VSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKF 142
           V DN  RAL                  KS+++G+EM  R ++  L++ GV+ I+A  + F
Sbjct: 118 VLDNFERALKIETD---------NEQAKSILQGMEMVYRSLVDALKKEGVEAIEAVGKPF 168

Query: 143 NPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           +P +HQA+ +   +    NT+++ +Q GY + +RVLRPA+V +S
Sbjct: 169 DPYLHQAVMQAEAEGYEPNTVVEELQKGYKLKDRVLRPAMVKVS 212


>gi|78224716|ref|YP_386463.1| heat shock protein GrpE [Geobacter metallireducens GS-15]
 gi|123729156|sp|Q39PT6|GRPE_GEOMG RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|78195971|gb|ABB33738.1| GrpE protein [Geobacter metallireducens GS-15]
          Length = 189

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 56/144 (38%), Positives = 93/144 (64%), Gaps = 11/144 (7%)

Query: 45  DKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKK 104
           DK++R  A++EN R+RT +EK++   Y       ++L V DN+ RALD +  D A++   
Sbjct: 56  DKFVRERADLENYRKRTQKEKEELLKYGNESLIVEILPVVDNMERALDHSDDDSASA--- 112

Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKID-AKDQKFNPNMHQAMFEEPHDTVPANTI 163
                  +IEG+ MT   ++STL+++GV  ++  K   F+P +HQAM +  +  VPAN++
Sbjct: 113 -------VIEGVRMTLNMLLSTLKKFGVTVVEAEKGTPFDPAVHQAMCQVENTDVPANSV 165

Query: 164 IKVVQDGYAINERVLRPALVSISK 187
           +++ Q GY +NER++RPA+VS+SK
Sbjct: 166 VEIFQKGYLLNERLIRPAMVSVSK 189


>gi|148825648|ref|YP_001290401.1| heat shock protein GrpE [Haemophilus influenzae PittEE]
 gi|229846992|ref|ZP_04467098.1| anaerobic ribonucleoside triphosphate reductase [Haemophilus
           influenzae 7P49H1]
 gi|148715808|gb|ABQ98018.1| anaerobic ribonucleoside triphosphate reductase [Haemophilus
           influenzae PittEE]
 gi|229810076|gb|EEP45796.1| anaerobic ribonucleoside triphosphate reductase [Haemophilus
           influenzae 7P49H1]
          Length = 234

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 63/207 (30%), Positives = 112/207 (54%), Gaps = 29/207 (14%)

Query: 2   ETFMSEKNIDKEK-------NPSNANSSTAEEKSEINIPEESLNQSEEFRDKY------- 47
           E  MSE+    +              +  AE   E +  EE++ + +E  ++        
Sbjct: 34  EKKMSEQEQKVKNPEVENQEEVVVEETQQAEHSQEFDPLEEAIARVQELEEQLKTQIEEA 93

Query: 48  --------LRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLA 99
                   LR  AE+ENLRRRT+++ + A  +++ KF++D+L+  DNL RAL +      
Sbjct: 94  ANKEQDILLRSRAEIENLRRRTEQDVEKAHKFALEKFSKDILNTIDNLERALAT------ 147

Query: 100 NSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVP 159
               K +  +K+L +G+E+T +E++ST+ R+GV+ +    + FNP++HQA+  +P +   
Sbjct: 148 -PANKEDESVKALFDGVELTLKELVSTVGRFGVEAVGVVGEAFNPDLHQAISMQPAEGFE 206

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
            N I  V+Q GY ++ RV+RPA+V ++
Sbjct: 207 TNQISVVLQKGYTLSGRVIRPAMVMVA 233


>gi|188533124|ref|YP_001906921.1| Heat shock protein [Erwinia tasmaniensis Et1/99]
 gi|226737134|sp|B2VEC6|GRPE_ERWT9 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|188028166|emb|CAO96024.1| Heat shock protein [Erwinia tasmaniensis Et1/99]
          Length = 194

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 56/189 (29%), Positives = 101/189 (53%), Gaps = 12/189 (6%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEE----FRDKYLRVIAEMENLRRRT 61
           S++   ++     A+++            +   Q  E     RD  LR  AE+EN+RRR 
Sbjct: 14  SDEIETEQAKNQGADTAAEAADQRDERIAQLEAQLAESQGGVRDAQLRAQAEIENIRRRA 73

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           + + + A  +++ KF+ ++L V D+L RAL+ A              L ++IEGI++T +
Sbjct: 74  ELDVEKAHKFALEKFSNELLPVIDSLERALEVADKS--------NPELAAMIEGIDLTMK 125

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
            ++  + ++GV+ +   +  FNP +HQAM     + V  N ++ V+Q GY +N R+LRPA
Sbjct: 126 SLLGAVRKFGVEVVGDTNVPFNPEVHQAMSMMESEEVEPNHVMMVMQRGYTLNGRLLRPA 185

Query: 182 LVSISKGKT 190
           +V+++K K 
Sbjct: 186 MVAVAKSKG 194


>gi|262195769|ref|YP_003266978.1| GrpE protein [Haliangium ochraceum DSM 14365]
 gi|262079116|gb|ACY15085.1| GrpE protein [Haliangium ochraceum DSM 14365]
          Length = 260

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 50/174 (28%), Positives = 91/174 (52%), Gaps = 6/174 (3%)

Query: 12  KEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
                +   S+     +      +   + +E  ++ LR  A+++N R+R+ RE  DA++ 
Sbjct: 62  DADEAATGPSAEERIATLEADNAQLAKEKQENWERVLRATADLDNFRKRSRREVDDARTE 121

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
           S +K  R+ML V DNL RA++ A      +         S+I+G+++  R+    LER  
Sbjct: 122 SRSKVLREMLPVIDNLERAIEHAESSDEGANST------SVIDGVKLVLRQFGQALERCE 175

Query: 132 VKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
           VK +DA  + F+P +H+A+ +         ++++V+Q GY I  R+LRP+LV +
Sbjct: 176 VKPVDAFGKPFDPTIHEAISQMESAEHAPGSVVQVLQKGYTIGARLLRPSLVVV 229


>gi|309972794|gb|ADO95995.1| Hsp 24 nucleotide exchange factor GrpE [Haemophilus influenzae
           R2846]
          Length = 230

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 63/207 (30%), Positives = 112/207 (54%), Gaps = 29/207 (14%)

Query: 2   ETFMSEKNIDKEK-------NPSNANSSTAEEKSEINIPEESLNQSEEFRDKY------- 47
           E  MSE+    +              +  AE   E +  EE++ + +E  ++        
Sbjct: 30  EKKMSEQEQKVKNPEVENQEEVVVEETQQAEHSQEFDPLEEAIARVQELEEQLKTQIEEA 89

Query: 48  --------LRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLA 99
                   LR  AE+ENLRRRT+++ + A  +++ KF++D+L+  DNL RAL +      
Sbjct: 90  TNKEQDILLRSRAEIENLRRRTEQDVEKAHKFALEKFSKDILNTIDNLERALAT------ 143

Query: 100 NSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVP 159
               K +  +K+L +G+E+T +E++ST+ R+GV+ +    + FNP++HQA+  +P +   
Sbjct: 144 -PANKEDESVKALFDGVELTLKELVSTVGRFGVEAVGVVGEAFNPDLHQAISMQPAEGFE 202

Query: 160 ANTIIKVVQDGYAINERVLRPALVSIS 186
            N I  V+Q GY ++ RV+RPA+V ++
Sbjct: 203 TNQISVVLQKGYTLSGRVIRPAMVMVA 229


>gi|73540743|ref|YP_295263.1| GrpE protein [Ralstonia eutropha JMP134]
 gi|123774122|sp|Q473L4|GRPE_RALEJ RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|72118156|gb|AAZ60419.1| GrpE protein [Ralstonia eutropha JMP134]
          Length = 184

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 59/187 (31%), Positives = 95/187 (50%), Gaps = 12/187 (6%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
           T   +   +   N + A   TA              ++ E  D Y+R +AE EN+RRR  
Sbjct: 10  TPTPDTAAEAAVNAATAAPETAGADDVAAQLAALEAKAREHYDMYVRAVAEGENIRRRAQ 69

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
            +   A  ++I  FA ++L V D+L  AL     D           +  L EG+E+T R+
Sbjct: 70  EDVSKAHKFAIENFADNLLPVMDSLQAALADGSGD-----------IAKLREGVELTARQ 118

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           + +  ER  + +++   +KF+P+ HQA+   P +   +NT++ V+Q GY I +RVLRPAL
Sbjct: 119 LSAAFERGKIVELNPVGEKFDPHRHQAISMVPSEQ-ESNTVVTVLQRGYTIADRVLRPAL 177

Query: 183 VSISKGK 189
           V++S  K
Sbjct: 178 VTVSAPK 184


>gi|261405587|ref|YP_003241828.1| GrpE protein [Paenibacillus sp. Y412MC10]
 gi|261282050|gb|ACX64021.1| GrpE protein [Paenibacillus sp. Y412MC10]
          Length = 204

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 50/178 (28%), Positives = 88/178 (49%), Gaps = 9/178 (5%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
                      + +A+E +     E+   + +E + + LRV A+ +N RRRT +EK+D  
Sbjct: 36  EAVNPEQEIPVTESADEAAGSAELEKLQAELQEQQQRTLRVQADFDNFRRRTQKEKEDLG 95

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
            Y+ +K   ++L V DN  RAL ++               +S  +G+ M  R++ S L  
Sbjct: 96  KYASSKLITELLPVIDNFERALQASEE---------NPEFESFSKGVNMIFRQLESVLAT 146

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            G+  + +  + FNP  HQA+ +   D      +++ VQ GY + ++VLRPA+V +S 
Sbjct: 147 EGLSAMKSVGEPFNPEYHQAIMQVESDEYEEGIVVEEVQKGYMLKDKVLRPAMVKVSM 204


>gi|121726051|ref|ZP_01679350.1| heat shock protein GrpE [Vibrio cholerae V52]
 gi|229505536|ref|ZP_04395046.1| heat shock protein GrpE [Vibrio cholerae BX 330286]
 gi|229510793|ref|ZP_04400272.1| heat shock protein GrpE [Vibrio cholerae B33]
 gi|229517914|ref|ZP_04407358.1| heat shock protein GrpE [Vibrio cholerae RC9]
 gi|229608556|ref|YP_002879204.1| heat shock protein GrpE [Vibrio cholerae MJ-1236]
 gi|121631533|gb|EAX63903.1| heat shock protein GrpE [Vibrio cholerae V52]
 gi|229344629|gb|EEO09603.1| heat shock protein GrpE [Vibrio cholerae RC9]
 gi|229350758|gb|EEO15699.1| heat shock protein GrpE [Vibrio cholerae B33]
 gi|229357759|gb|EEO22676.1| heat shock protein GrpE [Vibrio cholerae BX 330286]
 gi|229371211|gb|ACQ61634.1| heat shock protein GrpE [Vibrio cholerae MJ-1236]
          Length = 206

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 61/186 (32%), Positives = 107/186 (57%), Gaps = 8/186 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   ++ +ID  +     +   A+          S  + +E +D  LR  AE+EN+RRR+
Sbjct: 29  EVVGTDADIDWNQAADEIDEKEAKIAQLEAALLVSEERVKEQQDSVLRARAEVENMRRRS 88

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           ++E   A+ +++++FA ++L V DNL RA+ +A  ++          +K L+EG+E+T +
Sbjct: 89  EQEVDKARKFALSRFAEELLPVIDNLERAIQAADGEV--------EAIKPLLEGVELTHK 140

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
             + T+ ++G+K+I+   + FNP  HQAM  +       NT++ V+Q GY +N RVLRPA
Sbjct: 141 TFVDTIAKFGLKEINPHGEVFNPEFHQAMSIQESAEHEPNTVMFVMQKGYELNGRVLRPA 200

Query: 182 LVSISK 187
           +V +SK
Sbjct: 201 MVMVSK 206


>gi|304398632|ref|ZP_07380504.1| GrpE protein [Pantoea sp. aB]
 gi|308187819|ref|YP_003931950.1| Protein grpE (HSP-70 cofactor) [Pantoea vagans C9-1]
 gi|304353843|gb|EFM18218.1| GrpE protein [Pantoea sp. aB]
 gi|308058329|gb|ADO10501.1| Protein grpE (HSP-70 cofactor) [Pantoea vagans C9-1]
          Length = 193

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 63/197 (31%), Positives = 105/197 (53%), Gaps = 16/197 (8%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEE--------FRDKYLRVIAE 53
           E     + +  E          AE  +E++  +E + Q E          RD  LR  AE
Sbjct: 5   EQNTPNEQVSDEIQQDQQQPQEAETAAEVDPRDERIAQLEAELAQSQTGVRDAQLRAQAE 64

Query: 54  MENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLI 113
           +EN+RRR + + + A  +++ KFA ++L V D+L RAL+ A  +        +  L S+I
Sbjct: 65  VENIRRRAEMDVEKAHKFALEKFANELLPVIDSLERALEVANKE--------DPQLASMI 116

Query: 114 EGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAI 173
           EGIE+T + ++  + ++GV+ +      FNP +HQAM     +    N ++ V+Q GY +
Sbjct: 117 EGIELTLKGLLGAVRKFGVEVVGETGVPFNPEVHQAMSMMESEEFEPNHVMLVMQRGYTL 176

Query: 174 NERVLRPALVSISKGKT 190
           N R+LRPA+V++SK K+
Sbjct: 177 NGRLLRPAMVAVSKAKS 193


>gi|289615068|emb|CBI58138.1| unnamed protein product [Sordaria macrospora]
          Length = 214

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 64/190 (33%), Positives = 102/190 (53%), Gaps = 8/190 (4%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRD------KYLRVIAEMENLRRRT 61
           +    E        +     +     E    ++ E++D      K LR +A+  NL+ RT
Sbjct: 25  QKKADEGAEKKEGEADDGVAALKKQLEAKDAEAREWKDAPSLQDKCLRTVADFRNLQERT 84

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSE--SVLKSLIEGIEMT 119
            R+ K A+ ++I KFA+D++   DN  RAL   P +   SE+KSE  + L +L EG++MT
Sbjct: 85  ARDVKQAKDFAIQKFAKDLVESVDNFDRALSVVPKEKLKSEEKSEHLNDLVNLYEGLKMT 144

Query: 120 RREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
              ++ TL+++G+++ID   + FNPN H+A F  P      NT+  + Q G+ +N RVLR
Sbjct: 145 ENILLQTLKKHGLERIDPDGEVFNPNEHEATFMAPMPDKEHNTVFHIQQKGFKLNGRVLR 204

Query: 180 PALVSISKGK 189
           PA V + K K
Sbjct: 205 PAQVGVVKNK 214


>gi|19113469|ref|NP_596677.1| mitochondrial GrpE domain chaperone protein [Schizosaccharomyces
           pombe 972h-]
 gi|6225482|sp|O43047|GRPE_SCHPO RecName: Full=GrpE protein homolog, mitochondrial; Flags: Precursor
 gi|2950485|emb|CAA17799.1| mitochondrial GrpE domain chaperone protein [Schizosaccharomyces
           pombe]
          Length = 223

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 56/186 (30%), Positives = 97/186 (52%), Gaps = 5/186 (2%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIP----EESLNQSEEFRDKYLRVIAEMENLRRRTD 62
           E+   +EK     N    E +S+++      E    +  E +    + +A+  NL  R  
Sbjct: 37  EEKPAEEKVAETENVDVKELQSKLSELKSKYEAKDKEVAELKGSIRQSLADYRNLENRMK 96

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           R+ +  +++++ K  +D+L   DNL RAL   P +  N+ ++S   L  L EG+ MT   
Sbjct: 97  RDMEQTRAFAVQKLTKDLLDSVDNLERALSIVPEEKRNN-RESNKDLVDLYEGLAMTESN 155

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           +M TL +YG+ + D   + F+PN+H+A+F+ P +    NT+      G+ +N RV+RPA 
Sbjct: 156 LMKTLGKYGLVRYDGIGEDFDPNIHEAVFQIPVEGKKPNTVFHCESKGFQLNGRVIRPAK 215

Query: 183 VSISKG 188
           V + KG
Sbjct: 216 VGVVKG 221


>gi|328875933|gb|EGG24297.1| molecular chaperone [Dictyostelium fasciculatum]
          Length = 238

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 51/184 (27%), Positives = 88/184 (47%), Gaps = 4/184 (2%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
               K     +  +   +E +     ++   Q E+   + L + A+ EN+R+    E   
Sbjct: 59  TTESKPAAEESTKTEEKKELTLEEQIKDLKTQLEDKHSQLLYIAADRENVRKLGKEETDK 118

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A+ + I  FA+D++ V D L  AL               + LKSL EG++MT +  +  +
Sbjct: 119 AKKFGIQSFAKDLVEVVDQLEMALAQFNEAQLKE----NADLKSLHEGVQMTEKIFLKIM 174

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
              G+++ D   +KF+ N+H A+FE    T    T+  VV++GY +N R++R A V + K
Sbjct: 175 GNNGLERFDPLGEKFDYNLHNAIFEINDPTKENGTVGHVVKNGYKLNNRLVRAAQVGVVK 234

Query: 188 GKTQ 191
            K Q
Sbjct: 235 SKPQ 238


>gi|309781357|ref|ZP_07676093.1| co-chaperone GrpE [Ralstonia sp. 5_7_47FAA]
 gi|308919770|gb|EFP65431.1| co-chaperone GrpE [Ralstonia sp. 5_7_47FAA]
          Length = 203

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 49/158 (31%), Positives = 84/158 (53%), Gaps = 12/158 (7%)

Query: 32  IPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRAL 91
             E +  ++ +  + + R  AE EN+RRR   +   A  ++I  FA  +L V D+L  AL
Sbjct: 58  QLEAAEEKARQNYENWARATAECENIRRRGQDDVAKAHKFAIEGFAEYLLPVMDSLQAAL 117

Query: 92  DSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMF 151
                        +      L EG+E+T +++ +  E+  V +++   +KF+P+ HQA+ 
Sbjct: 118 A-----------DTSGDAAKLREGVELTLKQLYAAFEKGRVTELNPVGEKFDPHRHQAIS 166

Query: 152 EEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
             P     ANT++ V+Q GY + +RVLRPALV+++  K
Sbjct: 167 MVP-ADQEANTVVAVLQRGYTLADRVLRPALVTVAAPK 203


>gi|290476145|ref|YP_003469045.1| Hsp 24 nucleotide exchange factor [Xenorhabdus bovienii SS-2004]
 gi|289175478|emb|CBJ82281.1| Hsp 24 nucleotide exchange factor [Xenorhabdus bovienii SS-2004]
          Length = 193

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 59/181 (32%), Positives = 99/181 (54%), Gaps = 9/181 (4%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           E+ +D EK  +    S  + +      +    Q  E RD  LR  AE+EN+RRRT+ + +
Sbjct: 22  EQQMDAEKADTPETESIVDPRVAELEEQLKQAQIGE-RDAMLRARAEVENIRRRTELDIE 80

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
            A  +++ +FA ++L V DNL RAL++               L  +IEG+E+T +   + 
Sbjct: 81  KAHKFALERFANELLPVIDNLERALEAVDRS--------NDALLPMIEGVELTLKSFTNA 132

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           + ++G++ +   +  FNP +HQAM     D    N ++ V+Q GY +N R+LRPA+V++S
Sbjct: 133 VGKFGIEVVGDTNVPFNPEVHQAMTMMESDQHEPNHVMLVMQKGYTLNGRLLRPAMVAVS 192

Query: 187 K 187
           K
Sbjct: 193 K 193


>gi|260428971|ref|ZP_05782948.1| co-chaperone GrpE [Citreicella sp. SE45]
 gi|260419594|gb|EEX12847.1| co-chaperone GrpE [Citreicella sp. SE45]
          Length = 185

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 57/168 (33%), Positives = 96/168 (57%), Gaps = 10/168 (5%)

Query: 24  AEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSV 83
            E  S     +    + ++F+D+++R +A+ EN R+R D+++++AQ Y   + ARD+L V
Sbjct: 26  KEIDSAEAELDALRAERDQFKDRFMRALADAENARKRADKDRREAQQYGGTRLARDLLPV 85

Query: 84  SDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKF 142
            DN+ RAL  A  + A           +LIEG+E+T RE+++   ++G+  I  +   KF
Sbjct: 86  YDNMQRALSVAREEKAGD---------ALIEGVELTLRELLNVFSKHGMTAIKPEVGDKF 136

Query: 143 NPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           +P  H+AMFE P     A  II+V  +G+ + +R+LRPA V +S    
Sbjct: 137 DPQQHEAMFEAPVPGTRAGEIIQVSAEGFMLYDRLLRPAQVGVSSMPA 184


>gi|157371919|ref|YP_001479908.1| heat shock protein GrpE [Serratia proteamaculans 568]
 gi|167008735|sp|A8GI40|GRPE_SERP5 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|157323683|gb|ABV42780.1| GrpE protein [Serratia proteamaculans 568]
          Length = 190

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 60/184 (32%), Positives = 101/184 (54%), Gaps = 9/184 (4%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR-DKYLRVIAEMENLRRRTDREKK 66
           + +++++    A          I   E  L ++++   D  LR  AEMEN+RRRT+ + +
Sbjct: 15  EEMEQQEVLPEAAEGVDLRDERIAELEAQLAEAQQHERDSLLRAKAEMENVRRRTELDIE 74

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
            A  +++ KF+ D+L V DNL RAL+ A          +   L ++IEGIE+T + +   
Sbjct: 75  KAHKFALEKFSGDLLPVLDNLERALELADK--------NNPELTAMIEGIELTLKSLQDV 126

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           + +YG++ +   +  FNP +HQAM          N ++ V+Q GY +N R+LRPA+V++S
Sbjct: 127 VRKYGIEIVGDTNVPFNPEVHQAMSLMESADHQPNHVMMVMQKGYTLNGRLLRPAMVAVS 186

Query: 187 KGKT 190
           K K 
Sbjct: 187 KAKA 190


>gi|119963452|ref|YP_947626.1| co-chaperone GrpE [Arthrobacter aurescens TC1]
 gi|119950311|gb|ABM09222.1| co-chaperone GrpE [Arthrobacter aurescens TC1]
          Length = 180

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 48/175 (27%), Positives = 82/175 (46%), Gaps = 11/175 (6%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
            +P +  + TA       +P  S     +  D + R +A+ +N+R+R  RE    ++   
Sbjct: 11  ADPGSDGTETAAAGETETMPGASAEALAKMEDLWRRALADADNIRKRAAREASQLRAQER 70

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
           A  +   L V DNL  AL  AP                L++G++  R + +  L R G  
Sbjct: 71  AAVSLLWLPVLDNLELALAHAPSAGDP-----------LVDGLDAIRSQAIDILARLGYP 119

Query: 134 KIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           +ID ++  F+P +H+ +     D VP  T+I V++ GY   + +LRPA V +S+ 
Sbjct: 120 RIDGENVPFDPRIHEVVSVSETDDVPPGTVITVLRPGYGGTDTILRPAAVVVSRA 174


>gi|121534800|ref|ZP_01666620.1| GrpE protein [Thermosinus carboxydivorans Nor1]
 gi|121306595|gb|EAX47517.1| GrpE protein [Thermosinus carboxydivorans Nor1]
          Length = 199

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 51/179 (28%), Positives = 84/179 (46%), Gaps = 11/179 (6%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           E+   +E           + +  +    E     EE  ++  R+ A+ +N RRRT +EK 
Sbjct: 28  EEKDQEEIKDQEVCFPQEDVERLLASIAEKNRLHEEMMERLKRLQADFDNFRRRTRQEKD 87

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
           D            +L V DN  RAL +A  D A           +L  G+EM  R+    
Sbjct: 88  DLSKVVTEGIVLQLLPVLDNFERALSAATEDAA-----------ALRAGVEMIYRQFTQA 136

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
           LE+ GV+ I+A    F+P  H+A+        P NT+++V+Q GY ++ +V+RP++V +
Sbjct: 137 LEKMGVQPIEAAGAVFDPQYHEAVIRVEDPDRPDNTVVEVLQKGYMVHGKVIRPSMVKV 195


>gi|293394815|ref|ZP_06639105.1| co-chaperone GrpE [Serratia odorifera DSM 4582]
 gi|291422566|gb|EFE95805.1| co-chaperone GrpE [Serratia odorifera DSM 4582]
          Length = 193

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 63/184 (34%), Positives = 103/184 (55%), Gaps = 9/184 (4%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR-DKYLRVIAEMENLRRRTDREKK 66
           +N+  E+    A          I   E  L ++++   D  LR  AEMEN+RRRT+ + +
Sbjct: 18  ENVQHEEQQPEAAEGVDLRDQRIAELEAQLAEAQQRERDSLLRAKAEMENVRRRTELDIE 77

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
            A  +++ KF+ D+L V DNL RAL+ A         ++   L ++IEGIE+T + +   
Sbjct: 78  KAHKFALEKFSADLLPVIDNLERALELAD--------RNNPELAAMIEGIELTLKSLQDA 129

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           + +YG++ +   +  FNP++HQAM     D    N ++ V+Q GY +N R+LRPA+V++S
Sbjct: 130 VRKYGIEIVGDVNVPFNPDVHQAMSLMESDQHQPNHVMMVMQKGYTLNGRLLRPAMVAVS 189

Query: 187 KGKT 190
           K K 
Sbjct: 190 KAKA 193


>gi|229523341|ref|ZP_04412748.1| heat shock protein GrpE [Vibrio cholerae TM 11079-80]
 gi|229525477|ref|ZP_04414882.1| heat shock protein GrpE [Vibrio cholerae bv. albensis VL426]
 gi|229530038|ref|ZP_04419428.1| heat shock protein GrpE [Vibrio cholerae 12129(1)]
 gi|229333812|gb|EEN99298.1| heat shock protein GrpE [Vibrio cholerae 12129(1)]
 gi|229339058|gb|EEO04075.1| heat shock protein GrpE [Vibrio cholerae bv. albensis VL426]
 gi|229339704|gb|EEO04719.1| heat shock protein GrpE [Vibrio cholerae TM 11079-80]
          Length = 206

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 61/186 (32%), Positives = 107/186 (57%), Gaps = 8/186 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   ++ +ID  +     +   A+          S  + +E +D  LR  AE+EN+RRR+
Sbjct: 29  EVVGTDADIDWNQAADEIDEKEAKIAQLEAALLVSEERVKEQQDSVLRARAEVENMRRRS 88

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           ++E   A+ +++++FA ++L V DNL RA+ +A  ++          +K L+EG+E+T +
Sbjct: 89  EQEVDKARKFALSRFAEELLPVIDNLERAIQAADGEV--------EAIKPLLEGVELTHK 140

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
             + T+ ++G+K+I+   + FNP  HQAM  +       NT++ V+Q GY +N RVLRPA
Sbjct: 141 TFVDTIAKFGLKEINPHGEAFNPEFHQAMSIQESAEHEPNTVMFVMQKGYELNGRVLRPA 200

Query: 182 LVSISK 187
           +V +SK
Sbjct: 201 MVMVSK 206


>gi|319763797|ref|YP_004127734.1| grpe protein [Alicycliphilus denitrificans BC]
 gi|330823939|ref|YP_004387242.1| GrpE protein [Alicycliphilus denitrificans K601]
 gi|317118358|gb|ADV00847.1| GrpE protein [Alicycliphilus denitrificans BC]
 gi|329309311|gb|AEB83726.1| GrpE protein [Alicycliphilus denitrificans K601]
          Length = 180

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 59/162 (36%), Positives = 83/162 (51%), Gaps = 13/162 (8%)

Query: 29  EINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLS 88
                 E   +S E  D++LR  AE EN RRR + E   A+ + I  FA  +L V D+L 
Sbjct: 31  LQAELAELKAKSAELADQFLRAKAEAENARRRAEEEVSKARKFGIESFAESLLPVCDSLD 90

Query: 89  RALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDA-KDQKFNPNMH 147
            AL               +  + L EG + T R+++  LER  V  I+     KF+P+ H
Sbjct: 91  AALSI-----------ESATAEQLREGSDATLRQLVGALERNKVVVINPASGAKFDPHQH 139

Query: 148 QAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
           QA+   P     ANTI+ V+Q GY I +RVLRPALV+++  K
Sbjct: 140 QAISMVP-ADQEANTIVSVLQKGYLIADRVLRPALVTVAASK 180


>gi|148262293|ref|YP_001228999.1| heat shock protein GrpE [Geobacter uraniireducens Rf4]
 gi|189041742|sp|A5GDC7|GRPE_GEOUR RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|146395793|gb|ABQ24426.1| GrpE protein [Geobacter uraniireducens Rf4]
          Length = 199

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 58/188 (30%), Positives = 93/188 (49%), Gaps = 11/188 (5%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
            ++    E  P +   S  + K           ++    DK LR  A++EN R+R  +EK
Sbjct: 22  EQETATPEPTPQSETESADKIKQLEEALAAKEAEAAANWDKVLRERADLENYRKRVQKEK 81

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
           ++   Y       ++L   DN+ RAL+ A           +  + +++EGI+MT   + S
Sbjct: 82  EELLKYGNESLILEILPAIDNMERALEHA----------CDESMSAIVEGIKMTLCMLQS 131

Query: 126 TLERYGVKKIDA-KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
           TL+++GV  +DA K   F+P  HQAM +        NTI+   Q GY +NER+LRPALVS
Sbjct: 132 TLKKFGVAPVDAGKGTTFDPAYHQAMNQVESSEHEPNTIVSEFQKGYLLNERLLRPALVS 191

Query: 185 ISKGKTQN 192
           ++    + 
Sbjct: 192 VATAPKEQ 199


>gi|301105118|ref|XP_002901643.1| Mitochondrial Protein Translocase (MPT) Family [Phytophthora
           infestans T30-4]
 gi|262100647|gb|EEY58699.1| Mitochondrial Protein Translocase (MPT) Family [Phytophthora
           infestans T30-4]
          Length = 218

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 56/184 (30%), Positives = 101/184 (54%), Gaps = 1/184 (0%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
                K  +      ++ +      EE   Q+++  D+ LR +A+ EN+RR +  +  +A
Sbjct: 36  EETAAKTEAEEEPPLSDAEKLQKQVEELTTQNKDMNDRLLRALADAENVRRISRVDVNNA 95

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
           + ++I+KFA+ +L VSDNL RA +S  +     EK+    ++ L EG+ MT +++     
Sbjct: 96  REFAISKFAKALLDVSDNLKRAHESIDVATLQPEKQL-DAIEMLHEGVVMTEQQLQKVFR 154

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
            + + ++ A   KF+PN+H A+FE    T  A +I ++++ GY +NERV+RPA V + K 
Sbjct: 155 EFKINQVGAVGDKFDPNVHDALFEYEDATKEAGSIGQLMKTGYLLNERVIRPAQVGVVKA 214

Query: 189 KTQN 192
             + 
Sbjct: 215 PKEQ 218


>gi|119486415|ref|ZP_01620473.1| GrpE protein [Lyngbya sp. PCC 8106]
 gi|119456317|gb|EAW37448.1| GrpE protein [Lyngbya sp. PCC 8106]
          Length = 255

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 47/198 (23%), Positives = 88/198 (44%), Gaps = 8/198 (4%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
               ++  S +     E  +     +    Q +E   +Y R+ A+ EN R+RT +EK+D 
Sbjct: 66  ESQMQEESSTSEQIQQELVALAQANQALTAQLDEINTQYRRLAADFENFRKRTQKEKEDL 125

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
           +        + +L V DN  RA         +          ++ +  +   ++M+ +L+
Sbjct: 126 EVQIKCNTIKKLLPVIDNFERARSHIKPQTESEM--------NIHKSYQSVYKQMVESLK 177

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           + GV  +    + F+PN+H+A+  E  +T P  T+I+ +  GY I ERVLR A+V ++  
Sbjct: 178 QLGVSAMRPDGEPFDPNLHEAVMREASETHPEGTVIEEMMRGYMIGERVLRHAMVKVATA 237

Query: 189 KTQNPTEEKKETIEQPSP 206
              + + E       P  
Sbjct: 238 PESSSSSETDSEAPAPQE 255


>gi|256996829|dbj|BAI22705.1| GrpE protein [Acetobacter pasteurianus]
          Length = 198

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 59/181 (32%), Positives = 97/181 (53%), Gaps = 4/181 (2%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +    E   +   +   +        +E    + +F++K LR  AE +NLR R  R+  D
Sbjct: 21  EQTAPEHEAAAEAAQNGQPSGPEARIQELEQTAADFKEKLLRSEAENQNLRARAKRDLDD 80

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A+ Y++ KFARD++  ++NL RAL S P          +SVL  + EGIE T R  +S L
Sbjct: 81  ARQYAVQKFARDVVEAAENLRRALASLPPAQEGE----DSVLTKMREGIESTERSFISIL 136

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           ER+G+K  D   + F+ N+HQAM E+P       T+++     + ++ R+L+PA+V ++K
Sbjct: 137 ERHGIKCDDPAGKPFDANLHQAMAEQPSAEHEPGTVMQAWTPTWTLHGRLLKPAMVVVAK 196

Query: 188 G 188
            
Sbjct: 197 A 197


>gi|149375771|ref|ZP_01893539.1| Molecular chaperone GrpE (heat shock protein) [Marinobacter
           algicola DG893]
 gi|149359896|gb|EDM48352.1| Molecular chaperone GrpE (heat shock protein) [Marinobacter
           algicola DG893]
          Length = 201

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 53/191 (27%), Positives = 105/191 (54%), Gaps = 5/191 (2%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           K+  +        +  + E    +  E    Q++EF+++ LR  AEM+N+RRR + + + 
Sbjct: 16  KDTAEAAPEEETATEDSAEAGPESEIEVLKAQAQEFQEQMLRSQAEMQNVRRRAEIDVEK 75

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A  +++ KF +++L V+D+L +A++S              ++ S+ EG+EMT    M +L
Sbjct: 76  AHKFALEKFVKELLPVADSLEKAVESTEGHENAG-----ELVASIREGVEMTLNLFMGSL 130

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            ++ V +++   + F+P  H+AM   P      N+++ VVQ GY +N+R++RPA+V ++K
Sbjct: 131 GKFNVVQLNPVGEPFDPQQHEAMSMVPAPDAEPNSVVAVVQKGYTLNDRLVRPAMVVVAK 190

Query: 188 GKTQNPTEEKK 198
            +     +E+ 
Sbjct: 191 AEDAPKIDEQA 201


>gi|320335122|ref|YP_004171833.1| protein grpE [Deinococcus maricopensis DSM 21211]
 gi|319756411|gb|ADV68168.1| Protein grpE [Deinococcus maricopensis DSM 21211]
          Length = 205

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 44/167 (26%), Positives = 84/167 (50%), Gaps = 13/167 (7%)

Query: 21  SSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDM 80
           +   E   ++   +E   ++ E + K  R+ A+ +N RRRT ++ +DAQ   +AK A  +
Sbjct: 50  AQVQEMMEKLGKVDELERENAELKGKLGRLAADFDNYRRRTQQDVQDAQGQGVAKAAEAL 109

Query: 81  LSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQ 140
           + V D+L RA+     D A            LI G++  +  ++      G++    + +
Sbjct: 110 MPVYDDLDRAVTMGSGDPA-----------KLIPGVQAVQATVLRIFANLGLEATGQEGE 158

Query: 141 KFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            F+P  H+A+   P +    + I++V Q G+ + +R++RPA V +SK
Sbjct: 159 AFDPQWHEALQVIPGEQ--DDVIVQVYQRGFRMGDRLVRPARVVVSK 203


>gi|37523763|ref|NP_927140.1| heat shock protein [Gloeobacter violaceus PCC 7421]
 gi|52782906|sp|Q7NDP1|GRPE_GLOVI RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|35214768|dbj|BAC92135.1| heat shock protein [Gloeobacter violaceus PCC 7421]
          Length = 196

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 47/160 (29%), Positives = 79/160 (49%), Gaps = 8/160 (5%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
                   +   +  ++  KY R++A+ +N R+RT REK +   +  AK  +D+L V DN
Sbjct: 39  DQLAAENSDLQKKLADYEQKYTRLMADFDNFRKRTQREKDELAYFVSAKLLKDILPVFDN 98

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNM 146
             RA   A  D            + L    +   R+ +S LE+ GV  ++A  Q F+P  
Sbjct: 99  FDRARAFAQPD--------NEREEKLHNSYQQVYRQFLSVLEKMGVTAMEAIGQPFDPAQ 150

Query: 147 HQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           H+A+  E    V   T++  +Q GY + ++VLRPA+V ++
Sbjct: 151 HEAILREESAGVSQETVVAELQKGYLLADKVLRPAMVKVA 190


>gi|282891098|ref|ZP_06299603.1| hypothetical protein pah_c045o129 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281499091|gb|EFB41405.1| hypothetical protein pah_c045o129 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 214

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 41/191 (21%), Positives = 83/191 (43%), Gaps = 8/191 (4%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
              +   +P    +       +    E     + + +DKYLR++AE +N R+R  +E+++
Sbjct: 32  DQGEANASPQKEEAEPKVISIDEKEIEALRRDAADNKDKYLRILAESDNQRKRLQKERQE 91

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
              Y+I     D L+  D++  AL          + +    +K    G EM   +    L
Sbjct: 92  LIQYAIQNVIADFLNPIDHMENALKF--------KDQMSPEVKGWALGFEMILNQFKDVL 143

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
              GV  + +    F+P+ H+A+     +     T+++    GY + ++V+RPA V ++K
Sbjct: 144 ANNGVIPMTSVGTPFDPHFHEAIEMVETNEFAPGTVVEENLKGYKMGDKVIRPARVKVAK 203

Query: 188 GKTQNPTEEKK 198
                 +E+ +
Sbjct: 204 AVNGQTSEQTE 214


>gi|34556918|ref|NP_906733.1| heat shock protein GrpE [Wolinella succinogenes DSM 1740]
 gi|52782901|sp|Q7MA34|GRPE_WOLSU RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|34482633|emb|CAE09633.1| GRPE PROTEIN (HSP-70 COFACTOR) [Wolinella succinogenes]
          Length = 184

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 60/187 (32%), Positives = 96/187 (51%), Gaps = 5/187 (2%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           M    +     +E+    +  ST E  S+ +   E   + +E  D YLRV A+ EN ++R
Sbjct: 1   MNDNPANAEPQEEEVSLESQPSTPESGSDGSKEAELEAKIKELEDSYLRVHADFENTKKR 60

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
            +REK  A  Y+  K A+D+L + D L  AL SA             +     EG+E+T 
Sbjct: 61  LEREKFQALEYAYEKIAKDLLPIVDTLEIALKSANEVSGEE----SELQAKFKEGLELTL 116

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
                 L+R+G++ I  +  +F+P++H+ + + P  +     I++V Q GY   ERVLRP
Sbjct: 117 DNFSKVLQRHGIEMIACEG-EFDPHLHECIMQVPSPSHQEGEIVQVFQKGYRYKERVLRP 175

Query: 181 ALVSISK 187
           A+VSI+K
Sbjct: 176 AMVSIAK 182


>gi|241664052|ref|YP_002982412.1| heat shock protein GrpE [Ralstonia pickettii 12D]
 gi|240866079|gb|ACS63740.1| GrpE protein [Ralstonia pickettii 12D]
          Length = 215

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 49/158 (31%), Positives = 84/158 (53%), Gaps = 12/158 (7%)

Query: 32  IPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRAL 91
             E +  ++ +  + + R  AE EN+RRR   +   A  ++I  FA  +L V D+L  AL
Sbjct: 70  QLEAAEEKARQNYENWARATAECENIRRRGQDDVAKAHKFAIEGFAEYLLPVMDSLQAAL 129

Query: 92  DSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMF 151
                        +      L EG+E+T +++ +  E+  V +++   +KF+P+ HQA+ 
Sbjct: 130 A-----------DTSGDAAKLREGVELTLKQLYAAFEKGRVTELNPVGEKFDPHRHQAIS 178

Query: 152 EEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
             P     ANT++ V+Q GY + +RVLRPALV+++  K
Sbjct: 179 MVP-ADQEANTVVAVLQRGYTLADRVLRPALVTVAAPK 215


>gi|295675592|ref|YP_003604116.1| GrpE protein [Burkholderia sp. CCGE1002]
 gi|295435435|gb|ADG14605.1| GrpE protein [Burkholderia sp. CCGE1002]
          Length = 195

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 52/170 (30%), Positives = 91/170 (53%), Gaps = 12/170 (7%)

Query: 20  NSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARD 79
            ++ + + +      ++  +  E ++ +LR  AE EN+RRR   +   A  ++I  FA  
Sbjct: 38  ATTESAQAAAEQALADAQAKIAELQEDFLRAKAETENVRRRAQEDVAKAHKFAIENFAEH 97

Query: 80  MLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKD 139
           +L V D+L  A+  +  D           L+ + EG+E+T R++   LE+  V  I+   
Sbjct: 98  LLPVVDSLEAAVAHSSDD-----------LQKVREGVELTLRQLSGALEKGRVVAINPVG 146

Query: 140 QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
           +KF+P+ HQA+   P      NT++ V+Q G+ I +RVLRPALV+++  K
Sbjct: 147 EKFDPHRHQAISMVP-ADQEPNTVVAVLQKGFVIADRVLRPALVTVAAPK 195


>gi|84684656|ref|ZP_01012557.1| putative chaperone protein GrpE (heat shock protein)
           [Maritimibacter alkaliphilus HTCC2654]
 gi|84667635|gb|EAQ14104.1| putative chaperone protein GrpE (heat shock protein)
           [Rhodobacterales bacterium HTCC2654]
          Length = 199

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 57/191 (29%), Positives = 109/191 (57%), Gaps = 9/191 (4%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           +E  M+++         +  +  A+   E++  E    + ++ +DK++R +A+ EN R+R
Sbjct: 17  IEEIMADQGKSDLPEDEDV-APEADPLEEVDEVEALRIERDQLKDKFMRALADAENARKR 75

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           +DR++++A++Y  +K ARDML V DN+ RA+++   DL             L EG+E+T 
Sbjct: 76  SDRDRREAENYGGSKLARDMLPVYDNMKRAMEAIDDDLR-------EKASGLTEGLELTM 128

Query: 121 REMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
           RE+++   ++G++ +  +   KF+P  H+AMFE P        II+V+ +G+ +++R+LR
Sbjct: 129 RELLNIFSKHGIRILAPEVGDKFDPIEHEAMFEAPVPGTNKGEIIQVMAEGFMLHDRLLR 188

Query: 180 PALVSISKGKT 190
            A V +S    
Sbjct: 189 AAQVGVSSNPG 199


>gi|45440883|ref|NP_992422.1| heat shock protein GrpE [Yersinia pestis biovar Microtus str.
           91001]
 gi|51595485|ref|YP_069676.1| heat shock protein GrpE [Yersinia pseudotuberculosis IP 32953]
 gi|145599855|ref|YP_001163931.1| heat shock protein GrpE [Yersinia pestis Pestoides F]
 gi|153947129|ref|YP_001401850.1| heat shock protein GrpE [Yersinia pseudotuberculosis IP 31758]
 gi|162419727|ref|YP_001605904.1| heat shock protein GrpE [Yersinia pestis Angola]
 gi|166211740|ref|ZP_02237775.1| co-chaperone GrpE [Yersinia pestis biovar Antiqua str. B42003004]
 gi|170025196|ref|YP_001721701.1| heat shock protein GrpE [Yersinia pseudotuberculosis YPIII]
 gi|186894538|ref|YP_001871650.1| heat shock protein GrpE [Yersinia pseudotuberculosis PB1/+]
 gi|229893984|ref|ZP_04509170.1| heat shock protein [Yersinia pestis Pestoides A]
 gi|81691854|sp|Q66DA8|GRPE_YERPS RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|166215292|sp|A4TNU6|GRPE_YERPP RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|167008737|sp|A7FKS2|GRPE_YERP3 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737239|sp|B2K8E3|GRPE_YERPB RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737240|sp|A9R2E4|GRPE_YERPG RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737241|sp|B1JG65|GRPE_YERPY RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|45435741|gb|AAS61299.1| heat shock protein GrpE [Yersinia pestis biovar Microtus str.
           91001]
 gi|51588767|emb|CAH20381.1| heat shock protein GrpE [Yersinia pseudotuberculosis IP 32953]
 gi|145211551|gb|ABP40958.1| heat shock protein GrpE [Yersinia pestis Pestoides F]
 gi|152958624|gb|ABS46085.1| co-chaperone GrpE [Yersinia pseudotuberculosis IP 31758]
 gi|162352542|gb|ABX86490.1| co-chaperone GrpE [Yersinia pestis Angola]
 gi|166207511|gb|EDR51991.1| co-chaperone GrpE [Yersinia pestis biovar Antiqua str. B42003004]
 gi|169751730|gb|ACA69248.1| GrpE protein [Yersinia pseudotuberculosis YPIII]
 gi|186697564|gb|ACC88193.1| GrpE protein [Yersinia pseudotuberculosis PB1/+]
 gi|229703869|gb|EEO90882.1| heat shock protein [Yersinia pestis Pestoides A]
          Length = 192

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 57/190 (30%), Positives = 100/190 (52%), Gaps = 9/190 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPE-ESLNQSEEFRDKYLRVIAEMENLRRR 60
           E    E     E+       +       +   E +  +  +  R+  LR  AE+EN+RRR
Sbjct: 11  EQVSEEMENTAEQQVEATQETGECVDPRVAELEVQLSDALQRERESLLRAKAEVENIRRR 70

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+ + + A  +++ +F+ ++L V DNL RALD+A            + L S+IEG+E+T 
Sbjct: 71  TELDVEKAHKFALERFSSELLPVIDNLERALDTADKT--------NTELTSMIEGVELTL 122

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + ++  + ++G++ +      FNP +HQAM          N ++ V+Q GY +N R+LRP
Sbjct: 123 KSLLDAVGKFGIEVVGETHVPFNPEVHQAMTMLESADHEPNHVMMVMQKGYTLNGRLLRP 182

Query: 181 ALVSISKGKT 190
           A+V++SK K+
Sbjct: 183 AMVAVSKAKS 192


>gi|52788295|sp|Q9CNU1|GRPE_PASMU RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
          Length = 197

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 52/167 (31%), Positives = 95/167 (56%), Gaps = 7/167 (4%)

Query: 20  NSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARD 79
           +           +  +     ++ +D  LR  AEM+N+RRR +++ + A  + + KF++D
Sbjct: 37  DPLEEAILRVQELEAQLTEMVKKEQDFLLRSRAEMDNIRRRAEQDVEKAHKFGLEKFSKD 96

Query: 80  MLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKD 139
           +L+  DNL RAL +            +  +KSL +G+E+T +E+++T+ R+GV+ +    
Sbjct: 97  ILNTIDNLERALAT-------PANLEDESIKSLFDGVELTLKELLATVSRFGVEAVGVVG 149

Query: 140 QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           + FNP +HQA+  +P +    N I  V+Q GY +N RV+RPA+V ++
Sbjct: 150 ETFNPEVHQAISMQPMEGFETNQITVVLQKGYLLNGRVIRPAMVMVA 196


>gi|302659226|ref|XP_003021306.1| hypothetical protein TRV_04582 [Trichophyton verrucosum HKI 0517]
 gi|291185198|gb|EFE40688.1| hypothetical protein TRV_04582 [Trichophyton verrucosum HKI 0517]
          Length = 245

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 55/172 (31%), Positives = 95/172 (55%), Gaps = 7/172 (4%)

Query: 24  AEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSV 83
           +E ++     E    +  + +DKYLR +A+  NL+ RT R+ + A++++I KFA D++  
Sbjct: 73  SELETLKKDLETREKEVVDLKDKYLRSVADFRNLQERTRRDIEAARTFAIQKFAADLIES 132

Query: 84  SDNLSRALDSAPLDL-ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKD--- 139
            DNL RAL + P +    +  K    +  L  G++MT   +M+TL+++GV + D  +   
Sbjct: 133 IDNLERALAAVPPEKVDAANAKENKDVYELFSGLKMTEGVLMNTLKKHGVVRFDPSELVD 192

Query: 140 ---QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
              QKF+P+ H+A+F  P +      I+ V   G+ +N R+LR A V + K 
Sbjct: 193 GQPQKFDPSRHEALFMSPMEGKQDGDIMHVQNKGFTLNGRILRAAKVGVVKN 244


>gi|22126949|ref|NP_670372.1| heat shock protein GrpE [Yersinia pestis KIM 10]
 gi|108806582|ref|YP_650498.1| heat shock protein GrpE [Yersinia pestis Antiqua]
 gi|108813051|ref|YP_648818.1| heat shock protein GrpE [Yersinia pestis Nepal516]
 gi|149366893|ref|ZP_01888927.1| heat shock protein GrpE [Yersinia pestis CA88-4125]
 gi|165924334|ref|ZP_02220166.1| co-chaperone GrpE [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165938295|ref|ZP_02226853.1| co-chaperone GrpE [Yersinia pestis biovar Orientalis str. IP275]
 gi|166011530|ref|ZP_02232428.1| co-chaperone GrpE [Yersinia pestis biovar Antiqua str. E1979001]
 gi|167399986|ref|ZP_02305504.1| co-chaperone GrpE [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167419737|ref|ZP_02311490.1| co-chaperone GrpE [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167423879|ref|ZP_02315632.1| co-chaperone GrpE [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|218928275|ref|YP_002346150.1| heat shock protein GrpE [Yersinia pestis CO92]
 gi|229841043|ref|ZP_04461202.1| heat shock protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229843147|ref|ZP_04463293.1| heat shock protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229903492|ref|ZP_04518605.1| heat shock protein [Yersinia pestis Nepal516]
 gi|270487274|ref|ZP_06204348.1| co-chaperone GrpE [Yersinia pestis KIM D27]
 gi|294503115|ref|YP_003567177.1| heat shock protein GrpE [Yersinia pestis Z176003]
 gi|52782898|sp|Q7CH40|GRPE_YERPE RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|123245957|sp|Q1CAG9|GRPE_YERPA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|123373002|sp|Q1CFL2|GRPE_YERPN RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|21959990|gb|AAM86623.1|AE013908_6 heat shock protein [Yersinia pestis KIM 10]
 gi|108776699|gb|ABG19218.1| heat shock protein GrpE [Yersinia pestis Nepal516]
 gi|108778495|gb|ABG12553.1| heat shock protein GrpE [Yersinia pestis Antiqua]
 gi|115346886|emb|CAL19773.1| heat shock protein GrpE [Yersinia pestis CO92]
 gi|149291267|gb|EDM41342.1| heat shock protein GrpE [Yersinia pestis CA88-4125]
 gi|165913673|gb|EDR32292.1| co-chaperone GrpE [Yersinia pestis biovar Orientalis str. IP275]
 gi|165923394|gb|EDR40526.1| co-chaperone GrpE [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165989478|gb|EDR41779.1| co-chaperone GrpE [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166962478|gb|EDR58499.1| co-chaperone GrpE [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167050694|gb|EDR62102.1| co-chaperone GrpE [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167056728|gb|EDR66491.1| co-chaperone GrpE [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|229679262|gb|EEO75365.1| heat shock protein [Yersinia pestis Nepal516]
 gi|229689494|gb|EEO81555.1| heat shock protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229697409|gb|EEO87456.1| heat shock protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|262361151|gb|ACY57872.1| heat shock protein GrpE [Yersinia pestis D106004]
 gi|262365295|gb|ACY61852.1| heat shock protein GrpE [Yersinia pestis D182038]
 gi|270335778|gb|EFA46555.1| co-chaperone GrpE [Yersinia pestis KIM D27]
 gi|294353574|gb|ADE63915.1| heat shock protein GrpE [Yersinia pestis Z176003]
 gi|320014246|gb|ADV97817.1| heat shock protein [Yersinia pestis biovar Medievalis str. Harbin
           35]
          Length = 192

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 57/190 (30%), Positives = 100/190 (52%), Gaps = 9/190 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPE-ESLNQSEEFRDKYLRVIAEMENLRRR 60
           E    E     E+       +       +   E +  +  +  R+  LR  AE+EN+RRR
Sbjct: 11  EQVSEEMENTAEQQVEATQETGECVDPRVAELEVQLSDALQRERESLLRAKAEVENIRRR 70

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+ + + A  +++ +F+ ++L V DNL RALD+A            + L S+IEG+E+T 
Sbjct: 71  TELDVEKAHKFALERFSSELLPVIDNLERALDTADKT--------NTELISMIEGVELTL 122

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + ++  + ++G++ +      FNP +HQAM          N ++ V+Q GY +N R+LRP
Sbjct: 123 KSLLDAVGKFGIEVVGETHVPFNPEVHQAMTMLESADHEPNHVMMVMQKGYTLNGRLLRP 182

Query: 181 ALVSISKGKT 190
           A+V++SK K+
Sbjct: 183 AMVAVSKAKS 192


>gi|229513042|ref|ZP_04402508.1| heat shock protein GrpE [Vibrio cholerae TMA 21]
 gi|229349935|gb|EEO14889.1| heat shock protein GrpE [Vibrio cholerae TMA 21]
          Length = 206

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 61/186 (32%), Positives = 107/186 (57%), Gaps = 8/186 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   ++ +ID  +     +   A+          S  + +E +D  LR  AE+EN+RRR+
Sbjct: 29  EVVGTDADIDWNQAADEIDEKEAKIAQLEAALLVSEERVKEQQDSVLRARAEVENMRRRS 88

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           ++E   A+ +++++FA ++L V DNL RA+ +A  ++          +K L+EG+E+T +
Sbjct: 89  EQEVDKARKFALSRFAEELLPVIDNLERAIQAADGEV--------EAIKPLLEGVELTHK 140

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
             + T+ ++G+K+I+   + FNP  HQAM  +       NT++ V+Q GY +N RVLRPA
Sbjct: 141 TFVDTIAKFGLKEINPHGEAFNPEFHQAMSIQESAEHEPNTVMFVMQKGYELNGRVLRPA 200

Query: 182 LVSISK 187
           +V +SK
Sbjct: 201 MVMVSK 206


>gi|311897204|dbj|BAJ29612.1| putative GrpE protein [Kitasatospora setae KM-6054]
          Length = 196

 Score =  112 bits (281), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 38/212 (17%), Positives = 93/212 (43%), Gaps = 23/212 (10%)

Query: 5   MSEKNIDKEKNPSNANSST-------AEEKSEINIPEESLNQSEEFRDKYLRVIAEMENL 57
           M+EK   ++    +A           A   +  +    +  ++ E      R+ AE +N 
Sbjct: 1   MTEKPQGEQPGDDSAAEEAVLKAAEEAVAGAGADELAAAKREAGERTADLQRLQAEYQNY 60

Query: 58  RRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIE 117
           R+R +R++   +  +++     ++ V D++ RA +                   +  G +
Sbjct: 61  RKRVERDRSTVREIAVSNILESLVPVLDDIGRAREHGE----------------VTGGFK 104

Query: 118 MTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERV 177
                + + + + G+++   + + F+P +H+A+       V  +T ++++Q GY I ER+
Sbjct: 105 SVAESLETVVAKLGLQQFGKEGEPFDPTIHEALMHSYSSDVTEDTCVQILQPGYRIGERI 164

Query: 178 LRPALVSISKGKTQNPTEEKKETIEQPSPLDI 209
           +RPA+V++++ +    T  + +  +   P D 
Sbjct: 165 IRPAMVAVAEPQPGTQTTGEPDGDKADGPSDS 196


>gi|303279236|ref|XP_003058911.1| mitochondrial protein translocase family [Micromonas pusilla
           CCMP1545]
 gi|226460071|gb|EEH57366.1| mitochondrial protein translocase family [Micromonas pusilla
           CCMP1545]
          Length = 303

 Score =  112 bits (281), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 41/192 (21%), Positives = 87/192 (45%), Gaps = 12/192 (6%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEE---SLNQSEEFRDKYLRVIAEMENLRRRTDR 63
           E+++D  +    A    A E +  ++        +Q+   +D+YLR+ A+ +N ++RT +
Sbjct: 120 EESMDAPELAELAAEVKAIETAFKDLQAANVGLEDQTGALKDQYLRLNADFDNFKKRTIK 179

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           EK+   + + ++    ML   DN   A  +   +            + + +  E     +
Sbjct: 180 EKEQLATNAKSRVFEAMLPALDNFDLAKANLKTE--------NEGEEKIAKSYEGLVDGL 231

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAIN-ERVLRPAL 182
           M+ L   G+  +      F+PN H+A+  E  +  P +TI +  + GY +  ++++R A+
Sbjct: 232 MTILSAQGLSTVAGVGSPFDPNFHEAIMREESEEHPEDTISEEFRKGYKMGEDQLVRAAM 291

Query: 183 VSISKGKTQNPT 194
           V +S G   +  
Sbjct: 292 VKVSSGPPASEE 303


>gi|261252217|ref|ZP_05944790.1| heat shock protein GrpE [Vibrio orientalis CIP 102891]
 gi|260935608|gb|EEX91597.1| heat shock protein GrpE [Vibrio orientalis CIP 102891]
          Length = 198

 Score =  112 bits (281), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 57/166 (34%), Positives = 97/166 (58%), Gaps = 8/166 (4%)

Query: 22  STAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDML 81
              +          S  + ++ +D  LR  AE+EN+RRRT+ E   A+ Y++ KF+ ++L
Sbjct: 41  KDVKIAQLEAALLSSEAKIKDQQDGVLRAKAEVENMRRRTESEIDKARKYALNKFSEELL 100

Query: 82  SVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQK 141
            V DNL RA+ +A  +           +K L+EG+E+T +  + T+ ++G+K+I+ + + 
Sbjct: 101 PVIDNLERAIQAADTE--------NEAVKPLLEGVELTYKTFVDTVSKFGLKEINPEGET 152

Query: 142 FNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           FNP +HQAM  +       NT++ V+Q GY +N RV+RPA+V +SK
Sbjct: 153 FNPELHQAMSIQESPDHEPNTVMFVMQKGYELNGRVIRPAMVMVSK 198


>gi|284042267|ref|YP_003392607.1| GrpE protein [Conexibacter woesei DSM 14684]
 gi|283946488|gb|ADB49232.1| GrpE protein [Conexibacter woesei DSM 14684]
          Length = 203

 Score =  112 bits (281), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 52/194 (26%), Positives = 95/194 (48%), Gaps = 12/194 (6%)

Query: 2   ETFMSEKNIDKEKNP---------SNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIA 52
           E    E+   +E  P                 E + +++       +++E+     R  A
Sbjct: 12  EEAAVEQTAAEEAVPAADGVHAAHDTPEDHGIEVQQDLDELVAKAEKADEYLALAQRTQA 71

Query: 53  EMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSL 112
           + EN R+R  R+ K A++  I K A+++L   DNL RAL +A           E     L
Sbjct: 72  DFENFRKRMARDVKAAEARGIGKLAKELLPALDNLDRALAAAETPGEGGSGAPE---HHL 128

Query: 113 IEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYA 172
             GI +   E+++ L R G+++   + ++F+PN+H+AM ++P +   + T+++V Q GY 
Sbjct: 129 TAGIRLVHDELLAALGRAGIERFSPQGERFDPNLHEAMVQQPVEGAESGTVVEVYQSGYR 188

Query: 173 INERVLRPALVSIS 186
           ++  VLRPA V ++
Sbjct: 189 LDGLVLRPARVVVA 202


>gi|269216428|ref|ZP_06160282.1| heat shock protein GrpE [Slackia exigua ATCC 700122]
 gi|269129957|gb|EEZ61039.1| heat shock protein GrpE [Slackia exigua ATCC 700122]
          Length = 235

 Score =  112 bits (281), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 47/191 (24%), Positives = 89/191 (46%), Gaps = 10/191 (5%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
            D  +   +  +      +      ++  ++   RDKYLR+ A+ +N R+RT  E    +
Sbjct: 53  QDGAEVEGDEPAEAPASATSDQEVAQARAEASAMRDKYLRLQADWDNFRKRTAEENDQIR 112

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
             +  +   D+L V D+  RA+  A  +              L++G++    ++   LE+
Sbjct: 113 KRATERLMEDVLPVLDDFERAVSHAEQNGEA----------GLLDGVKAIGAKLAGVLEK 162

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
           +G+K +D   + F+   HQA+   P  +VP  T+ +V Q GY +  +V+R A+V+IS G 
Sbjct: 163 HGLKAVDPVGEPFDALAHQAVATVPDPSVPDETVAQVYQKGYRMGSKVIRSAMVAISSGG 222

Query: 190 TQNPTEEKKET 200
            +  +E     
Sbjct: 223 PKRESEPDASE 233


>gi|302840359|ref|XP_002951735.1| hypothetical protein VOLCADRAFT_109146 [Volvox carteri f.
           nagariensis]
 gi|300262983|gb|EFJ47186.1| hypothetical protein VOLCADRAFT_109146 [Volvox carteri f.
           nagariensis]
          Length = 262

 Score =  112 bits (281), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 37/185 (20%), Positives = 77/185 (41%), Gaps = 8/185 (4%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
           +         AE  + +         +   +D+Y+R+ A+ EN RRRT  E         
Sbjct: 86  ELELEMERMRAEASATMERASALEASANSAKDQYVRLTADFENFRRRTREENAQLTDNVR 145

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
               +++L + DN   A      +              +    +   ++M+  +   GV+
Sbjct: 146 GDVIKELLPIVDNFELARTQVKAETEGEA--------KINNSYQGLYKQMVDMMRSLGVE 197

Query: 134 KIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNP 193
            +      F+PN+H A+  EP ++ P  T+++  + G++I  ++LRPA+V +S  +    
Sbjct: 198 AVPTTGTAFDPNIHDAIMREPSNSHPDGTVLQEFRKGFSIGGKLLRPAMVKVSYTEEGPA 257

Query: 194 TEEKK 198
              ++
Sbjct: 258 NSSEE 262


>gi|94500152|ref|ZP_01306686.1| co-chaperone GrpE [Oceanobacter sp. RED65]
 gi|94427725|gb|EAT12701.1| co-chaperone GrpE [Oceanobacter sp. RED65]
          Length = 198

 Score =  112 bits (281), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 59/188 (31%), Positives = 104/188 (55%), Gaps = 9/188 (4%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
                     E    +A+++      + +  E    +  E +++ LR  AE +N+RRR +
Sbjct: 14  ETQETAQEQSESAQESADNTVESVVEQDSQVEALQAEVAELKEEVLRAQAETQNVRRRAE 73

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
            + + A  +S  KFAR++L V DNL RA+ ++P D          V+K  +EG+EMT++ 
Sbjct: 74  VDVEKAHKFSTEKFARELLEVVDNLERAIAASPED---------EVVKPFLEGVEMTQKS 124

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
            ++TL+++ V+ I+ +   F+P++HQA+          NT++ VVQ GY I++R+LRPA+
Sbjct: 125 FVNTLKKFKVEAIEPEGHPFDPDLHQAISMVDAPDAEPNTVLNVVQKGYTIHDRLLRPAM 184

Query: 183 VSISKGKT 190
           V +SK   
Sbjct: 185 VVVSKAAP 192


>gi|125848424|ref|XP_001344119.1| PREDICTED: grpE protein homolog 2, mitochondrial-like [Danio rerio]
          Length = 217

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 40/158 (25%), Positives = 76/158 (48%), Gaps = 10/158 (6%)

Query: 35  ESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSA 94
           +   Q  +  ++Y R +A+ +N+RRRT +  +DA+ + I  F RD++ V+D L + L   
Sbjct: 70  KLEEQVHDLTERYKRAVADSDNVRRRTQKFVEDAKLFGIQSFCRDLVEVADLLEKNLTVE 129

Query: 95  PLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEP 154
             D A          + L + +   +  +     ++G++K+      ++P  H+ +   P
Sbjct: 130 ESDGA----------QQLAQYLAHIQERLQDIFTKHGLEKMTPVGTTYDPYQHEIVCHTP 179

Query: 155 HDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQN 192
            +     TI  V QDGY ++ R +R ALV I+    + 
Sbjct: 180 AEGAEPGTIAMVKQDGYMLHGRTIRHALVGIAVKTQER 217


>gi|82703358|ref|YP_412924.1| GrpE protein [Nitrosospira multiformis ATCC 25196]
 gi|123754280|sp|Q2Y6T9|GRPE_NITMU RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|82411423|gb|ABB75532.1| GrpE protein [Nitrosospira multiformis ATCC 25196]
          Length = 193

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 57/188 (30%), Positives = 101/188 (53%), Gaps = 12/188 (6%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
           T  S      E              S   + +++   + E  D +LR  AE EN+R+R  
Sbjct: 17  TSESSVQETGENKARTPEQEGEAMPSLEQLLKKAELDAAEHYDAWLRAKAEGENIRKRAQ 76

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
            +  +A  Y+I  F+ ++LSV D+L  AL               + +++   G+E+T ++
Sbjct: 77  MDVTNAHKYAIENFSTELLSVMDSLEAALAV-----------ENATVENFKSGMELTLKQ 125

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           + +T  ++ +K++  + +KF+P++HQAM       +P NT+++V+Q GY +N+RV+RPAL
Sbjct: 126 LTATFAKFNIKQLSPQGEKFDPHLHQAMCMVE-SELPHNTVVQVMQKGYVLNDRVIRPAL 184

Query: 183 VSISKGKT 190
           VS+SKGK 
Sbjct: 185 VSVSKGKE 192


>gi|77360165|ref|YP_339740.1| nucleotide exchange factor [Pseudoalteromonas haloplanktis TAC125]
 gi|123589346|sp|Q3IKR2|GRPE_PSEHT RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|76875076|emb|CAI86297.1| Hsp 24 DnaK nucleotide exchange factor; probable member of the
           DnaK/DnaJ/GrpE foldase complex [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 203

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 59/188 (31%), Positives = 102/188 (54%), Gaps = 8/188 (4%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           ME  +       E++     S  AE        E +     + +D  +R  A++EN+RRR
Sbjct: 21  MEADVEAAVQAAEEHAEQEQSPEAEIAMLYAELEVAKQTIADQKDGVVRAAADVENMRRR 80

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
             ++ + A  +++ KFA ++L V DNL RA++ +  +           LK ++EGI MT 
Sbjct: 81  AAQDVEKAHKFALEKFANELLPVIDNLERAIEFSDKE--------NETLKPVLEGISMTV 132

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           +     + ++GV+ ++ + ++FNP  HQAM  +P + V  NT++ V+Q GY +N R+LRP
Sbjct: 133 KSFNDAVAKFGVEIVNPQGEQFNPEFHQAMSIQPSNDVSPNTVLAVMQKGYTLNGRLLRP 192

Query: 181 ALVSISKG 188
           A+V +SK 
Sbjct: 193 AMVMVSKA 200


>gi|167837754|ref|ZP_02464637.1| co-chaperone GrpE [Burkholderia thailandensis MSMB43]
          Length = 178

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 58/190 (30%), Positives = 96/190 (50%), Gaps = 13/190 (6%)

Query: 1   METFMSE-KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRR 59
           ME       +   E+    A ++     +      E+  +  E ++ +LR  AE EN+RR
Sbjct: 1   MENTQENPTDQTTEETGREAQAAENAAPAAEAALAEAQAKIAELQESFLRAKAETENVRR 60

Query: 60  RTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMT 119
           R   +   A  ++I  FA  +L V D+L  A+             +   L  + EG+E+T
Sbjct: 61  RAQEDVAKAHKFAIENFAEHLLPVLDSLEAAV-----------GDTSGDLAKVREGVELT 109

Query: 120 RREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
            R++ S LE+  V  ++   +KF+P++HQA+   P      NT++ V+Q GY I +RVLR
Sbjct: 110 LRQLTSALEKGRVAALNPVGEKFDPHLHQAISMVP-ADQEPNTVVAVLQKGYTIADRVLR 168

Query: 180 PALVSISKGK 189
           PALV++S+ K
Sbjct: 169 PALVTVSQPK 178


>gi|77917726|ref|YP_355541.1| heat shock protein nucleotide exchange factor GrpE [Pelobacter
           carbinolicus DSM 2380]
 gi|77543809|gb|ABA87371.1| heat shock protein nucleotide exchange factor GrpE [Pelobacter
           carbinolicus DSM 2380]
          Length = 198

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 56/149 (37%), Positives = 89/149 (59%), Gaps = 8/149 (5%)

Query: 45  DKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKK 104
           D YLR  AE+EN R+R  REK+D   ++     R++L+V DNL RA++ A        ++
Sbjct: 58  DLYLRERAELENFRKRMQREKEDLVRFANENLLREILTVVDNLERAIEHA--------RQ 109

Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTII 164
           ++  +K L+EG+EMT  +    LE++GV  + A  + F+P  H+AM +      P NT++
Sbjct: 110 TDETVKGLLEGVEMTLSQCQKLLEKFGVTPVVAVGEPFDPTWHEAMGQMESAEHPPNTVM 169

Query: 165 KVVQDGYAINERVLRPALVSISKGKTQNP 193
           + +Q GY +N+R+LRPA+V ISK      
Sbjct: 170 QEMQKGYVLNDRLLRPAMVMISKAPAATE 198


>gi|329924041|ref|ZP_08279304.1| co-chaperone GrpE [Paenibacillus sp. HGF5]
 gi|328940880|gb|EGG37188.1| co-chaperone GrpE [Paenibacillus sp. HGF5]
          Length = 204

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 54/186 (29%), Positives = 97/186 (52%), Gaps = 11/186 (5%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E+  SE+ ++ E+      + +A+E +     E+   + +E + + LRV A+ +N RRRT
Sbjct: 30  ESGSSEEAVNPEQEI--PVTESADEAAGSAELEKLQAELQEQQQRTLRVQADFDNFRRRT 87

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
            +EK+D   Y+ +K   ++L V DN  RAL ++               +S  +G+ M  R
Sbjct: 88  QKEKEDLGKYASSKLITELLPVIDNFERALQASEE---------NPEFESFSKGVSMIFR 138

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           ++ S L   G+  + +  + FNP  HQA+ +   D      +++ VQ GY + ++VLRPA
Sbjct: 139 QLESVLATEGLSAMKSVGEPFNPEYHQAIMQVESDEYEEGIVVEEVQKGYMLKDKVLRPA 198

Query: 182 LVSISK 187
           +V +S 
Sbjct: 199 MVKVSM 204


>gi|114321052|ref|YP_742735.1| GrpE protein [Alkalilimnicola ehrlichii MLHE-1]
 gi|122311356|sp|Q0A7E2|GRPE_ALHEH RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|114227446|gb|ABI57245.1| GrpE protein [Alkalilimnicola ehrlichii MLHE-1]
          Length = 218

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 60/196 (30%), Positives = 107/196 (54%), Gaps = 8/196 (4%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
            E    ++   S +  S  E        EE+  ++EE  ++ LR  AEM+N++RR   + 
Sbjct: 30  PEAQAAEDGAESASGDSGDELTELQQALEEARARAEENWNECLRARAEMQNIQRRAQADV 89

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
           + A+ Y++ K A D+L V D+L   + +A  + A+         + L+EG E+T + +  
Sbjct: 90  EKARKYAVEKIAGDLLGVKDSLEMGVKAAKEEGADP--------QKLLEGSELTLKMLSQ 141

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
            LER+ V++ID + ++FNP  H+A+  +P      NT++ V+Q GYA+++RVLRPA+V +
Sbjct: 142 VLERFNVQEIDPQGERFNPEHHEAVAAQPSHEHEPNTVLNVMQKGYALHDRVLRPAMVVV 201

Query: 186 SKGKTQNPTEEKKETI 201
           S+   + P     +  
Sbjct: 202 SQKAPEPPPSGSIDEQ 217


>gi|78211578|ref|YP_380357.1| putative heat shock protein GrpE [Synechococcus sp. CC9605]
 gi|123756985|sp|Q3ANN0|GRPE_SYNSC RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|78196037|gb|ABB33802.1| putative heat shock protein GrpE [Synechococcus sp. CC9605]
          Length = 225

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 41/209 (19%), Positives = 83/209 (39%), Gaps = 8/209 (3%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
               +      +  S A       +           + +    +Y+R+ A+ +N R+R  
Sbjct: 24  ESSPDAPEATSEQASAAVDPADRMQQLEQELSALKQEHDTLNSQYMRIAADFDNFRKRQS 83

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           R++ D +   +     ++L V DN  RA      +            ++L    +   ++
Sbjct: 84  RDQDDMRKQLVCSTLTEILPVVDNFERARQQLNPEG--------EEAQALHRSYQGLYKQ 135

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           ++  L++ GV ++D   Q+F+PN+H+A+  E       + + + +Q GY  + RVLR A+
Sbjct: 136 LVEVLKQQGVARMDVVGQEFDPNLHEAVLREESSEFAEDVVSEELQRGYHRDGRVLRHAM 195

Query: 183 VSISKGKTQNPTEEKKETIEQPSPLDIEE 211
           V +S G   +                 EE
Sbjct: 196 VKVSMGPGPSDPGSAPAEAAAAPDQTAEE 224


>gi|37527246|ref|NP_930590.1| GrpE protein [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|52782904|sp|Q7N1U7|GRPE_PHOLL RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|36786680|emb|CAE15746.1| GrpE protein (HSP-70 cofactor) (heat shock protein B25.3) (HSP24)
           [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 193

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 60/187 (32%), Positives = 104/187 (55%), Gaps = 10/187 (5%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           ME    ++N   +   S   S      +E+    +   Q E  RD  LR  AE+EN+RRR
Sbjct: 17  MEVVSEQQNSADKAEASETESVVDPRVAELEEQLKQAQQRE--RDAILRAKAEVENIRRR 74

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+++ + A  +++ +FA ++L V DNL RAL+ A         ++ + +  ++EGIE+T 
Sbjct: 75  TEQDVEKAHKFALERFANELLPVIDNLERALEVAD--------RTNTEIAPMVEGIELTL 126

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           +  +  + ++G++ +   +  FNP +HQAM     D    N ++ V+Q GY +N R+LRP
Sbjct: 127 KSFLGAVGKFGIEVVGDTNVPFNPEIHQAMTMMESDQHEPNHVMMVMQKGYTLNGRLLRP 186

Query: 181 ALVSISK 187
           A+V++SK
Sbjct: 187 AMVAVSK 193


>gi|121998259|ref|YP_001003046.1| GrpE protein [Halorhodospira halophila SL1]
 gi|166215267|sp|A1WX32|GRPE_HALHL RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|121589664|gb|ABM62244.1| GrpE protein [Halorhodospira halophila SL1]
          Length = 240

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 52/175 (29%), Positives = 98/175 (56%), Gaps = 8/175 (4%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
            + ++  +     +       ++  ++EE  D+ LR+ AE+EN RRR +++   A+   +
Sbjct: 59  DDGADPEALRQRVEELEKALADAEQKAEEHWDQVLRMRAELENARRRAEKDVDQAKRQGL 118

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
            K   D+L V D+L   + +A    A+ E         L+EG ++T + +    ER+ ++
Sbjct: 119 EKVCGDLLQVKDSLEMGVQAAEDAEADRE--------KLLEGSQLTLKMLNQVFERFEIE 170

Query: 134 KIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           +I+ + ++FNP+ H+AM  +P D    NT+++VVQ GY + +R+LRPALV ++K 
Sbjct: 171 EINPQGERFNPDYHEAMAAQPSDEQEPNTVLQVVQKGYRLQDRLLRPALVVVAKK 225


>gi|303229107|ref|ZP_07315909.1| co-chaperone GrpE [Veillonella atypica ACS-134-V-Col7a]
 gi|303232187|ref|ZP_07318890.1| co-chaperone GrpE [Veillonella atypica ACS-049-V-Sch6]
 gi|302513293|gb|EFL55332.1| co-chaperone GrpE [Veillonella atypica ACS-049-V-Sch6]
 gi|302516231|gb|EFL58171.1| co-chaperone GrpE [Veillonella atypica ACS-134-V-Col7a]
          Length = 183

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 50/180 (27%), Positives = 94/180 (52%), Gaps = 10/180 (5%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
            E+  +  +     + +   E+S ++  E       +F ++Y R+ A+ EN +RRT++EK
Sbjct: 12  DEEISEPTEATKEQSEAQNAEESVVDASEVLEELKADFDNRYKRLQADFENFKRRTNQEK 71

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
           +    +      +D+L V DN  RA+ +           +E   K  ++G  M  + +M+
Sbjct: 72  EQLAGFVKGDVLKDLLPVLDNFERAVQA----------PAEGDTKVFLDGFVMIHQNLMA 121

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
            L ++G+  IDA  + F+PN HQA+   P D   ++T+ +V+Q GY ++ R +RPA+V +
Sbjct: 122 MLSKHGLAVIDAVGKPFDPNFHQAIMRVPSDEYESDTVCEVLQTGYTVDGRCIRPAMVKV 181


>gi|288920265|ref|ZP_06414579.1| GrpE protein [Frankia sp. EUN1f]
 gi|288348369|gb|EFC82632.1| GrpE protein [Frankia sp. EUN1f]
          Length = 212

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 53/184 (28%), Positives = 85/184 (46%), Gaps = 15/184 (8%)

Query: 28  SEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNL 87
            +     +   + EE RD+ LR +A+ +N RRRT RE   A++    +     L V D+L
Sbjct: 8   EKAPAATDLAVELEECRDRQLRTLADFDNFRRRTGRELAAARTAERDRVVLAWLPVLDHL 67

Query: 88  SRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMH 147
             AL  A  + A           SL++G+   R+  +  L R GV ++D +   F+PN H
Sbjct: 68  ELALSHASAEPA-----------SLLDGVRGVRQLALEALRRCGVVRLDDEHGPFDPNRH 116

Query: 148 QAMFEEP----HDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQ 203
           +           D  PA T++ V++ G+A + RVLRPA V++S G         +     
Sbjct: 117 EVGAVVDVSTTPDPPPAGTVMDVLRSGFAADGRVLRPASVAVSAGPQTGTPHTPQTAQAP 176

Query: 204 PSPL 207
            +P 
Sbjct: 177 RAPQ 180


>gi|221134953|ref|ZP_03561256.1| heat shock protein GrpE [Glaciecola sp. HTCC2999]
          Length = 217

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 62/195 (31%), Positives = 105/195 (53%), Gaps = 8/195 (4%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
           T  +E    +  N    +   A      N    +     + +D  LR +AE EN +RR +
Sbjct: 31  TIDNETANVESDNVETLSPEQARIFELENELAAAKQALVDQKDGALRAVAEGENAKRRAE 90

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
            E + A+ +++ +FA D+L V DNL  A+  A  +           LK +++GI+MT++ 
Sbjct: 91  AEIEKARKFALERFAGDLLPVIDNLENAIRFADRE--------NETLKPILDGIDMTQKS 142

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
            +ST+E+ G++ ++ + + FNP+ HQAM  +    V  NT++ V+Q GY IN R+LRPA+
Sbjct: 143 FISTVEKNGLEVLNPEGEAFNPDQHQAMSMQESADVAPNTVLAVMQKGYVINGRLLRPAM 202

Query: 183 VSISKGKTQNPTEEK 197
           V +SK  TQ+   + 
Sbjct: 203 VMVSKAPTQDTEAKN 217


>gi|50843483|ref|YP_056710.1| molecular chaperone GrpE (heat shock protein) [Propionibacterium
           acnes KPA171202]
 gi|289425738|ref|ZP_06427493.1| co-chaperone GrpE [Propionibacterium acnes SK187]
 gi|289427866|ref|ZP_06429570.1| co-chaperone GrpE [Propionibacterium acnes J165]
 gi|295131566|ref|YP_003582229.1| co-chaperone GrpE [Propionibacterium acnes SK137]
 gi|81692367|sp|Q6A661|GRPE_PROAC RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|50841085|gb|AAT83752.1| molecular chaperone GrpE (heat shock protein) [Propionibacterium
           acnes KPA171202]
 gi|289153844|gb|EFD02550.1| co-chaperone GrpE [Propionibacterium acnes SK187]
 gi|289158749|gb|EFD06949.1| co-chaperone GrpE [Propionibacterium acnes J165]
 gi|291375381|gb|ADD99235.1| co-chaperone GrpE [Propionibacterium acnes SK137]
 gi|313763845|gb|EFS35209.1| co-chaperone GrpE [Propionibacterium acnes HL013PA1]
 gi|313771707|gb|EFS37673.1| co-chaperone GrpE [Propionibacterium acnes HL074PA1]
 gi|313793762|gb|EFS41793.1| co-chaperone GrpE [Propionibacterium acnes HL110PA1]
 gi|313803076|gb|EFS44284.1| co-chaperone GrpE [Propionibacterium acnes HL110PA2]
 gi|313808289|gb|EFS46760.1| co-chaperone GrpE [Propionibacterium acnes HL087PA2]
 gi|313810531|gb|EFS48245.1| co-chaperone GrpE [Propionibacterium acnes HL083PA1]
 gi|313813836|gb|EFS51550.1| co-chaperone GrpE [Propionibacterium acnes HL025PA1]
 gi|313816993|gb|EFS54707.1| co-chaperone GrpE [Propionibacterium acnes HL059PA1]
 gi|313818093|gb|EFS55807.1| co-chaperone GrpE [Propionibacterium acnes HL046PA2]
 gi|313820951|gb|EFS58665.1| co-chaperone GrpE [Propionibacterium acnes HL036PA1]
 gi|313823978|gb|EFS61692.1| co-chaperone GrpE [Propionibacterium acnes HL036PA2]
 gi|313827087|gb|EFS64801.1| co-chaperone GrpE [Propionibacterium acnes HL063PA1]
 gi|313829797|gb|EFS67511.1| co-chaperone GrpE [Propionibacterium acnes HL063PA2]
 gi|313831571|gb|EFS69285.1| co-chaperone GrpE [Propionibacterium acnes HL007PA1]
 gi|313832557|gb|EFS70271.1| co-chaperone GrpE [Propionibacterium acnes HL056PA1]
 gi|313839298|gb|EFS77012.1| co-chaperone GrpE [Propionibacterium acnes HL086PA1]
 gi|314916559|gb|EFS80390.1| co-chaperone GrpE [Propionibacterium acnes HL005PA4]
 gi|314918782|gb|EFS82613.1| co-chaperone GrpE [Propionibacterium acnes HL050PA1]
 gi|314920989|gb|EFS84820.1| co-chaperone GrpE [Propionibacterium acnes HL050PA3]
 gi|314926979|gb|EFS90810.1| co-chaperone GrpE [Propionibacterium acnes HL036PA3]
 gi|314932394|gb|EFS96225.1| co-chaperone GrpE [Propionibacterium acnes HL067PA1]
 gi|314956703|gb|EFT00955.1| co-chaperone GrpE [Propionibacterium acnes HL027PA1]
 gi|314959613|gb|EFT03715.1| co-chaperone GrpE [Propionibacterium acnes HL002PA1]
 gi|314961798|gb|EFT05899.1| co-chaperone GrpE [Propionibacterium acnes HL002PA2]
 gi|314964782|gb|EFT08882.1| co-chaperone GrpE [Propionibacterium acnes HL082PA1]
 gi|314968711|gb|EFT12809.1| co-chaperone GrpE [Propionibacterium acnes HL037PA1]
 gi|314974922|gb|EFT19017.1| co-chaperone GrpE [Propionibacterium acnes HL053PA1]
 gi|314977983|gb|EFT22077.1| co-chaperone GrpE [Propionibacterium acnes HL045PA1]
 gi|314979712|gb|EFT23806.1| co-chaperone GrpE [Propionibacterium acnes HL072PA2]
 gi|314984604|gb|EFT28696.1| co-chaperone GrpE [Propionibacterium acnes HL005PA1]
 gi|314988264|gb|EFT32355.1| co-chaperone GrpE [Propionibacterium acnes HL005PA2]
 gi|314990350|gb|EFT34441.1| co-chaperone GrpE [Propionibacterium acnes HL005PA3]
 gi|315079250|gb|EFT51253.1| co-chaperone GrpE [Propionibacterium acnes HL053PA2]
 gi|315082286|gb|EFT54262.1| co-chaperone GrpE [Propionibacterium acnes HL078PA1]
 gi|315083742|gb|EFT55718.1| co-chaperone GrpE [Propionibacterium acnes HL027PA2]
 gi|315087383|gb|EFT59359.1| co-chaperone GrpE [Propionibacterium acnes HL002PA3]
 gi|315089800|gb|EFT61776.1| co-chaperone GrpE [Propionibacterium acnes HL072PA1]
 gi|315100164|gb|EFT72140.1| co-chaperone GrpE [Propionibacterium acnes HL059PA2]
 gi|315102487|gb|EFT74463.1| co-chaperone GrpE [Propionibacterium acnes HL046PA1]
 gi|315107830|gb|EFT79806.1| co-chaperone GrpE [Propionibacterium acnes HL030PA1]
 gi|315109595|gb|EFT81571.1| co-chaperone GrpE [Propionibacterium acnes HL030PA2]
 gi|327326536|gb|EGE68324.1| protein GrpE 1 [Propionibacterium acnes HL096PA3]
 gi|327332804|gb|EGE74536.1| protein GrpE 1 [Propionibacterium acnes HL096PA2]
 gi|327448425|gb|EGE95079.1| co-chaperone GrpE [Propionibacterium acnes HL043PA2]
 gi|327448500|gb|EGE95154.1| co-chaperone GrpE [Propionibacterium acnes HL043PA1]
 gi|327449643|gb|EGE96297.1| co-chaperone GrpE [Propionibacterium acnes HL013PA2]
 gi|327455810|gb|EGF02465.1| co-chaperone GrpE [Propionibacterium acnes HL087PA3]
 gi|327456095|gb|EGF02750.1| co-chaperone GrpE [Propionibacterium acnes HL092PA1]
 gi|327457956|gb|EGF04611.1| co-chaperone GrpE [Propionibacterium acnes HL083PA2]
 gi|328757125|gb|EGF70741.1| co-chaperone GrpE [Propionibacterium acnes HL087PA1]
 gi|328757320|gb|EGF70936.1| co-chaperone GrpE [Propionibacterium acnes HL020PA1]
 gi|328757503|gb|EGF71119.1| co-chaperone GrpE [Propionibacterium acnes HL025PA2]
 gi|328762079|gb|EGF75584.1| protein GrpE 1 [Propionibacterium acnes HL099PA1]
 gi|332676434|gb|AEE73250.1| protein GrpE [Propionibacterium acnes 266]
          Length = 221

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 46/210 (21%), Positives = 93/210 (44%), Gaps = 19/210 (9%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           ++D + + S  +S   EE S  +  E  L +  E      R+ AE  N +RR DR++  +
Sbjct: 31  DVDIDADQSATDSPAPEELSRESQLEALLAERTE---DLQRLQAEYVNYKRRVDRDRALS 87

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
           +   + K   D++ V D+++ A     ++                 G ++   E+     
Sbjct: 88  RQSGVDKVITDLMPVLDSIAMARQHGEVEG----------------GFKLVVDELEKVAN 131

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
            +G+         F+PN+H+A+ + P + V   ++ +V+Q GY + +RVLRPA V++S  
Sbjct: 132 NHGLTSFGEVGDVFDPNLHEALMQMPMEGVSVTSVSQVMQPGYKLGDRVLRPARVAVSDP 191

Query: 189 KTQNPTEEKKETIEQPSPLDIEERNKTQTK 218
                + ++    +  S    E+    + +
Sbjct: 192 DPNATSADESSQADGESAQADEDDETPRNE 221


>gi|254475115|ref|ZP_05088501.1| co-chaperone GrpE [Ruegeria sp. R11]
 gi|214029358|gb|EEB70193.1| co-chaperone GrpE [Ruegeria sp. R11]
          Length = 187

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 58/180 (32%), Positives = 102/180 (56%), Gaps = 8/180 (4%)

Query: 12  KEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
            E      ++ T E        +    + +E +D+++R +A+ EN R+R D+ +++A+ Y
Sbjct: 14  TEAEAEELSAQTEEFDDVALELDSLRAERDELKDRFMRALADAENARKRGDKARREAEQY 73

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
             +K ARDML V DN+ RA+++A  +          V  +LIEG+E+T R ++   E++G
Sbjct: 74  GGSKLARDMLPVYDNMKRAVEAATDEQR-------EVSAALIEGVELTMRALLGVFEKHG 126

Query: 132 VKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           ++ I  +   KF+P +H+AMFE P     A  II+V  +G+ +++R+LRPA V +S    
Sbjct: 127 MQVIAPEVGDKFDPQVHEAMFEAPVPGTKAGDIIQVSAEGFMLHDRLLRPAQVGVSSTPA 186


>gi|259417105|ref|ZP_05741024.1| co-chaperone GrpE [Silicibacter sp. TrichCH4B]
 gi|259346011|gb|EEW57825.1| co-chaperone GrpE [Silicibacter sp. TrichCH4B]
          Length = 187

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 54/172 (31%), Positives = 102/172 (59%), Gaps = 8/172 (4%)

Query: 20  NSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARD 79
           ++ T E   E    +    + +E++D+++R +A+ EN R+R D+ +++A+ Y  +K ARD
Sbjct: 22  SAQTEEFDDEALELDSLRAERDEYKDRFMRALADAENARKRGDKARREAEQYGGSKLARD 81

Query: 80  MLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK- 138
           ML V DN+ RA+++A  +             +LIEG+E+T R ++   +++G++ +  + 
Sbjct: 82  MLPVYDNMKRAVEAATEEQKAVS-------AALIEGVELTMRALLDVFQKHGIQVVTPEV 134

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
             +F+P +H+AMFE P     A  II+V  +G+ +++R+LRPA V +S    
Sbjct: 135 GDRFDPQVHEAMFEAPVPGTKAGDIIQVSAEGFMLHDRLLRPAQVGVSSTPA 186


>gi|169832198|ref|YP_001718180.1| GrpE protein [Candidatus Desulforudis audaxviator MP104C]
 gi|169639042|gb|ACA60548.1| GrpE protein [Candidatus Desulforudis audaxviator MP104C]
          Length = 194

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 43/192 (22%), Positives = 83/192 (43%), Gaps = 11/192 (5%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           E             S             E   ++ + R++ LR+ A+ EN RRRT +E++
Sbjct: 14  ETGTAAITEVKEPESPEDGNGDLEARLAEEAEKAADCRERLLRLQADFENYRRRTRQERE 73

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
                +  +    +L V DN  RAL+                L   + G+ M  R++   
Sbjct: 74  GWYRQAAEEVVSAILPVLDNFERALEH-----------PGDRLDDFLAGVRMIYRQLDEI 122

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           L   G++++    ++F+P MH+A+       VP NT+++ ++ GY    +++RPA+V ++
Sbjct: 123 LAEQGLERVPGVGEEFDPRMHEAVDRVETTEVPENTVLEELRPGYYFKGKLMRPAMVKVA 182

Query: 187 KGKTQNPTEEKK 198
           K        + +
Sbjct: 183 KRAVNGEVAQDE 194


>gi|52782953|sp|Q8KML7|GRPE_LACSN RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|21912939|emb|CAC86404.1| heat shock protein [Lactobacillus sanfranciscensis]
          Length = 180

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 51/182 (28%), Positives = 93/182 (51%), Gaps = 10/182 (5%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
            +K    +        S ++  +      E   Q ++ ++ YLR  AE++N+++R+ +E+
Sbjct: 7   EDKQPIIKDEAVEEPKSDSKVNALSAKIAELQQQLDDSQNDYLRAQAEIQNMQKRSQKEQ 66

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
                Y   + A++++ V D+L RAL           +      + L  GIEM  + +  
Sbjct: 67  SALAKYGAQRLAKEVVPVMDDLKRALQV---------QVDNDSGQQLKTGIEMVYKHLEK 117

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEP-HDTVPANTIIKVVQDGYAINERVLRPALVS 184
            L    +K+IDA    F+P +HQA+   P  D  PA+T+++V+Q GY + +RVLRPA+V 
Sbjct: 118 ALNDNDIKEIDADGVAFDPELHQAVQTVPADDDHPADTVVQVLQSGYKLADRVLRPAMVV 177

Query: 185 IS 186
           ++
Sbjct: 178 VA 179


>gi|300175194|emb|CBK20505.2| Nucleotide exchange factor Mge1 [Blastocystis hominis]
          Length = 233

 Score =  112 bits (280), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 51/184 (27%), Positives = 94/184 (51%), Gaps = 2/184 (1%)

Query: 12  KEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
           + +      +   +  S     E S  + ++ +DK +R++AEM+N+R    R+  + ++Y
Sbjct: 51  QGEEKPAEATLDDQLASIKKQLESSEKELKDLKDKNMRLLAEMQNVRTIAKRDVLNERTY 110

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
           ++  F +++L V D LS A+ S P D    E  ++  L SL +G+ MT++E+   L   G
Sbjct: 111 ALQSFGKNLLCVCDYLSMAITSVPKDKVEGE-AADKTLVSLYQGVVMTQKELDKVLNAQG 169

Query: 132 VKKIDAKDQKFNPNMHQAMFEEP-HDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           + K       FNPN+H+AMF+ P  +    N++ +++  GY   +RVLRP    +     
Sbjct: 170 ITKYGVVGDDFNPNIHEAMFQMPLTEGAKPNSLGQIITAGYMFKQRVLRPCKAGVFVKAE 229

Query: 191 QNPT 194
           +   
Sbjct: 230 EEKQ 233


>gi|3411072|gb|AAC31364.1| co-chaperone mt-GrpE#2 precursor [Mus musculus]
          Length = 223

 Score =  112 bits (280), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 40/174 (22%), Positives = 86/174 (49%), Gaps = 3/174 (1%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
           ++P +    +  E++      +   + ++   +Y R +A+ EN+RRRT R  +DA+ + I
Sbjct: 45  EDPPDGLGPSLAEQALRLKAVKLEKEVQDLTLRYQRAVADCENIRRRTQRCVEDAKIFGI 104

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
             F +D++ V+D L +            + +    L+ + +G+ +    + S   ++G++
Sbjct: 105 QSFCKDLVEVADILEKTAKCCSEGAEPEDHRRT--LEKVFQGLSLLEARLKSVFTKHGLE 162

Query: 134 KIDAKDQKFNPNMHQAMFEEPHD-TVPANTIIKVVQDGYAINERVLRPALVSIS 186
           K+     K++P+ H+ +   P    V   T+  V QDGY ++ R +R A V ++
Sbjct: 163 KMTPIGDKYDPHEHELICHMPAGVGVQPGTVALVRQDGYKLHGRTIRLAQVEVA 216


>gi|29789124|ref|NP_067271.1| grpE protein homolog 2, mitochondrial precursor [Mus musculus]
 gi|22261800|sp|O88396|GRPE2_MOUSE RecName: Full=GrpE protein homolog 2, mitochondrial; AltName:
           Full=Mt-GrpE#2; Flags: Precursor
 gi|12833404|dbj|BAB22511.1| unnamed protein product [Mus musculus]
 gi|12849509|dbj|BAB28371.1| unnamed protein product [Mus musculus]
 gi|26350161|dbj|BAC38720.1| unnamed protein product [Mus musculus]
 gi|74211453|dbj|BAE26470.1| unnamed protein product [Mus musculus]
 gi|111308329|gb|AAI20748.1| GrpE-like 2, mitochondrial [Mus musculus]
 gi|127799456|gb|AAH68232.1| GrpE-like 2, mitochondrial [Mus musculus]
 gi|148677812|gb|EDL09759.1| GrpE-like 2, mitochondrial [Mus musculus]
          Length = 224

 Score =  112 bits (280), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 40/174 (22%), Positives = 86/174 (49%), Gaps = 3/174 (1%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
           ++P +    +  E++      +   + ++   +Y R +A+ EN+RRRT R  +DA+ + I
Sbjct: 46  EDPPDGLGPSLAEQALRLKAVKLEKEVQDLTLRYQRAVADCENIRRRTQRCVEDAKIFGI 105

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
             F +D++ V+D L +            + +    L+ + +G+ +    + S   ++G++
Sbjct: 106 QSFCKDLVEVADILEKTAKCCSEGAEPEDHRRT--LEKVFQGLSLLEARLKSVFTKHGLE 163

Query: 134 KIDAKDQKFNPNMHQAMFEEPHD-TVPANTIIKVVQDGYAINERVLRPALVSIS 186
           K+     K++P+ H+ +   P    V   T+  V QDGY ++ R +R A V ++
Sbjct: 164 KMTPIGDKYDPHEHELICHMPAGVGVQPGTVALVRQDGYKLHGRTIRLAQVEVA 217


>gi|145589950|ref|YP_001156547.1| GrpE protein [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
 gi|189041744|sp|A4SZR9|GRPE_POLSQ RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|145048356|gb|ABP34983.1| GrpE protein [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 184

 Score =  112 bits (280), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 58/184 (31%), Positives = 94/184 (51%), Gaps = 13/184 (7%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           E      +    A S  A  K+      +   Q  E +D +LR  AE EN+RRR   +  
Sbjct: 13  EDVAADPQVNEAAASEPAAVKTPEQEIADLNQQIGELQDNFLRAKAEGENIRRRAVEDIA 72

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
            A  ++I  FA  ++ V+D+L  AL +   D            K+  EG+E+T ++++S 
Sbjct: 73  KAHKFAIESFAEHLVPVTDSLYAALSTDAGDA-----------KAFKEGLEITLKQLLSA 121

Query: 127 LERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
            E+  + +I+     KF+P+ HQA+   P +    NT++ V+Q GY + +RVLRPALV++
Sbjct: 122 FEKGRMTEINPAVGDKFDPHHHQAIASVPSEQ-DPNTVVSVLQRGYTVADRVLRPALVTV 180

Query: 186 SKGK 189
           S  K
Sbjct: 181 SAPK 184


>gi|304403922|ref|ZP_07385584.1| GrpE protein [Paenibacillus curdlanolyticus YK9]
 gi|304346900|gb|EFM12732.1| GrpE protein [Paenibacillus curdlanolyticus YK9]
          Length = 194

 Score =  112 bits (280), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 52/186 (27%), Positives = 96/186 (51%), Gaps = 9/186 (4%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           +E    + + +++         T  + +      E   Q EE + +YLR  A+ +N RRR
Sbjct: 17  VEEQEQQAHNEEQNAADQPQEETTPQSASEARIAELEQQIEEQQQRYLRAQADFDNFRRR 76

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T +E+++   Y+ +K   ++L V DN  RA+++A            +   +L +G++M  
Sbjct: 77  TIKEREELAQYATSKLLTELLPVVDNFDRAINAAK---------QNNDFDALSKGVDMIS 127

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           R+    LE+ G++ ++   + FNP  HQA+ +E        TI++ +Q GY + E+VLRP
Sbjct: 128 RQFNQVLEQEGLQPMNVIGEPFNPEFHQAVMQESSAEHEEGTILEELQKGYMLKEKVLRP 187

Query: 181 ALVSIS 186
           A+V +S
Sbjct: 188 AMVKVS 193


>gi|99082714|ref|YP_614868.1| GrpE protein [Ruegeria sp. TM1040]
 gi|99038994|gb|ABF65606.1| GrpE protein [Ruegeria sp. TM1040]
          Length = 187

 Score =  112 bits (280), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 53/172 (30%), Positives = 102/172 (59%), Gaps = 8/172 (4%)

Query: 20  NSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARD 79
           ++ T E   E    +    + ++++D+++R +A+ EN R+R D+ +++A+ Y  +K ARD
Sbjct: 22  SAQTEEFDDEALELDSLRAERDDYKDRFMRALADAENARKRGDKARREAEQYGGSKLARD 81

Query: 80  MLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK- 138
           ML V DN+ RA+++A  +             +LIEG+E+T R ++   +++G++ +  + 
Sbjct: 82  MLPVYDNMKRAVEAATEEQKAVS-------AALIEGVELTMRALLDVFQKHGIQVVSPEV 134

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
             +F+P +H+AMFE P     A  II+V  +G+ +++R+LRPA V +S    
Sbjct: 135 GDRFDPQVHEAMFEAPVPGTKAGDIIQVSAEGFMLHDRLLRPAQVGVSSTPA 186


>gi|197103194|ref|YP_002128572.1| Heat shock protein GrpE(HSP-70 cofactor) [Phenylobacterium zucineum
           HLK1]
 gi|196480470|gb|ACG79997.1| Heat shock protein GrpE(HSP-70 cofactor) [Phenylobacterium zucineum
           HLK1]
          Length = 180

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 48/184 (26%), Positives = 87/184 (47%), Gaps = 4/184 (2%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
           +  E    NA  +   +      P+ +    E  +D+ LR +A+ EN RR+ +R + + +
Sbjct: 1   MTSESGIPNAPPAAEIKTPAGEAPQAATEAVEALQDRLLRALADAENARRQAERARSEGR 60

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
              +A     +    D+L  A+D+A     + E       +S+ EG+   RR ++   +R
Sbjct: 61  RAGVADLIARLAPGLDSLDLAVDAARGPDQDDETF----ARSVQEGLRAARRALLEAFQR 116

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
            GV++I+  DQ F+P  H+A+            +++VVQ GY + ER++RPA V +S   
Sbjct: 117 EGVQRIEPLDQPFDPTSHEAVATRADPAATPGHVLQVVQAGYRVGERLVRPARVVVSAAA 176

Query: 190 TQNP 193
               
Sbjct: 177 PPAD 180


>gi|327265216|ref|XP_003217404.1| PREDICTED: grpE protein homolog 2, mitochondrial-like [Anolis
           carolinensis]
          Length = 224

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 40/173 (23%), Positives = 85/173 (49%), Gaps = 4/173 (2%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
           ++P++       E    +   +   Q     ++Y R + + EN+RRRT +  +DA+ + I
Sbjct: 51  EDPNDEPRHLLNENGLEHKAIKLEEQVRVLTERYQRALTDSENVRRRTQKFVEDAKIFGI 110

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
               RD++ V+D L +  + A  +  +        LK + EG+ +   ++ S   ++G++
Sbjct: 111 QSLCRDLVEVADILEKTKECAVAEHNDPAL----TLKKIYEGLSLIESKLQSIFAKHGLQ 166

Query: 134 KIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           K++    K++P  H+ +   P + +   T+  V  DGY ++ R +R A V ++
Sbjct: 167 KMNPVGGKYDPYDHEIVCHVPAEEMHPGTVALVTLDGYKLHGRTIRHAHVGVA 219


>gi|145226768|gb|ABP48134.1| GrpE [Rhodococcus sp. DK17]
          Length = 174

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 42/182 (23%), Positives = 88/182 (48%), Gaps = 11/182 (6%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           E++ D        + +  ++        ++  +  +  D++ R +A+++NLR+R  ++  
Sbjct: 2   ERSADHSTTEPATDGTDRDQTETAPDRTDTGAELAQLEDRWRRALADLDNLRKRYAKDLD 61

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
             ++   ++ A   L V DNL  AL  A  D            ++++EG++  R + +  
Sbjct: 62  RERAAERSQVAAAWLPVLDNLELALAHAGSDP-----------QAVVEGVKAIRDQAVQV 110

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           L R G ++ D     F+P +H+ +       +P+ T+I+V++ GY  + R LRPA V +S
Sbjct: 111 LSRLGFERHDEVGVPFSPELHEVVSVVAQPDLPSGTVIEVLRPGYGEDGRQLRPAAVVVS 170

Query: 187 KG 188
           + 
Sbjct: 171 RP 172


>gi|332799050|ref|YP_004460549.1| Protein grpE [Tepidanaerobacter sp. Re1]
 gi|332696785|gb|AEE91242.1| Protein grpE [Tepidanaerobacter sp. Re1]
          Length = 206

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 50/183 (27%), Positives = 92/183 (50%), Gaps = 11/183 (6%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
           +     +  N +       E      + EE   + + +++++LR  A++EN R+RT+R+ 
Sbjct: 34  TTAENTQNGNQAEQIDDMQENVDLKKVLEEKQKEIDNYKNRWLRTQADLENYRKRTERDI 93

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
           ++   Y+  +   D+L V DN  RALDS            E    +L  GIE+   ++  
Sbjct: 94  QEIHLYAGEQLVLDILPVVDNFERALDSI-----------EDKNDALYRGIELIYEQLKK 142

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
            LE++G+K+I+A  + F+PN H A+     +     T+ +V+  GY  N +V+RP++V +
Sbjct: 143 VLEKHGIKEIEALGKPFDPNFHDAVMMVESEEYEPGTVAEVMLKGYMYNSKVIRPSMVKV 202

Query: 186 SKG 188
            K 
Sbjct: 203 VKN 205


>gi|302343493|ref|YP_003808022.1| GrpE protein [Desulfarculus baarsii DSM 2075]
 gi|301640106|gb|ADK85428.1| GrpE protein [Desulfarculus baarsii DSM 2075]
          Length = 197

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 55/182 (30%), Positives = 94/182 (51%), Gaps = 10/182 (5%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
            E+    +        +       ++  E+   Q  E  D+++R+ AE +N ++R +REK
Sbjct: 14  DEQREAAKATGQVDGPAQEVVDEPMSDLEQCQAQRAELEDRFMRLAAEFDNYKKRGEREK 73

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
            +    +    A D+L V DNL RAL +A           E+  ++L +G+EM   E+  
Sbjct: 74  AEFLKRANEAMAGDLLPVLDNLERALGAA----------GEADKQTLQKGVEMVLGELRK 123

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
           TLER+G++ IDA  Q F+P +H+AM ++ +  V    ++   Q GY    R+LRPA+V +
Sbjct: 124 TLERHGLEAIDALGQPFDPQLHEAMMQQENPDVEEGAVLSQFQKGYLFQGRLLRPAMVVV 183

Query: 186 SK 187
           +K
Sbjct: 184 AK 185


>gi|314924502|gb|EFS88333.1| co-chaperone GrpE [Propionibacterium acnes HL001PA1]
 gi|314967287|gb|EFT11386.1| co-chaperone GrpE [Propionibacterium acnes HL082PA2]
 gi|315094751|gb|EFT66727.1| co-chaperone GrpE [Propionibacterium acnes HL060PA1]
 gi|315102913|gb|EFT74889.1| co-chaperone GrpE [Propionibacterium acnes HL050PA2]
 gi|327328599|gb|EGE70359.1| protein GrpE 1 [Propionibacterium acnes HL103PA1]
          Length = 221

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 46/210 (21%), Positives = 93/210 (44%), Gaps = 19/210 (9%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           ++D + + S  +S   EE S  +  E  L +  E      R+ AE  N +RR DR++  +
Sbjct: 31  DVDIDADQSATDSPAPEELSRESQLEALLAERTE---DLQRLQAEYVNYKRRVDRDRALS 87

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
           +   + K   D++ V D+++ A     ++                 G ++   E+     
Sbjct: 88  RQSGVDKVITDLMPVLDSIAMARQHGEVEG----------------GFKLVVDELEKVAN 131

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
            +G+         F+PN+H+A+ + P + V   ++ +V+Q GY + +RVLRPA V++S  
Sbjct: 132 NHGLTSFGEVGDVFDPNLHEALMQMPMEGVSVTSVSQVMQPGYKLGDRVLRPARVAVSDP 191

Query: 189 KTQNPTEEKKETIEQPSPLDIEERNKTQTK 218
                + ++    +  S    E+    + +
Sbjct: 192 DPNATSADESSQADGESAQANEDDETPRNE 221


>gi|311278429|ref|YP_003940660.1| GrpE protein [Enterobacter cloacae SCF1]
 gi|308747624|gb|ADO47376.1| GrpE protein [Enterobacter cloacae SCF1]
          Length = 197

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 59/190 (31%), Positives = 98/190 (51%), Gaps = 9/190 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR-DKYLRVIAEMENLRRR 60
           ET   +    +   P  +         +I   E  L +++    D  LRV AEMENLRRR
Sbjct: 16  ETIKDQHEEVEAVEPGASAEQVDPRDEKIANLEAQLVEAQNRERDGVLRVKAEMENLRRR 75

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+ + + A  +++ KF  ++L V D+L RAL+ A              L  ++EGIE+T 
Sbjct: 76  TELDVEKAHKFALEKFVNELLPVIDSLDRALEVADKS--------NPDLTPMVEGIELTL 127

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + M+  + ++GV+ +   +   +PN+HQA+     D V    ++ V+Q GY +N R +R 
Sbjct: 128 KSMLDVVRKFGVEVVGDINVPMDPNVHQAIAMVESDDVAPGNVLMVMQKGYTLNGRTIRA 187

Query: 181 ALVSISKGKT 190
           A+VS++K K 
Sbjct: 188 AMVSVAKAKG 197


>gi|183599793|ref|ZP_02961286.1| hypothetical protein PROSTU_03301 [Providencia stuartii ATCC 25827]
 gi|188022057|gb|EDU60097.1| hypothetical protein PROSTU_03301 [Providencia stuartii ATCC 25827]
          Length = 196

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 59/187 (31%), Positives = 105/187 (56%), Gaps = 9/187 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR-DKYLRVIAEMENLRRR 60
           E   SE   ++E   ++  +      + I   EE L  S++   +  LR  AE+EN+RRR
Sbjct: 18  EEQKSELEQEQEAQQADPQAEVQALAARIAELEEQLAASQKVEREAMLRAHAEIENIRRR 77

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+++ + A  +++ KF+ ++L V DNL RA+D+A  +            K+++EG+++T 
Sbjct: 78  TEQDIEKAHKFALEKFSNELLPVIDNLERAIDAADHE--------SETSKAMLEGLDLTL 129

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           +  +S + ++G++ +   +  FNP +HQAM          N +I V+Q GY +N R+LRP
Sbjct: 130 KTFLSAVGKFGIEVVGESNVAFNPEVHQAMTMVESPDHQPNQVIDVMQKGYLLNGRLLRP 189

Query: 181 ALVSISK 187
           A+V +SK
Sbjct: 190 AMVIVSK 196


>gi|307106018|gb|EFN54265.1| hypothetical protein CHLNCDRAFT_36141 [Chlorella variabilis]
          Length = 176

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 71/146 (48%), Gaps = 8/146 (5%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           ++ RDK+LR+ A+ +N R+RT  EK   +         ++L + DN   A     L+   
Sbjct: 10  QDTRDKFLRLQADFDNFRKRTAGEKDALRVSVRGDTVAELLPLVDNFELAKAQLKLETEG 69

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160
                    K +    +   ++M+      G++ +      F+PN+H A+  E  + VP 
Sbjct: 70  E--------KRVDAAYQGLYKQMVELFRGLGLEAVPGVGSPFDPNLHDAIMREASEDVPD 121

Query: 161 NTIIKVVQDGYAINERVLRPALVSIS 186
            T+++  + G+ I +++LRPA+V +S
Sbjct: 122 GTVLEEFRKGFVIGDKLLRPAMVKVS 147


>gi|170691351|ref|ZP_02882516.1| GrpE protein [Burkholderia graminis C4D1M]
 gi|170143556|gb|EDT11719.1| GrpE protein [Burkholderia graminis C4D1M]
          Length = 195

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 55/188 (29%), Positives = 95/188 (50%), Gaps = 12/188 (6%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   +E    +++  ++  + T           E+  +  E ++ +LR  AE EN+RRR 
Sbjct: 20  ERPAAEAVTPEQEAAASVATDTPAATGAEAALAEAQAKIAELQESFLRAKAETENVRRRA 79

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
             +   A  ++I  FA  +L V D+L  A+  +  D           L  + EG+E+T R
Sbjct: 80  QEDVAKAHKFAIESFAEHLLPVIDSLEAAVAHSSDD-----------LAKVREGVELTLR 128

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           ++   LE+  V  ++   +KF+P+ HQA+   P      NT++ V+Q G+ I +RVLRPA
Sbjct: 129 QLTGALEKGRVVALNPVGEKFDPHRHQAISMVP-ADQEPNTVVAVLQKGFVIADRVLRPA 187

Query: 182 LVSISKGK 189
           LV+++  K
Sbjct: 188 LVTVAAPK 195


>gi|254491185|ref|ZP_05104366.1| co-chaperone GrpE [Methylophaga thiooxidans DMS010]
 gi|224463698|gb|EEF79966.1| co-chaperone GrpE [Methylophaga thiooxydans DMS010]
          Length = 181

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 55/185 (29%), Positives = 107/185 (57%), Gaps = 8/185 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E            N S  N     E+S   + E++ ++++E  ++ L   A++EN+RRR 
Sbjct: 4   EEIEKPDLEQDNINDSEENVQPEVEQSTEKLLEDARSKADEHWNELLLARADLENMRRRH 63

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
            R+ + A  +++ KF  ++L + D+L   L +A  +        E+ L+++ EG+EMT +
Sbjct: 64  ARDLESAHKHALDKFVNELLPICDSLELGLSAANGE--------EATLETVREGMEMTLK 115

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
            ++S + + G+++++ + Q F+P +HQA+  +P + + AN +I V+Q GY+ N R+LRPA
Sbjct: 116 MLLSNIGKLGLEQVNPEGQAFDPELHQAVSMQPSEGIEANQVITVMQKGYSFNGRLLRPA 175

Query: 182 LVSIS 186
           +V +S
Sbjct: 176 MVVVS 180


>gi|147780431|emb|CAN65730.1| hypothetical protein VITISV_011922 [Vitis vinifera]
          Length = 369

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 35/206 (16%), Positives = 75/206 (36%), Gaps = 30/206 (14%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E  +S       +  +       E+            +    +++ LR+ A+ +N R+RT
Sbjct: 149 EALVSNDESKAAEIEAFIKFIEDEKIDLEKKVAALSEELSSDKERILRISADFDNFRKRT 208

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           DRE+    + +  +   ++L V DN  RA     ++    E         +    +   +
Sbjct: 209 DRERLSLVTNAQGEVLENLLPVLDNFERAKAQIKVETEGEE--------KINNSYQSIYK 260

Query: 122 EMMSTLERYGVKKIDAKDQKFN----------------------PNMHQAMFEEPHDTVP 159
           + +  L   GV  ++     F+                         H+A+  E      
Sbjct: 261 QFVEILGSLGVTPVETIGNPFDPLVSFRAGSKFSLVLDELSRMLYQFHEAIMREDSTEFE 320

Query: 160 ANTIIKVVQDGYAINERVLRPALVSI 185
            + II+  + G+ + +R+LRP++V +
Sbjct: 321 EDVIIQEFRKGFKLGDRLLRPSMVKV 346


>gi|294637627|ref|ZP_06715906.1| co-chaperone GrpE [Edwardsiella tarda ATCC 23685]
 gi|291089182|gb|EFE21743.1| co-chaperone GrpE [Edwardsiella tarda ATCC 23685]
          Length = 200

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 60/187 (32%), Positives = 107/187 (57%), Gaps = 12/187 (6%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDK----YLRVIAEMENLRRRT 61
           + + ++  +  +   +S AE  +      E   Q +   DK     LR  AEM+N+RRR 
Sbjct: 22  NAEQVENAELQAETQASGAEPDARDARIAELEAQLKAMGDKERDIMLRARAEMDNVRRRA 81

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           +++ + A  +++ KF+ ++L V DNL RAL+ A            S L S+IEG+E+T +
Sbjct: 82  EQDVEKAHKFALEKFSSELLPVIDNLERALEVADKS--------NSELVSMIEGVELTLK 133

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
            ++  + ++GV+++   +  FNP++HQAM   P +    N ++ V+Q GY +N R++RPA
Sbjct: 134 SLLDVVRKFGVEQVAEVNVPFNPDVHQAMTMLPSEEHAPNQVMMVMQKGYTLNGRLIRPA 193

Query: 182 LVSISKG 188
           +V++SKG
Sbjct: 194 MVAVSKG 200


>gi|323978477|gb|EGB73560.1| GrpE protein [Escherichia coli TW10509]
          Length = 241

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 57/189 (30%), Positives = 99/189 (52%), Gaps = 9/189 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR-DKYLRVIAEMENLRRR 60
           E  M +    +   P  +         +I   E  L +++    D  LRV AEMENLRRR
Sbjct: 61  EIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLRRR 120

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+ + + A  +++ KF  ++L V D+L RAL+ A              + +++EGIE+T 
Sbjct: 121 TELDIEKAHKFALEKFINELLPVIDSLDRALEVADKT--------NPDMSAMVEGIELTL 172

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + M+  + ++GV+ I   +   +PN+HQA+     D V    ++ ++Q GY +N R +R 
Sbjct: 173 KSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRA 232

Query: 181 ALVSISKGK 189
           A+V+++K K
Sbjct: 233 AMVTVAKAK 241


>gi|15604476|ref|NP_220994.1| heat shock protein GrpE [Rickettsia prowazekii str. Madrid E]
 gi|6225481|sp|Q9ZCT4|GRPE_RICPR RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|3861170|emb|CAA15070.1| GRPE PROTEIN (grpE) [Rickettsia prowazekii]
 gi|292572258|gb|ADE30173.1| GrpE protein [Rickettsia prowazekii Rp22]
          Length = 178

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 51/162 (31%), Positives = 91/162 (56%), Gaps = 8/162 (4%)

Query: 29  EINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLS 88
           +         + EE +DK +R  AE++N R+R ++ + +A+ Y+IA FA+++L+VSDNL+
Sbjct: 24  DNEEIVRLKAEIEELKDKLIRTTAEIDNTRKRLEKARDEAKDYAIATFAKELLNVSDNLA 83

Query: 89  RALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDA-KDQKFNPNMH 147
           RAL   P +           + ++I G++MT+ E+     ++ +++I       F+ N+H
Sbjct: 84  RALAHKPANSDVE-------VTNIISGVQMTKDELDKIFHKHHIEEIKPAIGSMFDYNLH 136

Query: 148 QAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
            A+    H     N+II ++Q GY I +R+LRPA V + K  
Sbjct: 137 NAISHIEHPDHEPNSIITLMQSGYKIRDRLLRPAAVQVVKKP 178


>gi|157964777|ref|YP_001499601.1| GrpE protein [Rickettsia massiliae MTU5]
 gi|157844553|gb|ABV85054.1| GrpE protein [Rickettsia massiliae MTU5]
          Length = 194

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 56/188 (29%), Positives = 103/188 (54%), Gaps = 8/188 (4%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
             M + NI+ ++     + +    ++          + EE +DK +R  AE++N R+R +
Sbjct: 14  NNMIDDNIENDEQTIITDIAEEIVETTNPEITALKAEIEELKDKLIRTTAEIDNTRKRLE 73

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           + + +A+ Y+IA FA+++L+VSDNLSRAL   P +           + ++I G++MT+ E
Sbjct: 74  KARDEAKDYAIATFAKELLNVSDNLSRALAHKPANSDVE-------VTNIIAGVQMTKDE 126

Query: 123 MMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           +     ++ +++I  +    FN N+H A+ +  H     N+II ++Q GY I +R+LRPA
Sbjct: 127 LDKIFHKHHIEEIKPEIGSMFNYNLHNAIAQVEHPDHAPNSIITLMQSGYKIRDRLLRPA 186

Query: 182 LVSISKGK 189
            V + K  
Sbjct: 187 TVQVVKKP 194


>gi|86605671|ref|YP_474434.1| heat shock protein GrpE [Synechococcus sp. JA-3-3Ab]
 gi|123738124|sp|Q2JVR0|GRPE_SYNJA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|86554213|gb|ABC99171.1| co-chaperone GrpE [Synechococcus sp. JA-3-3Ab]
          Length = 237

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 51/210 (24%), Positives = 93/210 (44%), Gaps = 9/210 (4%)

Query: 1   METFMSEKNIDK-EKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRR 59
           +E   +E +    E +   +   +   K      E +  Q +E  + Y+R+ A+ EN RR
Sbjct: 26  LEDREAEASTSSGEASAEASQDLSETLKQLQQELEITRQQLKEKEESYIRLYADFENYRR 85

Query: 60  RTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMT 119
           RT REK++       KF  ++L V D+  RA     L+     +   S         +  
Sbjct: 86  RTQREKEEFSQKERQKFVLEILPVVDSFERAQQQLKLETDREREVHNS--------YQSV 137

Query: 120 RREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
            R ++  L++ GV ++ +  Q F+PN+H+A+  +P    P + +    Q GY + + V+R
Sbjct: 138 YRLLVECLKKMGVSRMKSVGQPFDPNLHEAIARQPSSEYPEDVVAVEYQPGYKLGDLVIR 197

Query: 180 PALVSISKGKTQNPTEEKKETIEQPSPLDI 209
            A+V++S G   +          +P P   
Sbjct: 198 HAMVAVSSGSPTSEPSPSDPATPKPEPEST 227


>gi|117923823|ref|YP_864440.1| GrpE protein [Magnetococcus sp. MC-1]
 gi|117607579|gb|ABK43034.1| GrpE protein [Magnetococcus sp. MC-1]
          Length = 210

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 62/171 (36%), Positives = 110/171 (64%), Gaps = 6/171 (3%)

Query: 19  ANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFAR 78
                + E S     + +L+++EE +  YLR +A+M+NLR+R  RE + A+ +++  FAR
Sbjct: 46  PEEENSTEPSLEAQLQMALDKAEEQQKNYLRSMADMDNLRKRNAREMEQARKFAVEGFAR 105

Query: 79  DMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
           DMLSV+DNL RA+     +           +K++++G++M   E+  +LE++G+K+I+A 
Sbjct: 106 DMLSVADNLERAMSHMDQESD------NEQIKAIVDGVKMVNSELAKSLEKHGIKRIEAM 159

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
            Q F+PN+HQA+ +   D VP +T+++ +Q GY +NER+LRP++V ++K  
Sbjct: 160 GQMFDPNLHQAVMQVADDRVPPDTVVQEMQAGYTLNERLLRPSMVGVAKAP 210


>gi|307728532|ref|YP_003905756.1| GrpE protein [Burkholderia sp. CCGE1003]
 gi|307583067|gb|ADN56465.1| GrpE protein [Burkholderia sp. CCGE1003]
          Length = 194

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 54/177 (30%), Positives = 92/177 (51%), Gaps = 12/177 (6%)

Query: 13  EKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYS 72
           E+  + + ++ A          E+  +  E ++ +LR  AE EN+RRR   +   A  ++
Sbjct: 30  EQEAAASVATDAPATGAEAALAEAQAKIAELQESFLRAKAETENVRRRAQEDVAKAHKFA 89

Query: 73  IAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGV 132
           I  FA  +L V D+L  A+  +  D           L  + EG+E+T R++   LE+  V
Sbjct: 90  IENFAEHLLPVVDSLEAAVAHSSDD-----------LAKVREGVELTLRQLTGALEKGRV 138

Query: 133 KKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
             ++   +KF+P+ HQA+   P      NT++ V+Q G+ I +RVLRPALV+++  K
Sbjct: 139 VALNPVGEKFDPHRHQAISMVP-ADQEPNTVVAVLQKGFVIADRVLRPALVTVAAPK 194


>gi|198284379|ref|YP_002220700.1| GrpE protein [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218667472|ref|YP_002427043.1| co-chaperone GrpE [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|226737096|sp|B7J7Y0|GRPE_ACIF2 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737097|sp|B5ENA4|GRPE_ACIF5 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|198248900|gb|ACH84493.1| GrpE protein [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218519685|gb|ACK80271.1| co-chaperone GrpE [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 171

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 53/179 (29%), Positives = 98/179 (54%), Gaps = 9/179 (5%)

Query: 15  NPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIA 74
           N     S + E +           ++E +R+ YLR +A++ENLR+R +++ +DA++Y++ 
Sbjct: 2   NEEKEESPSTEAEGAGAEVVNWEERAETYRNDYLRALADIENLRKRHEKQVEDARNYAVD 61

Query: 75  KFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKK 134
           +FAR++L V D+L  AL S          +    +  L +G+E T       L + G+  
Sbjct: 62  RFARELLPVVDSLELALAS--------PVEGAESIALLRQGLENTLTLFAKALGKAGIAP 113

Query: 135 IDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNP 193
           I+  + +F+P++HQA+     +   AN ++ V Q GY +++R+LRP++VS+SK      
Sbjct: 114 IEMGEGRFDPHLHQAIAMVETEG-EANRVLAVHQKGYVMHDRLLRPSMVSVSKAPKAAQ 171


>gi|145299905|ref|YP_001142746.1| heat shock protein GrpE [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|226737102|sp|A4SQ26|GRPE_AERS4 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|142852677|gb|ABO90998.1| heat shock protein GrpE [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 191

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 68/196 (34%), Positives = 104/196 (53%), Gaps = 15/196 (7%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSE-------EFRDKYLRVIAEM 54
           E    E     E  P       +E  +E     E   Q E       E R++ +R +AEM
Sbjct: 4   EEQKVETMEQVEAQPVEPTDVDSEVTAEQARIAELEAQLEAAQLASNEERERAIRAVAEM 63

Query: 55  ENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIE 114
           ENLRRR  ++ + A  +++ KFA ++L V DNL RA++ A  +           LK +IE
Sbjct: 64  ENLRRRAAQDVEKAHKFALEKFAAELLPVLDNLERAIELADKE--------SEELKPMIE 115

Query: 115 GIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAIN 174
           G+E+T + M S + ++G+  +D  +Q F+PN HQAM    +  +  NT+I V+Q GY +N
Sbjct: 116 GVELTLKSMQSGVAKFGLNPLDPLNQPFDPNAHQAMSMIENGELAPNTVIAVMQKGYELN 175

Query: 175 ERVLRPALVSISKGKT 190
            RV+RPA+V +SK   
Sbjct: 176 GRVIRPAMVMVSKAPA 191


>gi|114330432|ref|YP_746654.1| GrpE protein [Nitrosomonas eutropha C91]
 gi|122314549|sp|Q0AIY2|GRPE_NITEC RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|114307446|gb|ABI58689.1| GrpE protein [Nitrosomonas eutropha C91]
          Length = 196

 Score =  112 bits (279), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 56/190 (29%), Positives = 103/190 (54%), Gaps = 12/190 (6%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           ME  + +++       +                +E+  ++ E  D +LR  AE EN+R+R
Sbjct: 18  MEDTLEKQHSGASTENTERAEEGVVIPDLEQQLKEAEIRAAEHHDAWLRAKAETENIRKR 77

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
              +  +A  Y+I  FA  +L+V D+L  AL               S ++SL +G+E+TR
Sbjct: 78  AQTDIANAHKYAIDNFATQLLAVMDSLDAALAV-----------ENSTIESLKDGVELTR 126

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           +++ +  E++ +  I+ + +KF+P+ H+AM       +P NT+ +V+Q GY ++ERV+RP
Sbjct: 127 KQLAAVFEKFNIHTINPQGEKFDPHQHEAMCTVE-SDIPPNTVTQVMQKGYVLHERVIRP 185

Query: 181 ALVSISKGKT 190
           A+V++SK K+
Sbjct: 186 AMVAVSKAKS 195


>gi|317154030|ref|YP_004122078.1| GrpE protein [Desulfovibrio aespoeensis Aspo-2]
 gi|316944281|gb|ADU63332.1| GrpE protein [Desulfovibrio aespoeensis Aspo-2]
          Length = 207

 Score =  112 bits (279), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 49/177 (27%), Positives = 85/177 (48%), Gaps = 17/177 (9%)

Query: 20  NSSTAEEKSEINIPEESLNQ--------SEEFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
           + + AE     +  E                  +  LR +A+ ENL++R  RE ++ + Y
Sbjct: 38  DEAQAEVSLSQDELEALCRASVCPGCDVHRAAEEIRLRALADAENLKKRLLRETEEMKKY 97

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
           +      D+L V DNL  AL              +   K+ + G++MTR+     ++ +G
Sbjct: 98  AGESILADLLPVLDNLDLALAHTGN--------LDGACKNFVIGVDMTRKIFADAVKGHG 149

Query: 132 VKKIDA-KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           + +IDA +  +FNP +H+A+       +  N I++VVQ GY +  R+LRPA V ++K
Sbjct: 150 LVQIDAARGGEFNPEIHEAVGTVEDGELDDNRIVQVVQRGYTLKGRLLRPAKVMVNK 206


>gi|325981942|ref|YP_004294344.1| GrpE protein [Nitrosomonas sp. AL212]
 gi|325531461|gb|ADZ26182.1| GrpE protein [Nitrosomonas sp. AL212]
          Length = 197

 Score =  112 bits (279), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 57/192 (29%), Positives = 106/192 (55%), Gaps = 14/192 (7%)

Query: 1   METFMSEKNID--KEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLR 58
           M     E N+               + + S  ++ + + N++ E +D ++R  AE EN+R
Sbjct: 17  MADIKEEVNVPGITSDATIQTGEIKSSQPSLEDLLKAAENKAAEHQDAWMRAKAETENIR 76

Query: 59  RRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEM 118
           +R+  +  +A  Y+I  F+ ++L+V D+L  AL               + ++S   G+E+
Sbjct: 77  KRSQNDIANAHKYAIENFSTELLTVMDSLEAALAV-----------ENASVESFKNGVEL 125

Query: 119 TRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVL 178
           T++++MS  +++ +K ID   +KF+P+ HQAM       +  NTI++V+Q GY ++ER++
Sbjct: 126 TQKQLMSVFDKFNIKVIDPAGEKFDPHQHQAMCIVE-SELTPNTIVQVMQKGYKLHERII 184

Query: 179 RPALVSISKGKT 190
           RPALVS+SK + 
Sbjct: 185 RPALVSVSKAQG 196


>gi|313836378|gb|EFS74092.1| co-chaperone GrpE [Propionibacterium acnes HL037PA2]
 gi|314928844|gb|EFS92675.1| co-chaperone GrpE [Propionibacterium acnes HL044PA1]
 gi|314971279|gb|EFT15377.1| co-chaperone GrpE [Propionibacterium acnes HL037PA3]
 gi|328906410|gb|EGG26185.1| co-chaperone GrpE [Propionibacterium sp. P08]
          Length = 221

 Score =  112 bits (279), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 45/209 (21%), Positives = 89/209 (42%), Gaps = 19/209 (9%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           ++D + + S  +S   EE S  +  E  L +  E      R+ AE  N +RR DR++  +
Sbjct: 31  DVDIDADQSATDSQAPEELSRESQLEALLAERTE---DLQRLQAEYVNYKRRVDRDRALS 87

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
           +   + K    ++ V D+++ A     ++                 G ++   E+     
Sbjct: 88  RQSGVDKVITALMPVLDSIAMARQHGEVEG----------------GFKLVVDELEKVAN 131

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
            +G+         F+PN+H+A+ + P + V   ++ +V+Q GY + +RVLRPA V++S  
Sbjct: 132 NHGLTSFGEVGDAFDPNLHEALMQMPMEGVSVTSVSQVMQPGYKLGDRVLRPARVAVSDP 191

Query: 189 KTQNPTEEKKETIEQPSPLDIEERNKTQT 217
                  ++    +  S    E+      
Sbjct: 192 DPNATPVDESAQADGESAQADEDDETPHN 220


>gi|226311616|ref|YP_002771510.1| GrpE protein [Brevibacillus brevis NBRC 100599]
 gi|226094564|dbj|BAH43006.1| GrpE protein [Brevibacillus brevis NBRC 100599]
          Length = 196

 Score =  112 bits (279), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 51/184 (27%), Positives = 101/184 (54%), Gaps = 9/184 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E    +  +++E+   +A+ + A E +          Q+E+ +++ LR +A+M+NLRRR 
Sbjct: 20  EKVTQDPTLEEEQVAEDADQAEATEMNWEQEAAHWKAQAEDHQNRMLRAMADMDNLRRRV 79

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
            +E++D   Y+  K   ++L V DN  RAL +               ++SL+EG+ M  R
Sbjct: 80  RKEQEDLAKYASLKIVEELLPVLDNFERALAADKE---------SMTVESLLEGVNMVYR 130

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           +M+   ++ G+  I+A+ + F+P++HQA+ +  +    +  ++  +Q GY   +RV+RPA
Sbjct: 131 QMVQVFDKEGLAAIEAQGKPFDPHIHQAVMQTQNPEFESGVVVAELQKGYMFKDRVVRPA 190

Query: 182 LVSI 185
           +V +
Sbjct: 191 MVQV 194


>gi|187929942|ref|YP_001900429.1| heat shock protein GrpE [Ralstonia pickettii 12J]
 gi|226737160|sp|B2UBP7|GRPE_RALPJ RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|187726832|gb|ACD27997.1| GrpE protein [Ralstonia pickettii 12J]
          Length = 215

 Score =  112 bits (279), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 50/158 (31%), Positives = 84/158 (53%), Gaps = 12/158 (7%)

Query: 32  IPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRAL 91
             E +  ++ +  + + R  AE EN+RRR   +   A  ++I  FA  +L V D+L  AL
Sbjct: 70  QLEAAEEKARQNYENWARATAEGENIRRRGQDDVAKAHKFAIEGFAEYLLPVMDSLQAAL 129

Query: 92  DSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMF 151
                D              L EG+E+T +++ +  E+  V +++   +KF+P+ HQA+ 
Sbjct: 130 ADTSGDAT-----------KLREGVELTLKQLYAAFEKGRVTELNPVGEKFDPHRHQAIS 178

Query: 152 EEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
             P     ANT++ V+Q GY + +RVLRPALV+++  K
Sbjct: 179 MVP-ADQEANTVVAVLQRGYTLADRVLRPALVTVAAPK 215


>gi|325578788|ref|ZP_08148835.1| co-chaperone GrpE [Haemophilus parainfluenzae ATCC 33392]
 gi|325159612|gb|EGC71744.1| co-chaperone GrpE [Haemophilus parainfluenzae ATCC 33392]
          Length = 195

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 63/201 (31%), Positives = 113/201 (56%), Gaps = 22/201 (10%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKY------------- 47
           ME  MSE+  +  +N         E  S  +  EE++ + +E  ++              
Sbjct: 1   MEKKMSEQAQNLNENEELVEDVQQETTSTEDPLEEAIARVQELEEQLKAQVEETSKKEQD 60

Query: 48  --LRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKS 105
             LR  AE++N+RRR++++ + A  +++ KF++D+L+  DNL RAL +          K 
Sbjct: 61  LLLRTRAEIDNMRRRSEQDIEKAHKFALEKFSKDILNTIDNLERALAT-------PANKE 113

Query: 106 ESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIK 165
           +  +K+L +G+E+T +E++ST+ R+GV+ + A    FNP++HQA+  +P +    N I  
Sbjct: 114 DENIKALFDGVELTLKELLSTVSRFGVEPVGAVGDTFNPDLHQAISMQPAEGFTTNQITT 173

Query: 166 VVQDGYAINERVLRPALVSIS 186
           V+Q GY +N RV+RPA+V ++
Sbjct: 174 VLQKGYTLNGRVIRPAMVMVA 194


>gi|300940953|ref|ZP_07155477.1| co-chaperone GrpE [Escherichia coli MS 21-1]
 gi|300454277|gb|EFK17770.1| co-chaperone GrpE [Escherichia coli MS 21-1]
          Length = 241

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 57/189 (30%), Positives = 99/189 (52%), Gaps = 9/189 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR-DKYLRVIAEMENLRRR 60
           E  M +    +   P  +         +I   E  L +++    D  LRV AEMENLRRR
Sbjct: 61  EIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLRRR 120

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+ + + A  +++ KF  ++L V D+L RAL+ A              + +++EGIE+T 
Sbjct: 121 TELDIEKAHKFALEKFINELLPVIDSLDRALEVADKA--------NPDMSAMVEGIELTL 172

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + M+  + ++GV+ I   +   +PN+HQA+     D V    ++ ++Q GY +N R +R 
Sbjct: 173 KSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRA 232

Query: 181 ALVSISKGK 189
           A+V+++K K
Sbjct: 233 AMVTVAKAK 241


>gi|121595520|ref|YP_987416.1| heat shock protein GrpE [Acidovorax sp. JS42]
 gi|226737098|sp|A1WAR5|GRPE_ACISJ RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|120607600|gb|ABM43340.1| GrpE protein [Acidovorax sp. JS42]
          Length = 178

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 63/190 (33%), Positives = 95/190 (50%), Gaps = 17/190 (8%)

Query: 5   MSEKNID----KEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           MSE        +E   + + ++  E         E   +S +  D++LR  AE EN RRR
Sbjct: 1   MSENQNPPPSPEEIEAAMSANAADELNRLQGELAELKAKSADLADQFLRAKAEAENARRR 60

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
            + E   A+ + I  FA  +L V D+L  AL               +  + L EG + T 
Sbjct: 61  AEDEVAKARKFGIESFAESLLPVCDSLDAALAI-----------ENATAEQLREGSDATL 109

Query: 121 REMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
           R++MS LER  V  ++ +   KF+P+ HQA+   P     ANT++ V+Q GY I +RVLR
Sbjct: 110 RQLMSALERNKVVIVNPEAGTKFDPHQHQAISMVP-ADQEANTVVSVLQKGYLIFDRVLR 168

Query: 180 PALVSISKGK 189
           PALV+++  K
Sbjct: 169 PALVTVAAPK 178


>gi|327335194|gb|EGE76904.1| protein GrpE 1 [Propionibacterium acnes HL097PA1]
          Length = 221

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 46/210 (21%), Positives = 93/210 (44%), Gaps = 19/210 (9%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           ++D + + S  +S   EE S  +  E  L +  E      R+ AE  N +RR DR++  +
Sbjct: 31  DVDIDADQSATDSPAPEELSRESQLEALLAERIE---DLQRLQAEYVNYKRRVDRDRALS 87

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
           +   + K   D++ V D+++ A     ++                 G ++   E+     
Sbjct: 88  RQSGVDKVITDLMPVLDSIAMARQHGEVEG----------------GFKLVVDELEKVAN 131

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
            +G+         F+PN+H+A+ + P + V   ++ +V+Q GY + +RVLRPA V++S  
Sbjct: 132 NHGLTSFGEVGDVFDPNLHEALMQMPMEGVSVTSVSQVMQPGYKLGDRVLRPARVAVSDP 191

Query: 189 KTQNPTEEKKETIEQPSPLDIEERNKTQTK 218
                + ++    +  S    E+    + +
Sbjct: 192 DPNATSADESSQADGESAQANEDDETPRNE 221


>gi|83719694|ref|YP_441853.1| heat shock protein GrpE [Burkholderia thailandensis E264]
 gi|167618790|ref|ZP_02387421.1| co-chaperone GrpE [Burkholderia thailandensis Bt4]
 gi|257138021|ref|ZP_05586283.1| heat shock protein GrpE [Burkholderia thailandensis E264]
 gi|123767684|sp|Q2SYZ6|GRPE_BURTA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|83653519|gb|ABC37582.1| co-chaperone GrpE [Burkholderia thailandensis E264]
          Length = 178

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 57/190 (30%), Positives = 97/190 (51%), Gaps = 13/190 (6%)

Query: 1   METFMSE-KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRR 59
           ME       +   E+    A ++     +      E+  +  E ++ +LR  AE EN+RR
Sbjct: 1   MENTQENPTDQTTEETGREAQAAENAAPAAEAALAEAQAKIAELQESFLRAKAETENVRR 60

Query: 60  RTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMT 119
           R   +   A  ++I  FA ++L V D+L  A+             +   L  + EG+E+T
Sbjct: 61  RAQDDVAKAHKFAIESFAENLLPVLDSLEAAV-----------GDTSGDLAKVREGVELT 109

Query: 120 RREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
            R++ S LE+  V  ++   +KF+P++HQA+   P      NT++ V+Q GY I +RVLR
Sbjct: 110 LRQLTSALEKGRVAALNPVGEKFDPHLHQAISMVP-ADQEPNTVVAVLQKGYTIADRVLR 168

Query: 180 PALVSISKGK 189
           PALV++++ K
Sbjct: 169 PALVTVAQPK 178


>gi|83589448|ref|YP_429457.1| GrpE protein [Moorella thermoacetica ATCC 39073]
 gi|83572362|gb|ABC18914.1| GrpE protein [Moorella thermoacetica ATCC 39073]
          Length = 225

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 52/197 (26%), Positives = 92/197 (46%), Gaps = 11/197 (5%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +  +         + T E  S     E       E + +YLR+ A+ +N R+RT RE+++
Sbjct: 39  EQAEAMDAAGEIVNLTEEINSLRAEVENKTAALAELQQRYLRLQADFDNYRKRTRREQEE 98

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
               + A+    +L V DNL RAL +   + A          + L  G+EMT R++   L
Sbjct: 99  LTRMAAARLITSLLPVLDNLERALAAVTDNKA----------EGLATGVEMTLRQLKEIL 148

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVP-ANTIIKVVQDGYAINERVLRPALVSIS 186
           E+ G+  I A  Q FNP +H+A+  E  +    AN ++   + GY +  ++LRPA+V ++
Sbjct: 149 EQEGLTPIAALGQPFNPELHEAVAREETENPEQANMVVAEFRRGYTLKGKLLRPAMVKVA 208

Query: 187 KGKTQNPTEEKKETIEQ 203
                     ++   ++
Sbjct: 209 VAGATVKENGQEVDKDE 225


>gi|84501185|ref|ZP_00999390.1| co-chaperone GrpE [Oceanicola batsensis HTCC2597]
 gi|84390476|gb|EAQ02964.1| co-chaperone GrpE [Oceanicola batsensis HTCC2597]
          Length = 186

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 57/168 (33%), Positives = 103/168 (61%), Gaps = 9/168 (5%)

Query: 24  AEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSV 83
            E   E    +    + +E +DK++R +A+ EN R+R D+++++A+ Y  +K ARD+L +
Sbjct: 26  DEVDDETIEVDALRAERDELKDKWMRALADAENSRKRADKQRREAELYGGSKLARDLLPI 85

Query: 84  SDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKF 142
            DN+ RAL++A      +         +LIEG+E+T RE+++T +++G++ I  +   +F
Sbjct: 86  YDNMKRALEAAGEKTDENS--------ALIEGVELTMRELLNTFKKHGMEPISPEVGDRF 137

Query: 143 NPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           +PN+H+AMFE P     A  II+V  +G+ +++R+LRPA V +S    
Sbjct: 138 DPNVHEAMFEAPVPGTKAGDIIQVSAEGFWLSDRLLRPAQVGVSSTPA 185


>gi|167644137|ref|YP_001681800.1| heat shock protein GrpE [Caulobacter sp. K31]
 gi|254799586|sp|B0T367|GRPE_CAUSK RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|167346567|gb|ABZ69302.1| GrpE protein [Caulobacter sp. K31]
          Length = 205

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 65/179 (36%), Positives = 102/179 (56%), Gaps = 7/179 (3%)

Query: 13  EKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYS 72
               + A     E        E    +    +D+ LR  AE EN +RR +RE  DA++Y+
Sbjct: 2   TDEQTPAEDVAFEADDASQEIEALKLEVAALKDQALRYAAEAENTKRRAERESNDARAYA 61

Query: 73  IAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGV 132
           I KFARD+L  +DNLSRA   +P D  +        + + I G+EMT +E+    ER G+
Sbjct: 62  IQKFARDLLGAADNLSRATAMSPRDSQDP------AVTNYIIGVEMTEKELQGAFERNGL 115

Query: 133 KKIDA-KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           KKID  K +KF+P++HQA+ E+P   V A  +++V+Q GY +  R++RPA+V+++   +
Sbjct: 116 KKIDPAKGEKFDPHLHQAVMEQPSTEVAAGGVLQVLQAGYELMGRLVRPAMVAVAAKGS 174


>gi|209525543|ref|ZP_03274082.1| GrpE protein [Arthrospira maxima CS-328]
 gi|209494042|gb|EDZ94358.1| GrpE protein [Arthrospira maxima CS-328]
          Length = 253

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 44/208 (21%), Positives = 87/208 (41%), Gaps = 13/208 (6%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
               +  +  +           + ++     E    Q  +   +Y R+ A+ EN R+RT 
Sbjct: 59  EEAKDAEMSSDPIYIANEQLNEQLQTIAQARESLQTQLMDMTSQYQRLAADFENFRKRTQ 118

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           +EK+D +          +L V DN  RA                    ++ +  +   ++
Sbjct: 119 KEKEDLELNIKCSTIAQLLPVIDNFERARAHIK--------PQNDGEMNIHKSYQGVYKQ 170

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           M+  L++ GV  +  + ++F+PN+H+A+  +P    P  T+I+ +  GY + +RVLR A+
Sbjct: 171 MVECLKQIGVSPMRPEGEQFDPNLHEAVMRQPTSEYPEGTVIEELMRGYILGDRVLRHAM 230

Query: 183 VSISKGKTQNPTEEKKETIEQPSPLDIE 210
           V ++        E    T E P+    +
Sbjct: 231 VKVA-----TEPELSDTTEEPPAEGSED 253


>gi|238759666|ref|ZP_04620826.1| hypothetical protein yaldo0001_24710 [Yersinia aldovae ATCC 35236]
 gi|238702094|gb|EEP94651.1| hypothetical protein yaldo0001_24710 [Yersinia aldovae ATCC 35236]
          Length = 192

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 57/190 (30%), Positives = 98/190 (51%), Gaps = 9/190 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPE-ESLNQSEEFRDKYLRVIAEMENLRRR 60
           E    E     E+       +       +   E +     +  R+  LR  AE+EN+RRR
Sbjct: 11  EQASEEMENAAEQQVEVTQETGDGVDPRVTELEAQLAAAVQRERESLLRAKAEVENIRRR 70

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+ + + A  +++ +F+ ++L V DNL RALD+A            + L S+IEG+E+T 
Sbjct: 71  TELDVEKAHKFALERFSAELLPVIDNLERALDTADKS--------NTELTSMIEGVELTL 122

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + ++  + ++G++ +      FNP +HQAM          N ++ V+Q GY +N R+LRP
Sbjct: 123 KSLLDAVGKFGIEVVGETHVPFNPEVHQAMTMLESADHEPNHVMMVMQKGYTLNGRLLRP 182

Query: 181 ALVSISKGKT 190
           A+V++SK K 
Sbjct: 183 AMVAVSKAKA 192


>gi|74144100|dbj|BAE22153.1| unnamed protein product [Mus musculus]
          Length = 224

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 40/174 (22%), Positives = 86/174 (49%), Gaps = 3/174 (1%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
           ++P +    +  E++      +   + ++   +Y R +A+ EN+RRRT R  +DA+ + I
Sbjct: 46  EDPPDGLGPSLAEQALRLKAVKLEKEVQDLTLRYQRAVADCENIRRRTQRCVEDAKIFGI 105

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
             F +D++ V+D L +            + +    L+ + +G+ +    + S   ++G++
Sbjct: 106 QSFCKDLVEVADILEKTAKCCSEGAEPEDHRRT--LEKVFQGLSLLEARLKSVFTKHGLE 163

Query: 134 KIDAKDQKFNPNMHQAMFEEPHD-TVPANTIIKVVQDGYAINERVLRPALVSIS 186
           K+     K++P+ H+ +   P    V   T+  V QDGY ++ R +R A V ++
Sbjct: 164 KMTPIGDKYDPHEHELICHMPAGVGVQPGTVALVRQDGYKLHGRTIRLAQVEVA 217


>gi|222111741|ref|YP_002554005.1| heat shock protein grpe [Acidovorax ebreus TPSY]
 gi|254799590|sp|B9MDJ6|GRPE_DIAST RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|221731185|gb|ACM34005.1| GrpE protein [Acidovorax ebreus TPSY]
          Length = 178

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 61/190 (32%), Positives = 95/190 (50%), Gaps = 13/190 (6%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           M    +     +E   + + ++  E         E   +S +  D++LR  AE EN RRR
Sbjct: 1   MSENQNPSPSPEEIEAAMSANAADELNRLQGELAELKAKSADLADQFLRAKAEAENARRR 60

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
            + E   A+ + I  FA  +L V D+L  AL               +  + L EG + T 
Sbjct: 61  AEDEVAKARKFGIESFAESLLPVCDSLDAALAI-----------ENATAEQLREGSDATL 109

Query: 121 REMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
           R++MS LER  V  ++ +   KF+P+ HQA+   P     ANT++ V+Q GY I++RVLR
Sbjct: 110 RQLMSALERNKVVIVNPEAGTKFDPHQHQAISMVP-ADQEANTVVSVLQKGYLISDRVLR 168

Query: 180 PALVSISKGK 189
           PALV+++  K
Sbjct: 169 PALVTVAAPK 178


>gi|297799314|ref|XP_002867541.1| hypothetical protein ARALYDRAFT_492124 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297313377|gb|EFH43800.1| hypothetical protein ARALYDRAFT_492124 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 324

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 50/159 (31%), Positives = 93/159 (58%), Gaps = 5/159 (3%)

Query: 47  YLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPL-----DLANS 101
            LR  AEMEN+  RT R+ ++ + Y++  FA+ +L V+DNL RA           D +  
Sbjct: 166 VLRTYAEMENVMDRTRRDAENTKKYAVQNFAKSLLDVADNLGRASSVVKESFSKLDTSED 225

Query: 102 EKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPAN 161
              +  +LK+L+EG+EMT +++    +++G++K D  ++ F+PN H A+F+ P  + P  
Sbjct: 226 SAGAAPLLKTLLEGVEMTEKQLAEVFKKFGMEKYDPINEPFDPNRHNAVFQVPDASKPEG 285

Query: 162 TIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKET 200
           T+  V++ GY + +RV+RPA V +++       +++ + 
Sbjct: 286 TVAHVLKYGYTLYDRVIRPAEVGVTQAGENQEEKKESDA 324


>gi|113460794|ref|YP_718861.1| heat shock protein GrpE [Haemophilus somnus 129PT]
 gi|170719175|ref|YP_001784319.1| heat shock protein GrpE [Haemophilus somnus 2336]
 gi|123132056|sp|Q0I2Y4|GRPE_HAES1 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|189041743|sp|B0UT70|GRPE_HAES2 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|112822837|gb|ABI24926.1| GrpE protein [Haemophilus somnus 129PT]
 gi|168827304|gb|ACA32675.1| GrpE protein [Haemophilus somnus 2336]
          Length = 195

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 56/186 (30%), Positives = 106/186 (56%), Gaps = 7/186 (3%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           +ET   ++   +E    + ++          + E+ +   ++ +D  LR  AE++N+RRR
Sbjct: 16  LETQNEQEKPMEETEIQDGDALENAIARVQELEEQLIQAVKKEQDILLRTRAEIDNIRRR 75

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
            +++ + A  +++ KFA+D+L   DNL RAL +               +KSL++G+E+T 
Sbjct: 76  AEQDVEKAHKFALEKFAKDLLETIDNLERALST-------PANVENETIKSLVDGVELTL 128

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + ++ST+ R+GV+ +    + FNP +HQA+  +P +   +N I  V+Q GY +N RV+RP
Sbjct: 129 KGLLSTVARFGVEPVGVIGETFNPELHQAISMQPTEGFESNQITVVLQKGYLLNGRVIRP 188

Query: 181 ALVSIS 186
           A+V ++
Sbjct: 189 AMVMVA 194


>gi|149909294|ref|ZP_01897950.1| Hsp 24 DnaK nucleotide exchange factor; probable member of
           theDnaK/DnaJ/GrpE foldase complex [Moritella sp. PE36]
 gi|149807611|gb|EDM67559.1| Hsp 24 DnaK nucleotide exchange factor; probable member of
           theDnaK/DnaJ/GrpE foldase complex [Moritella sp. PE36]
          Length = 216

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 63/193 (32%), Positives = 103/193 (53%), Gaps = 8/193 (4%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
           + + +  E+     + S A   +     E++   + EF+D  LR  A+ +N+RRR   + 
Sbjct: 32  TAEEVTVEEATVEVDESVARIAALEAELEKATASAAEFKDVALRAKADADNIRRRAAIDV 91

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
             A+ +++ KFA ++L V DN+ R L                 L  LIEGIE+T + + +
Sbjct: 92  DKAKKFALEKFANELLPVIDNMERGLLHVDKS--------NETLLPLIEGIELTAKSLEA 143

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
            LE++GVK ++ + +KFNP +HQAM       V  NT+I V+Q GY +N R++RPA+V I
Sbjct: 144 ALEKFGVKSVNPEGEKFNPELHQAMSMIESTDVEPNTVISVMQKGYELNGRLIRPAMVMI 203

Query: 186 SKGKTQNPTEEKK 198
           SK  T    + + 
Sbjct: 204 SKAATTPTIDTQA 216


>gi|138896078|ref|YP_001126531.1| heat shock protein GrpE [Geobacillus thermodenitrificans NG80-2]
 gi|196248972|ref|ZP_03147672.1| GrpE protein [Geobacillus sp. G11MC16]
 gi|166215266|sp|A4IR32|GRPE_GEOTN RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|134267591|gb|ABO67786.1| Heat-shock protein GrpE [Geobacillus thermodenitrificans NG80-2]
 gi|196211848|gb|EDY06607.1| GrpE protein [Geobacillus sp. G11MC16]
          Length = 220

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 53/183 (28%), Positives = 86/183 (46%), Gaps = 9/183 (4%)

Query: 4   FMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDR 63
              E            +    E         E   +  E   +YLR+ A+ EN RRR  +
Sbjct: 46  ENPEAASTTADPAEQTSVEAEELAKAKAQVAELEEKLAEMEKRYLRLYADFENFRRRARQ 105

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           E + A+ Y     A D+L V DN  RAL                  KS+++G+EM  R +
Sbjct: 106 EMEAAEKYRAQSLASDLLPVLDNFERALKIETE---------NEQAKSILQGVEMVYRSL 156

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
           +  L + GV+ I+A  + F+P++HQA+ +        NT+++ +Q GY + +R+LRPA+V
Sbjct: 157 LDALRKEGVEVIEAVGKPFDPHLHQAVMQTDEGGYEPNTVVEELQKGYKLKDRILRPAMV 216

Query: 184 SIS 186
            +S
Sbjct: 217 KVS 219


>gi|225713032|gb|ACO12362.1| GrpE protein homolog, mitochondrial precursor [Lepeophtheirus
           salmonis]
          Length = 201

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 54/180 (30%), Positives = 96/180 (53%), Gaps = 11/180 (6%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
              +       + + E        EE   ++ +  DKY R IAE EN+R+R  ++  DA+
Sbjct: 32  NTSDSKDVEEATESPEIFKLREEIEELRGKNVDLLDKYRRSIAENENMRQRLTKQINDAK 91

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
            + I  F +D+L VSD LS+A+++ P D +          K + +GI++T  +++    R
Sbjct: 92  IFGIQSFCKDLLDVSDVLSKAVETLPEDAS----------KDIRDGIKLTESQLLQVFTR 141

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHD-TVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           +G+ K +  ++KF+PN H+A F+ P    V  N ++ V + G+ +  R +RPA+V +SK 
Sbjct: 142 HGLVKENPLNEKFDPNKHEAAFQIPAPKGVEDNIVLDVQKVGFILQGRTIRPAVVGVSKK 201


>gi|225713010|gb|ACO12351.1| GrpE protein homolog, mitochondrial precursor [Lepeophtheirus
           salmonis]
 gi|290562709|gb|ADD38750.1| GrpE protein homolog, mitochondrial [Lepeophtheirus salmonis]
          Length = 201

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 54/180 (30%), Positives = 96/180 (53%), Gaps = 11/180 (6%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
              +       + + E        EE   ++ +  DKY R IAE EN+R+R  ++  DA+
Sbjct: 32  NTSDSKDVEEATESPEIFKLREEIEELRGKNVDLLDKYRRSIAENENMRQRLTKQINDAK 91

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
            + I  F +D+L VSD LS+A+++ P D +          K + +GI++T  +++    R
Sbjct: 92  IFGIQSFCKDLLDVSDVLSKAVETLPEDAS----------KDIRDGIKLTESQLLQVFTR 141

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHD-TVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           +G+ K +  ++KF+PN H+A F+ P    V  N ++ V + G+ +  R +RPA+V +SK 
Sbjct: 142 HGLVKENPLNEKFDPNKHEAAFQIPAPKGVEDNIVLDVQKVGFILQGRTIRPAVVGVSKK 201


>gi|282850171|ref|ZP_06259550.1| co-chaperone GrpE [Veillonella parvula ATCC 17745]
 gi|282579664|gb|EFB85068.1| co-chaperone GrpE [Veillonella parvula ATCC 17745]
          Length = 181

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 49/168 (29%), Positives = 88/168 (52%), Gaps = 10/168 (5%)

Query: 18  NANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFA 77
              +    E++  +  +       +F ++Y R+ A+ EN +RRT++EK+    Y      
Sbjct: 22  EEPTVEKTEEAVADAAQVLEELKADFDNRYKRLQADFENFKRRTNQEKEQLAGYVKGDVL 81

Query: 78  RDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDA 137
            D+L V DN  RA+ S           +E  +K  ++G  M  + +M+ L ++G+  I+A
Sbjct: 82  TDLLPVLDNFERAVQS----------PAEGEVKVFLDGFIMIHQNLMAMLSKHGLAVIEA 131

Query: 138 KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
             Q F+PN HQA+   P D   ++T+ +V+Q GY ++ R +RPA+V +
Sbjct: 132 VGQPFDPNFHQAIMRVPSDEYESDTVCEVLQTGYTVDGRCIRPAMVKV 179


>gi|121715940|ref|XP_001275579.1| mitochondrial co-chaperone GrpE, putative [Aspergillus clavatus
           NRRL 1]
 gi|119403736|gb|EAW14153.1| mitochondrial co-chaperone GrpE, putative [Aspergillus clavatus
           NRRL 1]
          Length = 250

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 54/194 (27%), Positives = 103/194 (53%), Gaps = 8/194 (4%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
           T    +     +   N  +  + E++     E+   +  + +DKY+R +A+  NL+ RT 
Sbjct: 56  TENKSEGAPNSEAKENEAAEDSAEEALRKELEKKQKEIVDLKDKYVRSVADFLNLQERTK 115

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSE-KKSESVLKSLIEGIEMTRR 121
           R+ ++A++++I +FA D+L   DN  RAL + P +  ++   +    +  L++G++MT+ 
Sbjct: 116 RDMENARNFAIQRFAIDLLESIDNFDRALLAVPREKLDATLTEHNKDMLDLVDGLKMTQN 175

Query: 122 EMMSTLERYGVKKIDAKD-------QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAIN 174
            +M+TL+++G+++ D  +       QKF+PN H+A F    +      II     G+ +N
Sbjct: 176 ILMNTLQKHGLERFDPSEPAEDGKPQKFDPNYHEATFMTKAEGKEDGEIIHTQTKGFKLN 235

Query: 175 ERVLRPALVSISKG 188
            RVLR A V + K 
Sbjct: 236 GRVLRAAKVGVVKN 249


>gi|117929323|ref|YP_873874.1| GrpE protein [Acidothermus cellulolyticus 11B]
 gi|117649786|gb|ABK53888.1| GrpE protein [Acidothermus cellulolyticus 11B]
          Length = 267

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 39/177 (22%), Positives = 70/177 (39%), Gaps = 16/177 (9%)

Query: 19  ANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFAR 78
            +   AE        E+  N   E      RV AE  N R+R +R++   +  ++A    
Sbjct: 65  PSPDDAERAKLAAEVEQLRNLVAERTADLQRVQAEYANYRKRVERDRALVRDLAVADTLA 124

Query: 79  DMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
            +L V D++ RA     L+                 G +       + + + G+      
Sbjct: 125 LLLPVLDDIGRARAHGELEG----------------GFKQVAESFEAIVTKLGLVAFGDV 168

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTE 195
            + F+P  H+A+     D V   T+++V   GY    R++RPA VS+++     P +
Sbjct: 169 GEPFDPTRHEALMHAYSDEVTQPTVVEVFAPGYTYAGRIIRPARVSVAEPTVALPDD 225


>gi|124024728|ref|YP_001013844.1| heat shock protein GrpE [Prochlorococcus marinus str. NATL1A]
 gi|166215276|sp|A2BZB9|GRPE_PROM1 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|123959796|gb|ABM74579.1| Heat shock protein GrpE [Prochlorococcus marinus str. NATL1A]
          Length = 259

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 48/214 (22%), Positives = 95/214 (44%), Gaps = 9/214 (4%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
           ++     ++  S +  S  +        ++   + E    +Y+R+ A+ +N R+R  R++
Sbjct: 53  NDSVDTAKEQSSTSCESNIKGSDTEARLQQLEKEHETLNSQYMRIAADFDNFRKRQTRDQ 112

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
            D +         ++L + DN  RA      +            ++L    +   ++++ 
Sbjct: 113 DDLKIQLTCTTLSEILPIVDNFERARQQLNPEG--------EEAQALHRSYQGLYKQLVE 164

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
            L+  GV  +   DQ F+P++H+A+  EP D    + +I+ +Q GY +N RVLR ALV +
Sbjct: 165 VLKNLGVAPMRVVDQAFDPSLHEAVMREPSDEKAEDIVIEELQRGYHLNGRVLRHALVKV 224

Query: 186 SKGKTQNPTEEKKETIEQPSPLDIEERNKTQTKN 219
           S G       E+    +  S  ++ E     TK+
Sbjct: 225 SMGPGPKAVNEEI-PDQSASNQELSESVDGPTKD 257


>gi|301026814|ref|ZP_07190216.1| co-chaperone GrpE [Escherichia coli MS 196-1]
 gi|299879560|gb|EFI87771.1| co-chaperone GrpE [Escherichia coli MS 196-1]
 gi|327252318|gb|EGE63990.1| protein grpE [Escherichia coli STEC_7v]
 gi|332754038|gb|EGJ84410.1| protein grpE [Shigella flexneri K-671]
          Length = 179

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 56/187 (29%), Positives = 98/187 (52%), Gaps = 9/187 (4%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR-DKYLRVIAEMENLRRRTDR 63
           M +    +   P  +         +I   E  L +++    D  LRV AEMENLRRRT+ 
Sbjct: 1   MDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLRRRTEL 60

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           + + A  +++ KF  ++L V D+L RAL+ A              + +++EGIE+T + M
Sbjct: 61  DIEKAHKFALEKFINELLPVIDSLDRALEVADKA--------NPDMSAMVEGIELTLKSM 112

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
           +  + ++GV+ I   +   +PN+HQA+     D V    ++ ++Q GY +N R +R A+V
Sbjct: 113 LDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMV 172

Query: 184 SISKGKT 190
           +++K K 
Sbjct: 173 TVAKAKA 179


>gi|271499343|ref|YP_003332368.1| GrpE protein [Dickeya dadantii Ech586]
 gi|270342898|gb|ACZ75663.1| GrpE protein [Dickeya dadantii Ech586]
          Length = 195

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 61/193 (31%), Positives = 100/193 (51%), Gaps = 12/193 (6%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDK----YLRVIAEMENL 57
           E  + +K   + +       +T       +   E   Q  E + +     LR  AEMEN+
Sbjct: 11  EQVLDQKEAAQGQQADAVPETTDVADPREDRIAELEAQLSELQQRERENALRARAEMENV 70

Query: 58  RRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIE 117
           RRR + + + A  +++ KFA +ML V DNL RAL+ A              L  +IEG+E
Sbjct: 71  RRRAELDVEKAHKFALEKFAGEMLPVIDNLERALEMADKS--------NEALSGMIEGVE 122

Query: 118 MTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERV 177
           +T + M+S + ++G++ +   +  FNP++HQAM          N ++ V+Q GY +N R+
Sbjct: 123 LTLKAMLSAVSKFGIEVVAEVNVPFNPDVHQAMTLLESAEHEPNHVMMVMQKGYTLNGRL 182

Query: 178 LRPALVSISKGKT 190
           LRPA+V++SK K 
Sbjct: 183 LRPAMVAVSKAKE 195


>gi|86136766|ref|ZP_01055344.1| co-chaperone GrpE [Roseobacter sp. MED193]
 gi|85826090|gb|EAQ46287.1| co-chaperone GrpE [Roseobacter sp. MED193]
          Length = 186

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 55/160 (34%), Positives = 97/160 (60%), Gaps = 8/160 (5%)

Query: 32  IPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRAL 91
             +E   + +E++D+++R +A+ EN R+R D+ +++A+ Y  +K +RD+L V DNL RA+
Sbjct: 34  ELDELRAERDEYKDRFMRALADAENSRKRGDKARREAEQYGGSKLSRDILPVFDNLKRAV 93

Query: 92  DSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK-KIDAKDQKFNPNMHQAM 150
           +SA  +          V  +LIEG+E+T R ++   E++GV+        +F+P +H+AM
Sbjct: 94  ESATEEQK-------EVSAALIEGVELTMRALLGVFEKHGVRIVSPQVGDRFDPQVHEAM 146

Query: 151 FEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           FE P     A  II+V  +G+ +++R+LRPA V +S    
Sbjct: 147 FEAPVPGTKAGDIIQVSAEGFMLHDRLLRPAQVGVSSTPA 186


>gi|91781882|ref|YP_557088.1| putative heat shock protein [Burkholderia xenovorans LB400]
 gi|296161784|ref|ZP_06844586.1| GrpE protein [Burkholderia sp. Ch1-1]
 gi|123168993|sp|Q145F3|GRPE_BURXL RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|91685836|gb|ABE29036.1| Putative heat shock protein [Burkholderia xenovorans LB400]
 gi|295887948|gb|EFG67764.1| GrpE protein [Burkholderia sp. Ch1-1]
          Length = 194

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 51/151 (33%), Positives = 83/151 (54%), Gaps = 12/151 (7%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           +  E ++ +LR  AE EN+RRR   +   A  ++I  FA  +L V D+L  A+  +  D 
Sbjct: 56  KIAELQESFLRAKAETENVRRRAQEDVAKAHKFAIESFAEHLLPVIDSLEAAVAHSSDDP 115

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
           A            + EG+E+T R++   LE+  V  ++   +KF+P+ HQA+   P    
Sbjct: 116 A-----------KVREGVELTLRQLTGALEKGRVVALNPVGEKFDPHRHQAISMVP-ADQ 163

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISKGK 189
             NT++ V+Q G+ I +RVLRPALV+++  K
Sbjct: 164 EPNTVVAVLQKGFVIADRVLRPALVTVAAPK 194


>gi|89900755|ref|YP_523226.1| GrpE protein [Rhodoferax ferrireducens T118]
 gi|123397223|sp|Q21X08|GRPE_RHOFD RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|89345492|gb|ABD69695.1| GrpE protein [Rhodoferax ferrireducens T118]
          Length = 187

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 65/199 (32%), Positives = 100/199 (50%), Gaps = 26/199 (13%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEI------------NIPEESLNQSEEFRDKYLRVIA 52
           MSE N ++ K P+    ST E  +                  E   +S E  D+YLR  A
Sbjct: 1   MSETNPNQTKPPATGYQSTEEMVAAQGAYESDALSRAQADLAELQAKSAELADQYLRAKA 60

Query: 53  EMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSL 112
           E +N RRR + E   A+ +++  FA  +L V+D+L   L              ++ +  L
Sbjct: 61  EADNARRRAEDEISKARKFAVEAFAESLLPVADSLEAGL-----------IIKDATIDHL 109

Query: 113 IEGIEMTRREMMSTLERYGVKKIDAKD--QKFNPNMHQAMFEEPHDTVPANTIIKVVQDG 170
            EG + T R++++ LER  V  I+ +    KF+P+ HQA+   P     AN ++ V+Q G
Sbjct: 110 REGTQATLRQLLAALERNKVIPINPQPGTTKFDPHQHQAISVVP-SEFDANIVVTVLQKG 168

Query: 171 YAINERVLRPALVSISKGK 189
           YAI +RVLRPALV+++  K
Sbjct: 169 YAIADRVLRPALVTVAAPK 187


>gi|315180932|gb|ADT87846.1| heat shock protein GrpE [Vibrio furnissii NCTC 11218]
          Length = 200

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 56/186 (30%), Positives = 107/186 (57%), Gaps = 8/186 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   ++ +ID  +     +   A+          S  + +E +D  LR  A++EN+RRR+
Sbjct: 23  EAVGTDADIDWNQGADELDEKEAKIAQLEAALLTSEERVKEQQDAVLRARADVENMRRRS 82

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           ++E   A+ Y++++F  ++L V DN+ RA+ +A  +          V+K ++EG+E+T +
Sbjct: 83  EQEIDKARKYALSRFIEELLPVLDNMERAIQAADGE--------NEVVKPILEGVELTHK 134

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
             +  + ++G+K+I+ + + FNP  HQAM  +      +NT++ V+Q GY +N RV+RPA
Sbjct: 135 TFVDAVAKFGLKEINPEGEAFNPEFHQAMSIQESPDHASNTVMFVMQKGYELNGRVVRPA 194

Query: 182 LVSISK 187
           +V ++K
Sbjct: 195 MVMVAK 200


>gi|21732881|emb|CAD38619.1| hypothetical protein [Homo sapiens]
          Length = 232

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 42/174 (24%), Positives = 88/174 (50%), Gaps = 3/174 (1%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
           ++P +       E++      +   + ++   +Y R IA+ EN+RRRT R  +DA+ + I
Sbjct: 54  EDPPDELGPPLAERALRVKAVKLEKEVQDLTVRYQRAIADCENIRRRTQRCVEDAKIFGI 113

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
             F +D++ V+D L +  +    +    ++K    L+ +  G+ +   ++ S   ++G++
Sbjct: 114 QSFCKDLVEVADILEKTTECISEESEPEDQKLT--LEKVFRGLLLLEAKLKSVFAKHGLE 171

Query: 134 KIDAKDQKFNPNMHQAMFEEPHD-TVPANTIIKVVQDGYAINERVLRPALVSIS 186
           K+     K++P+ H+ +   P    V   T+  V QDGY ++ R +R A V ++
Sbjct: 172 KLTPIGDKYDPHEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVA 225


>gi|315298668|gb|EFU57922.1| co-chaperone GrpE [Escherichia coli MS 16-3]
          Length = 197

 Score =  111 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 57/190 (30%), Positives = 99/190 (52%), Gaps = 9/190 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR-DKYLRVIAEMENLRRR 60
           E  M +    +   P  +         +I   E  L +++    D  LRV AEMENLRRR
Sbjct: 16  EIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLRRR 75

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+ + + A  +++ KF  ++L V D+L RAL+ A              + +++EGIE+T 
Sbjct: 76  TELDIEKAHKFALEKFINELLPVIDSLDRALEVADKA--------NPDISAMVEGIELTL 127

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + M+  + ++GV+ I   +   +PN+HQA+     D V    ++ ++Q GY +N R +R 
Sbjct: 128 KSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRA 187

Query: 181 ALVSISKGKT 190
           A+V+++K K 
Sbjct: 188 AMVTVAKAKA 197


>gi|71018819|ref|XP_759640.1| hypothetical protein UM03493.1 [Ustilago maydis 521]
 gi|46099398|gb|EAK84631.1| hypothetical protein UM03493.1 [Ustilago maydis 521]
          Length = 255

 Score =  111 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 47/192 (24%), Positives = 89/192 (46%), Gaps = 8/192 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAE---EKSEINIPEESLNQSEEFRDKYLRVIAEMENLR 58
           E    ++     +     +   A     ++     +E   + +E ++  L   A+ +NL+
Sbjct: 59  EKKKQDETKASGEAMGATDKDAAAGAGSEALQAQIKEKDAKIKELQEAILYGKADYQNLQ 118

Query: 59  RRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLD-----LANSEKKSESVLKSLI 113
           RR+  EK  A  ++I K A+D+ S  D L  AL S P +          K    V+  L 
Sbjct: 119 RRSKDEKAQAGDFAITKLAKDLTSSIDILGLALKSVPEELRTAPKDLDLKDPRRVVADLY 178

Query: 114 EGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAI 173
            G+++T + ++  L  +G+ + D    KF+P  H+A+++ P       T+++  + GY I
Sbjct: 179 SGVDLTSKSLLDMLRTHGIVQFDPTGDKFDPKEHEALYQAPVPGKEPGTVLECSKVGYKI 238

Query: 174 NERVLRPALVSI 185
            +R+LR A V +
Sbjct: 239 KDRLLRAAEVGV 250


>gi|282854819|ref|ZP_06264153.1| co-chaperone GrpE [Propionibacterium acnes J139]
 gi|282581965|gb|EFB87348.1| co-chaperone GrpE [Propionibacterium acnes J139]
 gi|314981743|gb|EFT25836.1| co-chaperone GrpE [Propionibacterium acnes HL110PA3]
 gi|315092508|gb|EFT64484.1| co-chaperone GrpE [Propionibacterium acnes HL110PA4]
          Length = 221

 Score =  111 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 45/210 (21%), Positives = 92/210 (43%), Gaps = 19/210 (9%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           ++D + +    +S   EE S  +  E  L +  E      R+ AE  N +RR DR++  +
Sbjct: 31  DVDIDADQLATDSPAPEELSRESQLEALLAERTE---DLQRLQAEYVNYKRRVDRDRALS 87

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
           +   + K   D++ V D+++ A     ++                 G ++   E+     
Sbjct: 88  RQSGVDKVITDLMPVLDSIAMARQHGEVEG----------------GFKLVVDELEKVAN 131

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
            +G+         F+PN+H+A+ + P + V   ++ +V+Q GY + +RVLRPA V++S  
Sbjct: 132 NHGLTSFGEVGDVFDPNLHEALMQMPMEGVSVTSVSQVMQPGYKLGDRVLRPARVAVSDP 191

Query: 189 KTQNPTEEKKETIEQPSPLDIEERNKTQTK 218
                + ++    +  S    E+    + +
Sbjct: 192 DPNATSADESSQADGESAQANEDDETPRNE 221


>gi|218886293|ref|YP_002435614.1| GrpE protein [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218757247|gb|ACL08146.1| GrpE protein [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 201

 Score =  111 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 46/149 (30%), Positives = 84/149 (56%), Gaps = 9/149 (6%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           +  +  ++ LR +AEM+N ++R  REK D   Y+      D+L   DNL  AL       
Sbjct: 60  ERADADEQRLRALAEMDNFKKRLQREKDDQVRYAAEVVLADLLPTLDNLDLALQYG---- 115

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
                +  +  K ++ G+EMT++ ++  L+R+G++ +    + F+P +H+A+  E    +
Sbjct: 116 -----RGNAACKDMLIGVEMTQKLLLDALKRHGLEPVGEAGEPFSPEIHEAIGAEVRPDL 170

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISK 187
           P NT+  ++Q GY + ER+LRPA V++S+
Sbjct: 171 PENTVCALMQRGYRLKERLLRPAKVTVSR 199


>gi|62128886|gb|AAX66589.1| molecular chaparone; heat shock protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
          Length = 260

 Score =  111 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 57/189 (30%), Positives = 104/189 (55%), Gaps = 9/189 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR-DKYLRVIAEMENLRRR 60
           E  M +    +   P+++         +I   E  L +++    D  LR+ AEMENLRRR
Sbjct: 80  EIIMDQHEEVEAVEPNDSAEQVDPRDEKIANLEVQLAEAQTRERDTVLRIKAEMENLRRR 139

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+++ + A  +++ KF  ++L V D+L RAL+ A              + +++EGIE+T 
Sbjct: 140 TEQDIEKAHKFALEKFVNELLPVIDSLDRALEVADKA--------NPDMAAMVEGIELTL 191

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + M+  + ++GV+ I   +   +PN+HQA+     + VPA  ++ ++Q GY +N R +R 
Sbjct: 192 KSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESEEVPAGNVLGIMQKGYTLNGRTIRA 251

Query: 181 ALVSISKGK 189
           A+V+++K K
Sbjct: 252 AMVTVAKAK 260


>gi|167580686|ref|ZP_02373560.1| co-chaperone GrpE [Burkholderia thailandensis TXDOH]
          Length = 178

 Score =  111 bits (277), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 57/190 (30%), Positives = 97/190 (51%), Gaps = 13/190 (6%)

Query: 1   METFMSE-KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRR 59
           ME       +   E+    A ++     +      E+  +  E ++ +LR  AE EN+RR
Sbjct: 1   MENTQENPTDQTTEETGREAQAAENAAPAAEAALAEAQAKIAELQESFLRAKAETENVRR 60

Query: 60  RTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMT 119
           R   +   A  ++I  FA ++L V D+L  A+             +   L  + EG+E+T
Sbjct: 61  RAQDDVAKAHKFAIENFAENLLPVLDSLEAAV-----------GDTSGDLAKVREGVELT 109

Query: 120 RREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
            R++ S LE+  V  ++   +KF+P++HQA+   P      NT++ V+Q GY I +RVLR
Sbjct: 110 LRQLTSALEKGRVAALNPVGEKFDPHLHQAISMVP-ADQEPNTVVAVLQKGYTIADRVLR 168

Query: 180 PALVSISKGK 189
           PALV++++ K
Sbjct: 169 PALVTVAQPK 178


>gi|62184880|ref|YP_219665.1| GrpE protein(hsp-70 cofactor) [Chlamydophila abortus S26/3]
 gi|68846315|sp|Q8GH80|GRPE_CHLAB RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|62147947|emb|CAH63694.1| GrpE protein(hsp-70 cofactor) [Chlamydophila abortus S26/3]
          Length = 191

 Score =  111 bits (277), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 51/199 (25%), Positives = 88/199 (44%), Gaps = 8/199 (4%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           M++ +   E       +   E +           + +E  DKYL V+AE EN R+R  +E
Sbjct: 1   MTDSSNAHEAENPTVPTPDNEIQDLQQEIATLKAELKEKNDKYLMVLAESENARKRMQKE 60

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
           +++   Y++     D L   +++ +AL  A         +    +K+   G  M  ++  
Sbjct: 61  RQEMMQYAVENALIDFLVPIESMEKALGFAS--------QMSDEVKNWALGFNMILQQFK 112

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
              E  G+ +  +  QKFNP +H+A+  E    VP  TI++    GY I +R +R A V 
Sbjct: 113 QVFEEKGIVEYSSVGQKFNPFLHEAVETEETTKVPEGTIVEEFSKGYKIGDRPIRVAKVK 172

Query: 185 ISKGKTQNPTEEKKETIEQ 203
           +SK      TE + E   +
Sbjct: 173 VSKAPAPQGTEAEIENNNE 191


>gi|157824222|ref|NP_001102983.1| grpE protein homolog 2, mitochondrial [Rattus norvegicus]
 gi|149064415|gb|EDM14618.1| rCG46866, isoform CRA_a [Rattus norvegicus]
          Length = 224

 Score =  111 bits (277), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 41/174 (23%), Positives = 88/174 (50%), Gaps = 3/174 (1%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
           ++P +    +  E++      +   + ++   +Y R +A+ EN+RRRT R  +DA+ + I
Sbjct: 46  EDPPDGLGPSLAEQALRLKAVKLEKEVQDLTLRYQRAVADCENIRRRTQRCVEDAKIFGI 105

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
             F +D++ V+D L +  +         + K    L+ + +G+ +   ++ S   ++G++
Sbjct: 106 QSFCKDLVEVADILEKTAECFSDGAEPQDHKLT--LEKVFQGLSLLEAKLKSVFTKHGLE 163

Query: 134 KIDAKDQKFNPNMHQAMFEEPHD-TVPANTIIKVVQDGYAINERVLRPALVSIS 186
           K+     K++P+ H+ +   P    V   T+  V QDGY ++ R +R A V ++
Sbjct: 164 KMAPIGDKYDPHEHELICHMPAGVGVQPGTVALVRQDGYKLHGRTIRLAQVEVA 217


>gi|329942563|ref|ZP_08291373.1| grpE family protein [Chlamydophila psittaci Cal10]
 gi|332287194|ref|YP_004422095.1| heat shock protein grpE [Chlamydophila psittaci 6BC]
 gi|313847790|emb|CBY16780.1| GrpE protein(hsp-70 cofactor) [Chlamydophila psittaci RD1]
 gi|325507022|gb|ADZ18660.1| heat shock protein grpE [Chlamydophila psittaci 6BC]
 gi|328815473|gb|EGF85461.1| grpE family protein [Chlamydophila psittaci Cal10]
 gi|328914442|gb|AEB55275.1| co-chaperone GrpE [Chlamydophila psittaci 6BC]
          Length = 191

 Score =  111 bits (277), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 48/188 (25%), Positives = 85/188 (45%), Gaps = 8/188 (4%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           M++ + + E   S   +   E +           + +E  DKYL V+AE EN R+R  +E
Sbjct: 1   MTDSSNEHEAENSTVPTPDNEIQDLQQEIATLKAELKEKNDKYLMVLAESENARKRMQKE 60

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
           +++   Y++     D L   +++ +AL  A         +    +K+   G  M  ++  
Sbjct: 61  RQEMMQYAVENALIDFLVPIESMEKALGFAS--------QMSDEVKNWALGFNMILQQFK 112

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
              E  G+ +  +  QKFNP +H+A+  E     P  T+++    GY I +R +R A V 
Sbjct: 113 QVFEEKGIVEYSSVGQKFNPFLHEAVETEETTKFPEGTVVEEFSKGYKIGDRPIRVAKVK 172

Query: 185 ISKGKTQN 192
           +SK  T  
Sbjct: 173 VSKAPTPQ 180


>gi|302864663|ref|YP_003833300.1| GrpE protein [Micromonospora aurantiaca ATCC 27029]
 gi|302567522|gb|ADL43724.1| GrpE protein [Micromonospora aurantiaca ATCC 27029]
          Length = 245

 Score =  111 bits (277), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 40/175 (22%), Positives = 71/175 (40%), Gaps = 16/175 (9%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
            +P+  N  T  +       E      EE      RV AE  N R+R DR++   Q  + 
Sbjct: 86  DSPAEPNGGTGPDAPLGAELESLRTDLEERTRDLQRVTAEYANYRKRVDRDRNLVQEQAT 145

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
                 +L + D+L RA +                   L+        ++   L ++G+ 
Sbjct: 146 GAVLTALLPILDDLDRAREHGD----------------LVGPFGSVAEQLTGALAKFGLT 189

Query: 134 KIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
                   F+P  H+A+  +    V   T ++V++ GY + ER+LRPA+V+++  
Sbjct: 190 AFGETGDPFDPTRHEAVAHQTSADVTEPTCVQVMRRGYQLGERLLRPAMVAVADP 244


>gi|223646752|gb|ACN10134.1| GrpE protein homolog 1, mitochondrial precursor [Salmo salar]
 gi|223672607|gb|ACN12485.1| GrpE protein homolog 1, mitochondrial precursor [Salmo salar]
          Length = 208

 Score =  111 bits (277), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 52/177 (29%), Positives = 98/177 (55%), Gaps = 3/177 (1%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
               +   S  ++ +E +  E+ L + +   ++ L+ + + ENLR R+ +  +D + Y I
Sbjct: 34  AQQKSGQGSEEDQNAEQSAAEKVLAEEKGQLEEQLKEVTDTENLRTRSQKMVEDTKLYGI 93

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
             F +D+L V+D L +A +S P +  +S+K     LK+L +G+ MT +++     ++G+ 
Sbjct: 94  QGFCKDLLEVADILEKATESVPSEEVSSQK--NPHLKNLYDGLVMTDKQIQKVFTKHGLV 151

Query: 134 KIDAKD-QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
           K++    QKF+P  H+A+F  P +     T+  V + GY ++ R LRPALV ++K  
Sbjct: 152 KLNPDGGQKFDPYEHEALFHSPVEGKEPGTVAIVTKVGYKLHGRTLRPALVGVAKAP 208


>gi|161525804|ref|YP_001580816.1| heat shock protein GrpE [Burkholderia multivorans ATCC 17616]
 gi|189349475|ref|YP_001945103.1| heat shock protein GrpE [Burkholderia multivorans ATCC 17616]
 gi|221200977|ref|ZP_03574017.1| co-chaperone GrpE [Burkholderia multivorans CGD2M]
 gi|221206571|ref|ZP_03579584.1| co-chaperone GrpE [Burkholderia multivorans CGD2]
 gi|221214428|ref|ZP_03587399.1| co-chaperone GrpE [Burkholderia multivorans CGD1]
 gi|226737115|sp|A9AGC0|GRPE_BURM1 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|56798250|dbj|BAD82892.1| GrpE [Burkholderia multivorans]
 gi|160343233|gb|ABX16319.1| GrpE protein [Burkholderia multivorans ATCC 17616]
 gi|189333497|dbj|BAG42567.1| molecular chaperone [Burkholderia multivorans ATCC 17616]
 gi|221165685|gb|EED98160.1| co-chaperone GrpE [Burkholderia multivorans CGD1]
 gi|221173880|gb|EEE06314.1| co-chaperone GrpE [Burkholderia multivorans CGD2]
 gi|221178827|gb|EEE11234.1| co-chaperone GrpE [Burkholderia multivorans CGD2M]
          Length = 181

 Score =  111 bits (277), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 57/188 (30%), Positives = 94/188 (50%), Gaps = 12/188 (6%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   S+   +       A  +    ++      E+  +  E ++ YLR  AE EN+RRR 
Sbjct: 6   ENPASQSAEENGSETQAAQDAAPAAEAADAALAEAQAKVAELQESYLRAKAETENVRRRA 65

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
             +   A  ++I  FA  +L V D+L  A+             +   +  + EG+E+T R
Sbjct: 66  QEDVAKAHKFAIESFAEHLLPVLDSLEAAV-----------GDTSGDIAKVREGVELTLR 114

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           ++ S LE+  V  I+   +KF+P+ HQA+   P      NT++ V+Q GY I +RVLRPA
Sbjct: 115 QLTSALEKGRVVAINPVGEKFDPHRHQAISMVP-ADQEPNTVVTVLQKGYTIADRVLRPA 173

Query: 182 LVSISKGK 189
           LV++++ K
Sbjct: 174 LVTVAQPK 181


>gi|260771332|ref|ZP_05880258.1| heat shock protein GrpE [Vibrio furnissii CIP 102972]
 gi|260613648|gb|EEX38841.1| heat shock protein GrpE [Vibrio furnissii CIP 102972]
          Length = 200

 Score =  111 bits (277), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 56/186 (30%), Positives = 107/186 (57%), Gaps = 8/186 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   ++ +ID  +     +   A+          S  + +E +D  LR  A++EN+RRR+
Sbjct: 23  EAVGTDADIDWNQGADELDEKEAKIAQLEAALLTSEERVKEQQDAVLRARADVENMRRRS 82

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           ++E   A+ Y++++F  ++L V DN+ RA+ +A  +          V+K ++EG+E+T +
Sbjct: 83  EQEVDKARKYALSRFIEELLPVLDNMERAIQAADGE--------NEVVKPILEGVELTHK 134

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
             +  + ++G+K+I+ + + FNP  HQAM  +      +NT++ V+Q GY +N RV+RPA
Sbjct: 135 TFVDAVAKFGLKEINPEGEAFNPEFHQAMSIQESPDHASNTVMFVMQKGYELNGRVVRPA 194

Query: 182 LVSISK 187
           +V ++K
Sbjct: 195 MVMVAK 200


>gi|293412003|ref|ZP_06654726.1| co-chaperone GrpE [Escherichia coli B354]
 gi|293415884|ref|ZP_06658524.1| co-chaperone GrpE [Escherichia coli B185]
 gi|331684269|ref|ZP_08384861.1| co-chaperone GrpE [Escherichia coli H299]
 gi|291432073|gb|EFF05055.1| co-chaperone GrpE [Escherichia coli B185]
 gi|291468774|gb|EFF11265.1| co-chaperone GrpE [Escherichia coli B354]
 gi|331077884|gb|EGI49090.1| co-chaperone GrpE [Escherichia coli H299]
          Length = 197

 Score =  111 bits (277), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 57/190 (30%), Positives = 99/190 (52%), Gaps = 9/190 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR-DKYLRVIAEMENLRRR 60
           E  M +    +   P  +         +I   E  L +++    D  LRV AEMENLRRR
Sbjct: 16  EIIMDQHEEIEAVEPDASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLRRR 75

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+ + + A  +++ KF  ++L V D+L RAL+ A              + +++EGIE+T 
Sbjct: 76  TELDIEKAHKFALEKFINELLPVIDSLDRALEVADKA--------NPDMSAMVEGIELTL 127

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + M+  + ++GV+ I   +   +PN+HQA+     D V    ++ ++Q GY +N R +R 
Sbjct: 128 KSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRA 187

Query: 181 ALVSISKGKT 190
           A+V+++K K 
Sbjct: 188 AMVTVAKAKA 197


>gi|251790872|ref|YP_003005593.1| heat shock protein GrpE [Dickeya zeae Ech1591]
 gi|247539493|gb|ACT08114.1| GrpE protein [Dickeya zeae Ech1591]
          Length = 195

 Score =  111 bits (277), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 60/193 (31%), Positives = 99/193 (51%), Gaps = 12/193 (6%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDK----YLRVIAEMENL 57
           E  + +K  ++ +       +T           E   Q  + + +     LR  AEMEN+
Sbjct: 11  EQVLDQKETEQGQQADAVPETTDVADPREERIAELEAQLNDLQQRERENALRARAEMENV 70

Query: 58  RRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIE 117
           RRR + + + A  +++ KFA +ML V DNL RAL+ A              L  +IEG+E
Sbjct: 71  RRRAELDVEKAHKFALEKFAGEMLPVIDNLERALEMADKS--------NETLSGMIEGVE 122

Query: 118 MTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERV 177
           +T + M+S + ++G++ +   +  FNP +HQAM          N ++ V+Q GY +N R+
Sbjct: 123 LTLKAMLSAVSKFGIEVVAEVNVPFNPEIHQAMTLIESADHEPNHVMMVMQKGYTLNGRL 182

Query: 178 LRPALVSISKGKT 190
           LRPA+V++SK K 
Sbjct: 183 LRPAMVAVSKAKE 195


>gi|209966221|ref|YP_002299136.1| co-chaperone GrpE, putative [Rhodospirillum centenum SW]
 gi|209959687|gb|ACJ00324.1| co-chaperone GrpE, putative [Rhodospirillum centenum SW]
          Length = 234

 Score =  111 bits (277), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 61/183 (33%), Positives = 105/183 (57%), Gaps = 4/183 (2%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +    +  P     + A E    +       + +  +D+ LR +AE EN+RRR +RE++D
Sbjct: 48  QTTPGQTAPGAGGRAAAGEAPADDRTASLEAEIQVLKDQLLRALAETENVRRRAERERED 107

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
              Y+IAKFA+D+L+V+DNL RA++S     A  +++    + SL+ G+E T R++ +  
Sbjct: 108 TAKYAIAKFAKDLLAVADNLRRAVESV----APDQRQGNEAVNSLLTGVEATERQLAAAF 163

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +R G++K++  D+ F+PN HQ M E         T++ V+Q GY +  R+LR A+V ++K
Sbjct: 164 DRAGIQKMEPLDRPFDPNFHQVMMEMEGTGKAPGTVVAVLQAGYTLQGRLLREAMVGVAK 223

Query: 188 GKT 190
           G  
Sbjct: 224 GGE 226


>gi|91762499|ref|ZP_01264464.1| GrpE protein (HSP-70 cofactor) [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|91718301|gb|EAS84951.1| GrpE protein (HSP-70 cofactor) [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 211

 Score =  111 bits (277), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 60/205 (29%), Positives = 98/205 (47%), Gaps = 3/205 (1%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E    E    + +  +      + +K+E         + +E  DK  R  AEMEN RRR 
Sbjct: 10  ENQNEEIKESEAEEQNQVEQEISADKTEEAKEVTPEEKIKELEDKLTRTFAEMENQRRRF 69

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           ++EK DA  Y    FA++ L++ DNL R+      D    +      LK  +E  E+  +
Sbjct: 70  EKEKDDAFDYGGFSFAKEALNLIDNLERSKQILESDEVLKD---TEALKKTLEHFEIISK 126

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           +M+S   + G+  + +  +K +PN HQAM E   D     TI++ +Q G+ + +R+LRPA
Sbjct: 127 DMVSIFSKNGITPVVSIGKKLDPNQHQAMMEIDDDQKEPGTIVQEIQKGFMMKDRLLRPA 186

Query: 182 LVSISKGKTQNPTEEKKETIEQPSP 206
           LV +SK       ++ +E  E    
Sbjct: 187 LVGVSKKTKTPDDQKSEENKENSDN 211


>gi|326793877|ref|YP_004311697.1| protein grpE [Marinomonas mediterranea MMB-1]
 gi|326544641|gb|ADZ89861.1| Protein grpE [Marinomonas mediterranea MMB-1]
          Length = 189

 Score =  111 bits (277), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 55/188 (29%), Positives = 104/188 (55%), Gaps = 9/188 (4%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           +E  +  + + +E            E  E +   ++  ++ ++++  LR  A+ +N+RRR
Sbjct: 10  LEDELQAEELQQEGAQVEELLEPEVEIVEDDELAKAKEEALQYKEAALRAQADAQNIRRR 69

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
            + + + A  +++ KFA+D++ V+DNL RAL S                 S+ EG+E+T 
Sbjct: 70  AELDVEKAHKFALEKFAKDIVKVADNLERALTSTEQTSDAD---------SVREGVELTL 120

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           ++++ TL R+ + ++D   + FNP +HQAM   P+  +  NT++ VVQ GY +N R++RP
Sbjct: 121 KDLIETLARFDIAQVDPHGEPFNPELHQAMTMVPNPEMEPNTVMDVVQKGYTLNGRLMRP 180

Query: 181 ALVSISKG 188
           A+V +S  
Sbjct: 181 AMVVVSSA 188


>gi|259907664|ref|YP_002648020.1| heat shock protein GrpE [Erwinia pyrifoliae Ep1/96]
 gi|224963286|emb|CAX54771.1| Heat shock protein [Erwinia pyrifoliae Ep1/96]
 gi|283477511|emb|CAY73427.1| Protein grpE (HSP-70 cofactor) [Erwinia pyrifoliae DSM 12163]
          Length = 194

 Score =  111 bits (277), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 57/189 (30%), Positives = 102/189 (53%), Gaps = 12/189 (6%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEE----FRDKYLRVIAEMENLRRRT 61
           S++   ++    +A ++            +   Q  E     RD  LR  AE+EN+RRR 
Sbjct: 14  SDEIEMEQAQNQDAETAAEVVDPRDERIAQLEVQLAESQNGVRDAQLRAQAEIENIRRRA 73

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           + + + A  +++ KF+ ++L V D+L RAL+ A              L ++IEGIE+T +
Sbjct: 74  ELDVEKAHKFALEKFSNELLPVIDSLERALEVADKS--------NPELAAMIEGIELTMK 125

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
            ++  + ++GV+ +   +  FNP +HQAM     + V  N ++ V+Q GY +N R+LRPA
Sbjct: 126 SLLGAVRKFGVEVVGDTNVPFNPELHQAMSMMESEEVEPNHVMMVMQRGYTLNGRLLRPA 185

Query: 182 LVSISKGKT 190
           +V+++K K+
Sbjct: 186 MVAVAKSKS 194


>gi|163745102|ref|ZP_02152462.1| GrpE protein HSP-70 cofactor, putative [Oceanibulbus indolifex
           HEL-45]
 gi|161381920|gb|EDQ06329.1| GrpE protein HSP-70 cofactor, putative [Oceanibulbus indolifex
           HEL-45]
          Length = 187

 Score =  111 bits (277), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 60/183 (32%), Positives = 105/183 (57%), Gaps = 8/183 (4%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           +              AE   E    EE   + +++RD+++R +A+ EN R+R+D+++++A
Sbjct: 11  DEIDSAEAEEYAEDMAEIDEEALAVEELRAERDQYRDRFMRALADAENARKRSDKDRREA 70

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
           ++Y  +K ARDML V DN+ RAL++   +           L  L+EGI++T RE++S  +
Sbjct: 71  ENYGGSKLARDMLPVYDNMKRALETTTDEQR-------EALGPLLEGIQLTMRELLSVFK 123

Query: 129 RYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           ++G++ I  +   KF+P  H+AMFE P     A  II+V  +G+ +++R+LRPA V +S 
Sbjct: 124 KHGIEVIAPEVGDKFDPKHHEAMFEAPVPGTVAGEIIQVAAEGFMLHDRLLRPAQVGVSS 183

Query: 188 GKT 190
              
Sbjct: 184 TPA 186


>gi|307129654|ref|YP_003881670.1| heat shock protein [Dickeya dadantii 3937]
 gi|306527183|gb|ADM97113.1| heat shock protein [Dickeya dadantii 3937]
          Length = 195

 Score =  111 bits (277), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 60/193 (31%), Positives = 98/193 (50%), Gaps = 12/193 (6%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDK----YLRVIAEMENL 57
           E  + +K   + +       +T           E   Q  + + +     LR  AEMEN+
Sbjct: 11  EQVLDQKGAAEGQQTDAVPETTDVADPRDERIAELEAQLNDAQQRERESALRARAEMENI 70

Query: 58  RRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIE 117
           RRR + + + A  +++ KFA +ML V DNL RAL+ A              L  +IEG+E
Sbjct: 71  RRRAELDVEKAHKFALEKFAGEMLPVIDNLERALEMADKS--------NEALSGMIEGVE 122

Query: 118 MTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERV 177
           +T + M+S + ++G++ +   +  FNP +HQAM          N ++ V+Q GY +N R+
Sbjct: 123 LTLKAMLSAVNKFGIEVVADVNVPFNPEIHQAMTLLESADHAPNHVMMVMQKGYTLNGRL 182

Query: 178 LRPALVSISKGKT 190
           LRPA+V++SK K 
Sbjct: 183 LRPAMVAVSKAKE 195


>gi|120609914|ref|YP_969592.1| heat shock protein GrpE [Acidovorax citrulli AAC00-1]
 gi|166215245|sp|A1TLI0|GRPE_ACIAC RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|120588378|gb|ABM31818.1| GrpE protein [Acidovorax citrulli AAC00-1]
          Length = 189

 Score =  111 bits (277), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 62/182 (34%), Positives = 93/182 (51%), Gaps = 13/182 (7%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
           +  +    + A  +  E     N   E   +S +  D++LR  AE EN RRR D E   A
Sbjct: 20  DSPEAVEATMAAHAADELGRLQNELAELKAKSADLADQFLRAKAEAENARRRADEEVSKA 79

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
           + + I  FA  +L V+D+L+ AL              ++ ++ L EG + T R++ S LE
Sbjct: 80  RKFGIESFAESLLPVADSLTAALAI-----------KDATIEQLREGTDATLRQLTSALE 128

Query: 129 RYGVKKIDA-KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           R  V  I     +KF+P+ HQA+   P      NTI+ V+Q GY I +RVLRPALV+++ 
Sbjct: 129 RNKVLAIQPGAGEKFDPHQHQAISMVP-AEQEPNTIVSVLQKGYVIADRVLRPALVTVAA 187

Query: 188 GK 189
            K
Sbjct: 188 PK 189


>gi|15640870|ref|NP_230501.1| heat shock protein GrpE [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121585724|ref|ZP_01675519.1| heat shock protein GrpE [Vibrio cholerae 2740-80]
 gi|147673276|ref|YP_001216335.1| heat shock protein GrpE [Vibrio cholerae O395]
 gi|227081030|ref|YP_002809581.1| heat shock protein GrpE [Vibrio cholerae M66-2]
 gi|254847991|ref|ZP_05237341.1| HSP-70 cofactor grpE [Vibrio cholerae MO10]
 gi|255744654|ref|ZP_05418605.1| heat shock protein GrpE [Vibrio cholera CIRS 101]
 gi|262161215|ref|ZP_06030326.1| heat shock protein GrpE [Vibrio cholerae INDRE 91/1]
 gi|262168719|ref|ZP_06036414.1| heat shock protein GrpE [Vibrio cholerae RC27]
 gi|298499017|ref|ZP_07008824.1| co-chaperone GrpE [Vibrio cholerae MAK 757]
 gi|12644057|sp|O30862|GRPE_VIBCH RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|172047432|sp|A5F369|GRPE_VIBC3 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|254799622|sp|C3LTA4|GRPE_VIBCM RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|9655306|gb|AAF94016.1| heat shock protein GrpE [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121550087|gb|EAX60103.1| heat shock protein GrpE [Vibrio cholerae 2740-80]
 gi|146315159|gb|ABQ19698.1| heat shock protein GrpE [Vibrio cholerae O395]
 gi|227008918|gb|ACP05130.1| heat shock protein GrpE [Vibrio cholerae M66-2]
 gi|227012674|gb|ACP08884.1| heat shock protein GrpE [Vibrio cholerae O395]
 gi|254843696|gb|EET22110.1| HSP-70 cofactor grpE [Vibrio cholerae MO10]
 gi|255737685|gb|EET93079.1| heat shock protein GrpE [Vibrio cholera CIRS 101]
 gi|262022837|gb|EEY41543.1| heat shock protein GrpE [Vibrio cholerae RC27]
 gi|262028965|gb|EEY47618.1| heat shock protein GrpE [Vibrio cholerae INDRE 91/1]
 gi|297543350|gb|EFH79400.1| co-chaperone GrpE [Vibrio cholerae MAK 757]
          Length = 200

 Score =  111 bits (277), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 61/186 (32%), Positives = 107/186 (57%), Gaps = 8/186 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   ++ +ID  +     +   A+          S  + +E +D  LR  AE+EN+RRR+
Sbjct: 23  EVVGTDADIDWNQAADEIDEKEAKIAQLEAALLVSEERVKEQQDSVLRARAEVENMRRRS 82

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           ++E   A+ +++++FA ++L V DNL RA+ +A  ++          +K L+EG+E+T +
Sbjct: 83  EQEVDKARKFALSRFAEELLPVIDNLERAIQAADGEV--------EAIKPLLEGVELTHK 134

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
             + T+ ++G+K+I+   + FNP  HQAM  +       NT++ V+Q GY +N RVLRPA
Sbjct: 135 TFVDTIAKFGLKEINPHGEVFNPEFHQAMSIQESAEHEPNTVMFVMQKGYELNGRVLRPA 194

Query: 182 LVSISK 187
           +V +SK
Sbjct: 195 MVMVSK 200


>gi|114602725|ref|XP_001163063.1| PREDICTED: grpE protein homolog 2, mitochondrial [Pan troglodytes]
          Length = 225

 Score =  111 bits (277), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 42/174 (24%), Positives = 88/174 (50%), Gaps = 3/174 (1%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
           ++P +       E++      +   + ++   +Y R IA+ EN+RRRT R  +DA+ + I
Sbjct: 47  EDPPDELGPPLAERALRVKAVKLEKEVQDLTVRYQRAIADCENIRRRTQRCVEDAKIFGI 106

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
             F +D++ V+D L +  +    +    ++K    L+ +  G+ +   ++ S   ++G++
Sbjct: 107 QSFCKDLVEVADILEKTTECISEESEPEDQKLT--LEKVFRGLLLLEAKLKSVFAKHGLE 164

Query: 134 KIDAKDQKFNPNMHQAMFEEPHD-TVPANTIIKVVQDGYAINERVLRPALVSIS 186
           K+     K++P+ H+ +   P    V   T+  V QDGY ++ R +R A V ++
Sbjct: 165 KLTPIGDKYDPHEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVA 218


>gi|284922559|emb|CBG35646.1| heat shock protein (heat shock protein B25.3) [Escherichia coli
           042]
          Length = 197

 Score =  111 bits (277), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 57/190 (30%), Positives = 99/190 (52%), Gaps = 9/190 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR-DKYLRVIAEMENLRRR 60
           E  M +    +   P  +         +I   E  L +++    D  LRV AEMENLRRR
Sbjct: 16  EIIMDQHEDIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLRRR 75

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+ + + A  +++ KF  ++L V D+L RAL+ A              + +++EGIE+T 
Sbjct: 76  TELDIEKAHKFALEKFINELLPVIDSLDRALEVADKA--------NPDMSAMVEGIELTL 127

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + M+  + ++GV+ I   +   +PN+HQA+     D V    ++ ++Q GY +N R +R 
Sbjct: 128 KSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRA 187

Query: 181 ALVSISKGKT 190
           A+V+++K K 
Sbjct: 188 AMVTVAKAKA 197


>gi|238762782|ref|ZP_04623751.1| hypothetical protein ykris0001_9610 [Yersinia kristensenii ATCC
           33638]
 gi|238699087|gb|EEP91835.1| hypothetical protein ykris0001_9610 [Yersinia kristensenii ATCC
           33638]
          Length = 192

 Score =  111 bits (277), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 58/190 (30%), Positives = 99/190 (52%), Gaps = 9/190 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPE-ESLNQSEEFRDKYLRVIAEMENLRRR 60
           E    E     E+       +       +   E +     +  R+  LR  AE+EN+RRR
Sbjct: 11  EQVSEEMENAAEQQVEATQETGEGLDPRVAELEVQLAAALQRERESLLRAKAEVENIRRR 70

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+++ + A  +++ KF+ ++L V DNL RALD+A              L ++IEG+E+T 
Sbjct: 71  TEQDVEKAHKFALEKFSSELLPVIDNLERALDTADKT--------NEELTAMIEGVELTL 122

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + ++  + +YG++ +   +  FNP +HQAM          N ++ V+Q GY +N R+LRP
Sbjct: 123 KSLLDAVGKYGIQVVSETNVPFNPEVHQAMTMLESADHEPNHVMMVMQKGYTLNGRLLRP 182

Query: 181 ALVSISKGKT 190
           A+V++SK K 
Sbjct: 183 AMVAVSKAKA 192


>gi|126291502|ref|XP_001380736.1| PREDICTED: hypothetical protein [Monodelphis domestica]
          Length = 186

 Score =  111 bits (276), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 43/186 (23%), Positives = 93/186 (50%), Gaps = 5/186 (2%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           M    SE       +PS  +   + E++  +       +  +  ++Y + +A+ E++RRR
Sbjct: 1   MAAQSSEGEAYGSTDPSGESGPLSAEEALEHKALRLQEEVRDLTERYQKALADSEHVRRR 60

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T +  +DA+ + I  F +D++ ++D L +A               ++ LK + EG+ + +
Sbjct: 61  TQKFVEDAKIFGIQSFCKDLVEIADILEKATA-----GETEAGDQKTTLKKVFEGLSLLQ 115

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
            ++ +   ++G++K+     K++P  H+ +   P D V   T+  V Q+GY ++ R +RP
Sbjct: 116 AKLQNVFAKHGLQKMTPIGDKYDPYDHEIVCHIPADGVQPGTVTLVTQNGYKLHGRTIRP 175

Query: 181 ALVSIS 186
           A V ++
Sbjct: 176 AQVGVA 181


>gi|325521151|gb|EGD00053.1| heat shock protein GrpE [Burkholderia sp. TJI49]
          Length = 181

 Score =  111 bits (276), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 56/188 (29%), Positives = 93/188 (49%), Gaps = 12/188 (6%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   S+   D          +    ++      E+  +  E ++ +LR  AE EN+RRR 
Sbjct: 6   ENPASQSAEDTGSETQATQGAAPAAEAADAALAEAQAKVAELQESFLRAKAETENVRRRA 65

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
             +   A  ++I  FA  +L V D+L  A+             +   +  + EG+E+T R
Sbjct: 66  QDDVAKAHKFAIESFAEHLLPVLDSLEAAV-----------GDTSGDITKVREGVELTLR 114

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           ++ S LE+  V  I+   +KF+P+ HQA+   P      NT++ V+Q GY I +RVLRPA
Sbjct: 115 QLTSALEKGRVVAINPVGEKFDPHQHQAISMVP-AEQEPNTVVSVLQKGYMIADRVLRPA 173

Query: 182 LVSISKGK 189
           LV++++ K
Sbjct: 174 LVTVAQPK 181


>gi|85712934|ref|ZP_01043974.1| Molecular chaperone GrpE (heat shock protein) [Idiomarina baltica
           OS145]
 gi|85693240|gb|EAQ31198.1| Molecular chaperone GrpE (heat shock protein) [Idiomarina baltica
           OS145]
          Length = 224

 Score =  111 bits (276), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 60/193 (31%), Positives = 106/193 (54%), Gaps = 8/193 (4%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
             E+   +++  + A++             ++  +  E ++  LR  AEMEN+RRR  ++
Sbjct: 40  SDEQPETQQQTAAAADNQADRIAELELALTKAEAKVNEQKESVLRSQAEMENVRRRASQD 99

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
            + A  +++ KFA ++L+  DNL RA+ +A  +           LKS +EGIE+T + + 
Sbjct: 100 VEKAHKFALEKFANELLTSVDNLERAMQAADTE--------NPELKSFLEGIELTYKSLT 151

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
           STL+++GVK +  + + FNP++HQAM  +       NTII V+Q GY +N R+LRPA+V 
Sbjct: 152 STLDKFGVKAVGEEGEVFNPDLHQAMSMQESAEHKNNTIIAVMQKGYELNGRLLRPAMVM 211

Query: 185 ISKGKTQNPTEEK 197
           +++        + 
Sbjct: 212 VARNSNGGVDTKA 224


>gi|170765860|ref|ZP_02900671.1| co-chaperone GrpE [Escherichia albertii TW07627]
 gi|170125006|gb|EDS93937.1| co-chaperone GrpE [Escherichia albertii TW07627]
          Length = 197

 Score =  111 bits (276), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 57/189 (30%), Positives = 99/189 (52%), Gaps = 9/189 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR-DKYLRVIAEMENLRRR 60
           E  M +    +   P  +         +I   E  L +++    D  LRV AEMENLRRR
Sbjct: 16  EIIMDQHEEIEAVEPDASAEQVDPRDEKIANLEAQLAEAQARERDGILRVKAEMENLRRR 75

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+ + + A  +++ KF  ++L V D+L RAL+ A              + +++EGIE+T 
Sbjct: 76  TELDIEKAHKFALEKFINELLPVIDSLDRALEVADKA--------NPDMSAMVEGIELTL 127

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + M+  + ++GV+ I   +   +PN+HQA+     D V    ++ ++Q GY +N R +R 
Sbjct: 128 KSMLDVVRKFGVEVISETNVPLDPNVHQAIAMVESDDVEPGNVLGIMQKGYTLNGRTIRA 187

Query: 181 ALVSISKGK 189
           A+V+++K K
Sbjct: 188 AMVTVAKAK 196


>gi|238920934|ref|YP_002934449.1| co-chaperone GrpE [Edwardsiella ictaluri 93-146]
 gi|238870503|gb|ACR70214.1| co-chaperone GrpE [Edwardsiella ictaluri 93-146]
          Length = 192

 Score =  111 bits (276), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 54/185 (29%), Positives = 101/185 (54%), Gaps = 12/185 (6%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEF----RDKYLRVIAEMENLRRRTDR 63
           + ++ E   +    +  E  +      E   Q +      R+  LR  A+++N+RRR ++
Sbjct: 16  EQVENEALQAETQGAGVEPDARDARIAELEAQLKAMGEHEREIMLRARADVDNIRRRAEQ 75

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           + + A  +++ KF+ ++L V DNL RAL+ A            + L S+IEG+E+T + +
Sbjct: 76  DVEKAHKFALEKFSGELLPVIDNLERALELADKS--------NTELVSMIEGVELTLKSL 127

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
           +  + ++GV+++   +  FNP +HQAM          N ++ V+Q GY +N R++RPA+V
Sbjct: 128 LDVVRKFGVEQVAEVNVPFNPEVHQAMTMMASPDHAPNQVMMVMQKGYTLNGRLIRPAMV 187

Query: 184 SISKG 188
           ++SKG
Sbjct: 188 AVSKG 192


>gi|238796723|ref|ZP_04640229.1| hypothetical protein ymoll0001_29400 [Yersinia mollaretii ATCC
           43969]
 gi|238719454|gb|EEQ11264.1| hypothetical protein ymoll0001_29400 [Yersinia mollaretii ATCC
           43969]
          Length = 192

 Score =  111 bits (276), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 57/190 (30%), Positives = 100/190 (52%), Gaps = 9/190 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR-DKYLRVIAEMENLRRR 60
           E    E     E+       +       +   E  L ++ +   +  LR  AE+EN+RRR
Sbjct: 11  EQVSEEMENAAEQQVEATQETGEGVDPRVAELEAQLAEALQRERESLLRAKAEVENIRRR 70

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+ + + A  +++ +F+ ++L V DNL RALD+A            + L S+IEG+E+T 
Sbjct: 71  TELDVEKAHKFALERFSAELLPVIDNLERALDTADKA--------NTELTSMIEGVELTL 122

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + ++  + ++G++ +   +  FNP +HQAM          N ++ V+Q GY +N R+LRP
Sbjct: 123 KSLLDAVGKFGIEVVSDTNVPFNPEVHQAMTMLESADHEPNNVMMVMQKGYTLNGRLLRP 182

Query: 181 ALVSISKGKT 190
           A+V++SK K 
Sbjct: 183 AMVAVSKAKA 192


>gi|258511964|ref|YP_003185398.1| GrpE protein [Alicyclobacillus acidocaldarius subsp. acidocaldarius
           DSM 446]
 gi|257478690|gb|ACV59009.1| GrpE protein [Alicyclobacillus acidocaldarius subsp. acidocaldarius
           DSM 446]
          Length = 208

 Score =  111 bits (276), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 53/178 (29%), Positives = 93/178 (52%), Gaps = 10/178 (5%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
            + +E     A  S  EE +  + P+    Q EE   + LR  A+ +N RRRT +E+++ 
Sbjct: 40  EMAEEDLSYEAGDSAEEEGASASEPDPRDAQIEELTQQLLRTRADFDNFRRRTRQEREEL 99

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
             ++  K   D+L V DN  RA+ +                  + +GIEM  R+++  + 
Sbjct: 100 VQFATKKLLADLLPVLDNFDRAIQALEGVDEP----------QMKQGIEMVHRQLIQVMH 149

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           +YGV ++DA    F+P+ H+A+ +E  +      +I+V+Q GY ++ +VLRPA+V +S
Sbjct: 150 QYGVTEMDAVGAPFDPSQHEAVMQEQVEGQEPGRVIEVLQKGYLLHGKVLRPAMVKVS 207


>gi|307294014|ref|ZP_07573858.1| GrpE protein [Sphingobium chlorophenolicum L-1]
 gi|306880165|gb|EFN11382.1| GrpE protein [Sphingobium chlorophenolicum L-1]
          Length = 184

 Score =  111 bits (276), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 68/188 (36%), Positives = 97/188 (51%), Gaps = 8/188 (4%)

Query: 5   MSEKNIDKEKNP---SNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           MSE   + E           +     +         N+    R   L   AE +N+RRR 
Sbjct: 1   MSEDKQNIENTEVVDELPEDAAPAGDAAAERIAALENELATARQDVLYAHAETQNVRRRL 60

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           ++E  DA++Y+   FARDMLSV+DNL RAL + P DL           K L+ G+E T R
Sbjct: 61  EKELADARAYAATAFARDMLSVADNLGRALQAIPADLRED-----EKFKGLVAGLEATGR 115

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           E+ +   R G++K+ +  Q  +PN HQAM E P D     T++  +Q GY I +R+LRPA
Sbjct: 116 ELEAVFGRNGIEKLVSVGQPLDPNKHQAMMEVPSDEAEPGTVLVEMQAGYTIKDRLLRPA 175

Query: 182 LVSISKGK 189
           LVS++K  
Sbjct: 176 LVSVAKKP 183


>gi|308180800|ref|YP_003924928.1| co-chaperone GrpE [Lactobacillus plantarum subsp. plantarum ST-III]
 gi|308046291|gb|ADN98834.1| co-chaperone GrpE [Lactobacillus plantarum subsp. plantarum ST-III]
          Length = 199

 Score =  111 bits (276), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 51/180 (28%), Positives = 90/180 (50%), Gaps = 10/180 (5%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +      + ++  +             +   Q +   D+ LR  AE+ N++ R  +E+  
Sbjct: 28  EATQAATSTTDDQAEQTTAVDPTQQITDLKAQLDAKDDQLLRAQAEIVNMQNRNKKEQAA 87

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
              Y     A+D+L V DNL RAL +   D            + L +G+EM    +   L
Sbjct: 88  LLKYDGQALAKDVLPVLDNLERALATPADD---------EAAQQLKKGVEMVYGHLQDAL 138

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEP-HDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           +++GV ++ A  +KF+PN+HQA+   P  D  PA+T+++V+Q GY + +R LRPA+V ++
Sbjct: 139 KKHGVTEVAAAGEKFDPNIHQAVQTVPVDDDHPADTVVQVLQRGYLLKDRTLRPAMVVVA 198


>gi|56752030|ref|YP_172731.1| heat shock protein GrpE [Synechococcus elongatus PCC 6301]
 gi|56686989|dbj|BAD80211.1| heat shock protein GrpE [Synechococcus elongatus PCC 6301]
          Length = 214

 Score =  111 bits (276), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 53/219 (24%), Positives = 96/219 (43%), Gaps = 29/219 (13%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEIN---------------------IPEESLNQ 39
           +   MSE     E++ + AN  +AE  SE +                       +    +
Sbjct: 4   LSIVMSEHQTPPEEDLTVANGDSAEAVSEPDVTVASGQEAAELAAQLALVAADRDRLKTE 63

Query: 40  SEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLA 99
            +E    YLR+ A+ EN RRRT +E+++ +  S      ++L V DN  RA         
Sbjct: 64  LDEQNSAYLRLAADFENFRRRTLKEREELELQSKRTTITELLPVIDNFDRARAQIKPQGE 123

Query: 100 NSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVP 159
            +E        ++ +  +   ++++  L+R GV  + A+ Q F+P++H A+  E     P
Sbjct: 124 EAE--------AIHKSYQGLYKQLVDCLKRIGVSPMRAEGQPFDPSLHDAVLREETTEHP 175

Query: 160 ANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKK 198
              +++ +Q GY + + VLR ALV +S    +N     +
Sbjct: 176 DGIVLEELQRGYLLGDLVLRHALVKVSIAAEENSAAVTE 214


>gi|33519991|ref|NP_878823.1| heat shock protein GrpE [Candidatus Blochmannia floridanus]
 gi|52782917|sp|Q7VRQ6|GRPE_BLOFL RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|33504337|emb|CAD83230.1| heat shock protein GrpE [Candidatus Blochmannia floridanus]
          Length = 195

 Score =  111 bits (276), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 53/192 (27%), Positives = 100/192 (52%), Gaps = 12/192 (6%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDK----YLRVIAEMENLR 58
              S   I K++   +A    +    + +   +   Q  + ++      LR+ AE+EN++
Sbjct: 12  NASSANTIKKDELSESACKIDSIIDPKDDQIIQLQIQLAQIKEHERNTILRLKAEIENIQ 71

Query: 59  RRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEM 118
           RR  +E + A  +++ +F  ++L V DNL R L               + L ++IEGI++
Sbjct: 72  RRNIQEIEKAHKFALDRFVSELLPVIDNLERTLGIIDRS--------NTTLSAIIEGIDL 123

Query: 119 TRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVL 178
           T +  + T+ ++GVK I      FNP +HQA+     +   +N ++ +VQ GY++N R++
Sbjct: 124 TLKSFLDTVYKFGVKSIHEIHIPFNPEIHQAISTMESEKYESNQVLTIVQKGYSLNGRLV 183

Query: 179 RPALVSISKGKT 190
           RPA+V ++K K+
Sbjct: 184 RPAMVIVAKSKS 195


>gi|260435548|ref|ZP_05789518.1| co-chaperone GrpE [Synechococcus sp. WH 8109]
 gi|260413422|gb|EEX06718.1| co-chaperone GrpE [Synechococcus sp. WH 8109]
          Length = 225

 Score =  111 bits (276), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 40/207 (19%), Positives = 82/207 (39%), Gaps = 8/207 (3%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
            +      +    A       +           + E    +Y+R+ A+ +N R+R  R++
Sbjct: 27  PDAPEATSEQAPAAVDPADRMQQLEQELSALKQEHETLNSQYMRIAADFDNFRKRQSRDQ 86

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
            D +   +     ++L V DN  RA      +            ++L    +   ++++ 
Sbjct: 87  DDMRQQLVCSTLTEILPVVDNFERARQQLNPEG--------EEAQALHRSYQGLYKQLVE 138

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
            L++ GV +++   Q+F+PN+H+A+  E       + + + +Q GY  + RVLR A+V +
Sbjct: 139 VLKQQGVARMEVVGQEFDPNLHEAVLREESSEFAEDVVCEELQRGYHRDGRVLRHAMVKV 198

Query: 186 SKGKTQNPTEEKKETIEQPSPLDIEER 212
           S G   +                 EE 
Sbjct: 199 SMGPGPSDPASAPAEAAATPDQTAEEP 225


>gi|317484539|ref|ZP_07943447.1| GrpE protein [Bilophila wadsworthia 3_1_6]
 gi|316924200|gb|EFV45378.1| GrpE protein [Bilophila wadsworthia 3_1_6]
          Length = 188

 Score =  111 bits (276), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 48/197 (24%), Positives = 86/197 (43%), Gaps = 16/197 (8%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQS-------EEFRDKYLRVIAE 53
           M      +    +   +  N +   +  E  + E+   +         E  +  LR +AE
Sbjct: 1   MTDTRDPQTEKGQNGATEENLAETAQAPEKTLEEQFREEICPTCTVKAEADETRLRALAE 60

Query: 54  MENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLI 113
           MEN ++R  R+  +   Y+     +D+L   D+L  A+     D            KSL+
Sbjct: 61  MENFKKRIQRDHDEYMRYASEPVLKDLLPALDSLDLAIQYGGSD---------ETCKSLL 111

Query: 114 EGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAI 173
            G+ MTR+ ++  L+ +G        + FNP++H A+  E  D +    +  + Q GY +
Sbjct: 112 TGVIMTRKLLLDALKNHGFDVAGEVGEPFNPDVHDAVSYEERDDMEPGLVSTLHQRGYRL 171

Query: 174 NERVLRPALVSISKGKT 190
            +R+LRPA VS+S+   
Sbjct: 172 KDRLLRPAKVSVSRKPA 188


>gi|157828825|ref|YP_001495067.1| grpE protein [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165933551|ref|YP_001650340.1| heat shock protein GrpE [Rickettsia rickettsii str. Iowa]
 gi|157801306|gb|ABV76559.1| grpE protein [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165908638|gb|ABY72934.1| GrpE [Rickettsia rickettsii str. Iowa]
          Length = 199

 Score =  111 bits (276), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 57/188 (30%), Positives = 102/188 (54%), Gaps = 9/188 (4%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
             M + NI+  +   N  +    E +          + EE +DK +R  AE++N R+R +
Sbjct: 20  NNMIDDNIENNEQTINDIAEEIVETANPE-VTALKAEIEELKDKLIRTTAEIDNTRKRLE 78

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           + + +A+ Y+IA FA+++L+VSDNLSRAL   P +           + ++I G++MT+ E
Sbjct: 79  KARDEAKDYAIATFAKELLNVSDNLSRALAHKPANSDVE-------VTNIIAGVQMTKDE 131

Query: 123 MMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           +     ++ +++I  +    F+ N+H A+ +  H     N+II ++Q GY I +R+LRPA
Sbjct: 132 LDKVFHKHHIEEIKPEIGSMFDYNLHNAIAQIEHPDHAPNSIITLMQSGYKIRDRLLRPA 191

Query: 182 LVSISKGK 189
            V + K  
Sbjct: 192 TVQVVKKP 199


>gi|126738495|ref|ZP_01754200.1| co-chaperone GrpE [Roseobacter sp. SK209-2-6]
 gi|126720294|gb|EBA17000.1| co-chaperone GrpE [Roseobacter sp. SK209-2-6]
          Length = 187

 Score =  111 bits (276), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 55/160 (34%), Positives = 97/160 (60%), Gaps = 8/160 (5%)

Query: 32  IPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRAL 91
             +E   + ++++D+++R +A+ EN R+R D+ +++A++Y  +K ARDML V DNL RA+
Sbjct: 34  ELDELRAERDQYKDRFMRALADAENARKRGDKARREAENYGGSKLARDMLPVYDNLKRAV 93

Query: 92  DSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK-KIDAKDQKFNPNMHQAM 150
           +SA  +          V  +LIEG+E+T R ++   E++G++        +F+P MH+AM
Sbjct: 94  ESASDEQR-------EVAAALIEGVELTMRSLLGVFEKHGIRIVSPEVGDRFDPQMHEAM 146

Query: 151 FEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           FE P     A  II+V  +G+ +++R+LR A V +S    
Sbjct: 147 FEAPVPGTKAGDIIQVSAEGFMLHDRLLRAAQVGVSSTPA 186


>gi|72383180|ref|YP_292535.1| heat shock protein GrpE [Prochlorococcus marinus str. NATL2A]
 gi|123773739|sp|Q46I46|GRPE_PROMT RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|72003030|gb|AAZ58832.1| molecular chaperone GrpE, heat shock protein [Prochlorococcus
           marinus str. NATL2A]
          Length = 259

 Score =  111 bits (276), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 48/214 (22%), Positives = 94/214 (43%), Gaps = 9/214 (4%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
           ++      +  S +  S  +        ++   + E    +Y+R+ A+ +N R+R  R++
Sbjct: 53  NDSVDTANEQSSTSCESNIKGSDTEARLQQLEKEHETLNSQYMRIAADFDNFRKRQTRDQ 112

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
            D +         ++L + DN  RA      +            ++L    +   ++++ 
Sbjct: 113 DDLKIQLTCTTLSEILPIVDNFERARQQLNPEG--------EEAQALHRSYQGLYKQLVE 164

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
            L+  GV  +   DQ F+P++H+A+  EP D    + +I+ +Q GY +N RVLR ALV +
Sbjct: 165 VLKNLGVAPMRVVDQAFDPSLHEAVMREPSDEKAEDIVIEELQRGYHLNGRVLRHALVKV 224

Query: 186 SKGKTQNPTEEKKETIEQPSPLDIEERNKTQTKN 219
           S G       E+    +  S  ++ E     TK+
Sbjct: 225 SMGPGPKVINEEI-PDQSASNQELSESVDGSTKD 257


>gi|157148126|ref|YP_001455445.1| heat shock protein GrpE [Citrobacter koseri ATCC BAA-895]
 gi|157085331|gb|ABV15009.1| hypothetical protein CKO_03936 [Citrobacter koseri ATCC BAA-895]
          Length = 251

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 55/190 (28%), Positives = 98/190 (51%), Gaps = 9/190 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR-DKYLRVIAEMENLRRR 60
           E  M +    +      +         +I   E  L +++    D  LR+ AEMENLRRR
Sbjct: 70  EIIMDQHEEVEAVESDASAEQVDPRDEKIANLEAQLAEAQNRERDSVLRIKAEMENLRRR 129

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+ + + A  +++ KF  ++L V D+L RAL+ A              + S++EGIE+T 
Sbjct: 130 TELDVEKAHKFALEKFVNELLPVIDSLDRALEVADKA--------NPDMASMVEGIELTL 181

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + M+  + ++GV+ I   +   +PN+HQA+     + V    ++ ++Q GY +N R +R 
Sbjct: 182 KSMLDVVRKFGVEVIADTNVPLDPNVHQAIAMVESEDVTPGNVLGIMQKGYTLNGRTIRA 241

Query: 181 ALVSISKGKT 190
           A+V+++K K 
Sbjct: 242 AMVTVAKAKA 251


>gi|254465145|ref|ZP_05078556.1| co-chaperone GrpE [Rhodobacterales bacterium Y4I]
 gi|206686053|gb|EDZ46535.1| co-chaperone GrpE [Rhodobacterales bacterium Y4I]
          Length = 187

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 53/160 (33%), Positives = 96/160 (60%), Gaps = 8/160 (5%)

Query: 32  IPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRAL 91
             +    + +E +D+++R +A+ EN R+R D+ +++A+ Y  +K ARDML V DN+ RA+
Sbjct: 34  EIDALRAERDELKDRFMRALADAENARKRGDKARREAEQYGGSKLARDMLPVYDNMKRAI 93

Query: 92  DSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAM 150
           ++A  +          V  +LIEG+E+T R ++   E++G++ +  +   KF+P +H+AM
Sbjct: 94  EAATDEQR-------EVSAALIEGVELTMRSLLGVFEKHGIRVVSPEVGDKFDPQVHEAM 146

Query: 151 FEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           FE P     A  II+V  +G+ +++R+LR A V +S    
Sbjct: 147 FEAPVPGTKAGDIIQVSAEGFMLHDRLLRAAQVGVSSTPA 186


>gi|153802062|ref|ZP_01956648.1| heat shock protein GrpE [Vibrio cholerae MZO-3]
 gi|153824596|ref|ZP_01977263.1| heat shock protein GrpE [Vibrio cholerae MZO-2]
 gi|153828290|ref|ZP_01980957.1| heat shock protein GrpE [Vibrio cholerae 623-39]
 gi|254225096|ref|ZP_04918710.1| heat shock protein GrpE [Vibrio cholerae V51]
 gi|297581243|ref|ZP_06943167.1| heat shock protein GrpE [Vibrio cholerae RC385]
 gi|124122421|gb|EAY41164.1| heat shock protein GrpE [Vibrio cholerae MZO-3]
 gi|125622483|gb|EAZ50803.1| heat shock protein GrpE [Vibrio cholerae V51]
 gi|148876244|gb|EDL74379.1| heat shock protein GrpE [Vibrio cholerae 623-39]
 gi|149741814|gb|EDM55843.1| heat shock protein GrpE [Vibrio cholerae MZO-2]
 gi|297534559|gb|EFH73396.1| heat shock protein GrpE [Vibrio cholerae RC385]
 gi|327483599|gb|AEA78006.1| Heat shock protein GrpE [Vibrio cholerae LMA3894-4]
          Length = 200

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 61/186 (32%), Positives = 107/186 (57%), Gaps = 8/186 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   ++ +ID  +     +   A+          S  + +E +D  LR  AE+EN+RRR+
Sbjct: 23  EVVGTDADIDWNQAADEIDEKEAKIAQLEAALLVSEERVKEQQDSVLRARAEVENMRRRS 82

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           ++E   A+ +++++FA ++L V DNL RA+ +A  ++          +K L+EG+E+T +
Sbjct: 83  EQEVDKARKFALSRFAEELLPVIDNLERAIQAADGEV--------EAIKPLLEGVELTHK 134

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
             + T+ ++G+K+I+   + FNP  HQAM  +       NT++ V+Q GY +N RVLRPA
Sbjct: 135 TFVDTIAKFGLKEINPHGEAFNPEFHQAMSIQESAEHEPNTVMFVMQKGYELNGRVLRPA 194

Query: 182 LVSISK 187
           +V +SK
Sbjct: 195 MVMVSK 200


>gi|28378661|ref|NP_785553.1| heat shock protein GrpE [Lactobacillus plantarum WCFS1]
 gi|254556859|ref|YP_003063276.1| heat shock protein GrpE [Lactobacillus plantarum JDM1]
 gi|52782935|sp|Q88VL9|GRPE_LACPL RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|28271497|emb|CAD64402.1| heat shock protein GrpE [Lactobacillus plantarum WCFS1]
 gi|254045786|gb|ACT62579.1| heat shock protein GrpE [Lactobacillus plantarum JDM1]
          Length = 199

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 51/180 (28%), Positives = 90/180 (50%), Gaps = 10/180 (5%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +      + ++  +             +   Q +   D+ LR  AE+ N++ R  +E+  
Sbjct: 28  EATQAATSATDDQAEQTTAVDPTQQITDLKAQLDAKDDQLLRAQAEIVNMQNRNKKEQAA 87

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
              Y     A+D+L V DNL RAL +   D            + L +G+EM    +   L
Sbjct: 88  LLKYDGQALAKDVLPVLDNLERALATPADD---------EAAQQLKKGVEMVYGHLQDAL 138

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEP-HDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           +++GV ++ A  +KF+PN+HQA+   P  D  PA+T+++V+Q GY + +R LRPA+V ++
Sbjct: 139 KKHGVTEVAAAGEKFDPNIHQAVQTVPVDDDHPADTVVQVLQRGYLLKDRTLRPAMVVVA 198


>gi|269140080|ref|YP_003296781.1| heat shock protein [Edwardsiella tarda EIB202]
 gi|267985741|gb|ACY85570.1| heat shock protein [Edwardsiella tarda EIB202]
 gi|304559907|gb|ADM42571.1| Heat shock protein GrpE [Edwardsiella tarda FL6-60]
          Length = 192

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 56/185 (30%), Positives = 102/185 (55%), Gaps = 12/185 (6%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDK----YLRVIAEMENLRRRTDR 63
           + ++ E   +    + AE  +      E   Q +   D+     LR  AE++N+RRR ++
Sbjct: 16  EQVENEALQAETQGAGAEPDARDVRIAELEAQLKATGDQEREIMLRARAEVDNIRRRAEQ 75

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           + + A  +++ KF+ ++L V DNL RAL+ A            + L S+IEG+E+T + +
Sbjct: 76  DVEKAHKFALEKFSGELLPVIDNLERALELADKS--------NTELVSMIEGVELTLKSL 127

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
           +  + ++GV+++   +  FNP +HQAM          N ++ V+Q GY +N R++RPA+V
Sbjct: 128 LDVVRKFGVEQVAEVNVPFNPEVHQAMTMMASPDHAPNQVMMVMQKGYTLNGRLIRPAMV 187

Query: 184 SISKG 188
           ++SKG
Sbjct: 188 AVSKG 192


>gi|254583852|ref|XP_002497494.1| ZYRO0F06820p [Zygosaccharomyces rouxii]
 gi|238940387|emb|CAR28561.1| ZYRO0F06820p [Zygosaccharomyces rouxii]
          Length = 217

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 54/188 (28%), Positives = 100/188 (53%), Gaps = 4/188 (2%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
              + +   K++  +      +E +      +    ++ E++D+ +R +A+  NL+  T 
Sbjct: 34  KNENAQEEPKQEQENKKEEQGSELQELQQKLQNKDKEAAEYKDRLVRCVADFRNLQEVTK 93

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           ++ + A+ +++ KFA+D+L   DN   AL++       ++ K  S +K L  G++MTR  
Sbjct: 94  KDVQKAKDFALQKFAKDLLESVDNFGHALNAF----DAADSKHSSEVKELYTGVKMTRDV 149

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
              TL +YG++KI+   Q+F+PN H+A FE         T+  V Q G+++N RV+RPA 
Sbjct: 150 FEKTLYKYGIEKIEPLGQQFDPNQHEATFELDQPDKEPGTVFFVQQVGFSLNSRVIRPAK 209

Query: 183 VSISKGKT 190
           V I K + 
Sbjct: 210 VGIVKARE 217


>gi|145629060|ref|ZP_01784859.1| anaerobic ribonucleoside triphosphate reductase [Haemophilus
           influenzae 22.1-21]
 gi|144978563|gb|EDJ88286.1| anaerobic ribonucleoside triphosphate reductase [Haemophilus
           influenzae 22.1-21]
          Length = 244

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 58/175 (33%), Positives = 101/175 (57%), Gaps = 11/175 (6%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDK----YLRVIAEMENLRRRTDREKKDAQ 69
           ++    +           + E+   Q EE  +K     LR  AE+ENLRRRT+++ + A 
Sbjct: 69  EHSQEFDPLEEAIARVQELEEQLKTQIEEAANKEQDILLRSRAEIENLRRRTEQDVEKAH 128

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
            +++ KF++D+L+  DNL RAL +          K +  +K+L +G+E+T +E++ST+ R
Sbjct: 129 KFALEKFSKDILNTIDNLERALAT-------PANKEDESVKALFDGVELTLKELVSTVGR 181

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
           +GV+ +    + FNP++HQA+  +P +    N I  V+Q GY ++ RV+RPA+V 
Sbjct: 182 FGVEAVGVVGEAFNPDLHQAISMQPAEGFETNQISVVLQKGYTLSGRVIRPAMVM 236


>gi|127513700|ref|YP_001094897.1| GrpE protein [Shewanella loihica PV-4]
 gi|166215284|sp|A3QGP0|GRPE_SHELP RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|126638995|gb|ABO24638.1| GrpE protein [Shewanella loihica PV-4]
          Length = 205

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 60/212 (28%), Positives = 110/212 (51%), Gaps = 29/212 (13%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQS---------------------EEF 43
           MS+++   ++       + A E   +      +++                      EE 
Sbjct: 1   MSKESNKAQEPQIEETEAVAVETEVVEDAASLMDELTQANFRVEELEQALAAAEAKVEEQ 60

Query: 44  RDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEK 103
           +D  +R  AE+EN+RRR   + + A  +++ KFA ++L V DN+ RAL     +      
Sbjct: 61  KDSVIRAAAEVENVRRRAAIDVEKAHKFALEKFANELLPVIDNMERALQGTSSE------ 114

Query: 104 KSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI 163
             +   K++ EG+E+T +   S + ++G+ ++D + + FNP+ HQA+  +P +  PANT+
Sbjct: 115 --DEATKAIYEGVELTLKTFTSAVAKFGLTQVDPQGEAFNPDHHQAIGMQPSEEFPANTV 172

Query: 164 IKVVQDGYAINERVLRPALVSISKGKTQNPTE 195
           + V+Q GY +NER+LRPA+V +S+G     T+
Sbjct: 173 MMVMQKGYMLNERLLRPAMVMVSQGGASVDTQ 204


>gi|197101653|ref|NP_001127040.1| grpE protein homolog 2, mitochondrial precursor [Pongo abelii]
 gi|75061585|sp|Q5R435|GRPE2_PONAB RecName: Full=GrpE protein homolog 2, mitochondrial; AltName:
           Full=Mt-GrpE#2; Flags: Precursor
 gi|55733609|emb|CAH93481.1| hypothetical protein [Pongo abelii]
          Length = 225

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 41/174 (23%), Positives = 88/174 (50%), Gaps = 3/174 (1%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
           ++P +       E++      +   + ++   +Y R +A+ EN+RRRT R  +DA+ + I
Sbjct: 47  EDPPDELGPPLAERALRVKAVKLEKEVQDLTVRYQRAVADCENIRRRTQRCVEDAKIFGI 106

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
             F +D++ V+D L +  +    +    ++K    L+ +  G+ +   ++ S   ++G++
Sbjct: 107 QSFCKDLVEVADILEKTTECISEESEPEDQKLT--LEKVFRGLLLLEAKLKSVFAKHGLE 164

Query: 134 KIDAKDQKFNPNMHQAMFEEPHD-TVPANTIIKVVQDGYAINERVLRPALVSIS 186
           K+     K++P+ H+ +   P    V   T+  V QDGY ++ R +R A V ++
Sbjct: 165 KLTPIGDKYDPHEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVA 218


>gi|158313407|ref|YP_001505915.1| GrpE protein [Frankia sp. EAN1pec]
 gi|158108812|gb|ABW11009.1| GrpE protein [Frankia sp. EAN1pec]
          Length = 161

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 46/159 (28%), Positives = 75/159 (47%), Gaps = 15/159 (9%)

Query: 35  ESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSA 94
           +   + EE + ++LR +A+ +N RRRT RE   A +    +     L V D+L  AL  A
Sbjct: 10  DLAAELEESQARHLRTLADFDNYRRRTGREISAAMAAERDRVVLAWLPVLDHLELALAHA 69

Query: 95  PLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEP 154
             D             SL++G+   R+  +  L   GV ++D +   F+P  H+      
Sbjct: 70  DADPD-----------SLVDGVRGVRQLALDALRISGVARLDDETGPFDPARHEVGAVVD 118

Query: 155 HDTV----PANTIIKVVQDGYAINERVLRPALVSISKGK 189
             +     PA T+++V++ G     RVLRPA V++S G 
Sbjct: 119 SASTPQPPPAGTVVEVLRPGVEAGGRVLRPASVAVSAGP 157


>gi|118603015|ref|YP_904230.1| GrpE protein [Candidatus Ruthia magnifica str. Cm (Calyptogena
           magnifica)]
 gi|226737166|sp|A1AXV2|GRPE_RUTMC RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|118567954|gb|ABL02759.1| GrpE protein [Candidatus Ruthia magnifica str. Cm (Calyptogena
           magnifica)]
          Length = 180

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 54/184 (29%), Positives = 106/184 (57%), Gaps = 8/184 (4%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
              +EK        + + +   +E +      ++   +++  DK LR  AEMENL+RR  
Sbjct: 4   KKSTEKEDINPTIKAVSQTPKEKEDNLKEQLIQAQQSAKDNWDKLLRSQAEMENLKRRNA 63

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           ++ ++A  +++  F + +L V D+LS  + +A  +         + +K ++EG+EMT + 
Sbjct: 64  KDVENAHKFALDSFVKALLEVKDSLSMGIKTAQEEK--------ATVKHIVEGLEMTNKV 115

Query: 123 MMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
            +STLE++GV  I+ +D+ FNP +H+A+   P     +N++++VVQ G+ +N R++RPA+
Sbjct: 116 FLSTLEKFGVVMINPEDEAFNPELHEAVTMIPMPGKDSNSVLEVVQFGFTLNGRLVRPAM 175

Query: 183 VSIS 186
           V ++
Sbjct: 176 VVVA 179


>gi|254506755|ref|ZP_05118895.1| co-chaperone GrpE [Vibrio parahaemolyticus 16]
 gi|219550336|gb|EED27321.1| co-chaperone GrpE [Vibrio parahaemolyticus 16]
          Length = 206

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 61/168 (36%), Positives = 102/168 (60%), Gaps = 8/168 (4%)

Query: 20  NSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARD 79
           +   A+          S  + +E +D  LR  AE+EN+RRRT++E   A+ Y++ KFA +
Sbjct: 47  DEKDAKIAQLEAALLTSEAKVQEQQDSVLRAKAEVENMRRRTEQEIDKARKYALNKFAEE 106

Query: 80  MLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKD 139
           +L V DNL RA+ +A  D          V+K L+EG+E+T +  + T+ ++G+K+I+ + 
Sbjct: 107 LLPVIDNLERAIQAADTD--------AEVVKPLLEGVELTHKTFVDTVAKFGLKEINPEG 158

Query: 140 QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           + FNP +HQAM  +      +NT++ V+Q GY +N RV+RPA+V ++K
Sbjct: 159 EAFNPELHQAMSIQESPDHESNTVMFVMQKGYELNGRVVRPAMVMVAK 206


>gi|40255109|ref|NP_689620.2| grpE protein homolog 2, mitochondrial precursor [Homo sapiens]
 gi|22256760|sp|Q8TAA5|GRPE2_HUMAN RecName: Full=GrpE protein homolog 2, mitochondrial; AltName:
           Full=Mt-GrpE#2; Flags: Precursor
 gi|18676855|dbj|BAB85040.1| unnamed protein product [Homo sapiens]
 gi|47682981|gb|AAH70090.1| GrpE-like 2, mitochondrial (E. coli) [Homo sapiens]
 gi|71296786|gb|AAH36678.1| GrpE-like 2, mitochondrial (E. coli) [Homo sapiens]
 gi|119582190|gb|EAW61786.1| GrpE-like 2, mitochondrial (E. coli) [Homo sapiens]
 gi|312150910|gb|ADQ31967.1| GrpE-like 2, mitochondrial (E. coli) [synthetic construct]
          Length = 225

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 42/174 (24%), Positives = 88/174 (50%), Gaps = 3/174 (1%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
           ++P +       E++      +   + ++   +Y R IA+ EN+RRRT R  +DA+ + I
Sbjct: 47  EDPPDELGPPLAERALRVKAVKLEKEVQDLTVRYQRAIADCENIRRRTQRCVEDAKIFGI 106

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
             F +D++ V+D L +  +    +    ++K    L+ +  G+ +   ++ S   ++G++
Sbjct: 107 QSFCKDLVEVADILEKTTECISEESEPEDQKLT--LEKVFRGLLLLEAKLKSVFAKHGLE 164

Query: 134 KIDAKDQKFNPNMHQAMFEEPHD-TVPANTIIKVVQDGYAINERVLRPALVSIS 186
           K+     K++P+ H+ +   P    V   T+  V QDGY ++ R +R A V ++
Sbjct: 165 KLTPIGDKYDPHEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVA 218


>gi|237653703|ref|YP_002890017.1| heat shock protein GrpE [Thauera sp. MZ1T]
 gi|237624950|gb|ACR01640.1| GrpE protein [Thauera sp. MZ1T]
          Length = 207

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 57/185 (30%), Positives = 91/185 (49%), Gaps = 12/185 (6%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
           +         +   +      S      ++  ++ E  D +LR  AE ENLRRR   +  
Sbjct: 35  DLQAAAAAADTAPENGIDSMPSLEEALRQAELKAAEHHDAWLRAKAETENLRRRAQDDIA 94

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
            A  ++  KFA  ML V D+L  AL +               ++ + EG+E+T R+++S 
Sbjct: 95  KASKFAAEKFATAMLPVKDSLEAALAT-----------ENQTVEKMREGVELTLRQLISA 143

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
            E   + + +   QKF+PN HQA+          NT++ V+Q GY ++ERV+RPA+V +S
Sbjct: 144 FEGAKLAEENPLGQKFDPNKHQAISMVE-ADAEPNTVVTVLQKGYLLSERVIRPAMVMVS 202

Query: 187 KGKTQ 191
           KGK Q
Sbjct: 203 KGKAQ 207


>gi|257062868|ref|YP_003142540.1| molecular chaperone GrpE (heat shock protein) [Slackia
           heliotrinireducens DSM 20476]
 gi|256790521|gb|ACV21191.1| molecular chaperone GrpE (heat shock protein) [Slackia
           heliotrinireducens DSM 20476]
          Length = 243

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 46/185 (24%), Positives = 91/185 (49%), Gaps = 10/185 (5%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
            +   A +   EE   ++   ++   +   RD+YLR+ A+ +N R+RT  +  + +  + 
Sbjct: 69  ADAVEAEALEGEEVPTLDELAQAKADAAAMRDRYLRLQADWDNFRKRTAEQNAEMRQRAT 128

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
            +   D+L V D+  RA+  A  +              L++G++    ++   L ++G++
Sbjct: 129 ERLMEDVLPVLDDFERAIAHASQNGET----------GLLDGVKAISTKLNEVLAKHGLE 178

Query: 134 KIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNP 193
            I    + F+   HQA+   P D+VP  T+ +V Q GY +  +V+R A+V+I+ G  +  
Sbjct: 179 PIGEPGEPFDAIAHQAVATVPDDSVPDETVAQVYQKGYRMGGKVIRSAMVTITTGGPRRE 238

Query: 194 TEEKK 198
            E+ K
Sbjct: 239 AEDDK 243


>gi|269797942|ref|YP_003311842.1| GrpE protein [Veillonella parvula DSM 2008]
 gi|294791823|ref|ZP_06756971.1| co-chaperone GrpE [Veillonella sp. 6_1_27]
 gi|294793684|ref|ZP_06758821.1| co-chaperone GrpE [Veillonella sp. 3_1_44]
 gi|269094571|gb|ACZ24562.1| GrpE protein [Veillonella parvula DSM 2008]
 gi|294455254|gb|EFG23626.1| co-chaperone GrpE [Veillonella sp. 3_1_44]
 gi|294457053|gb|EFG25415.1| co-chaperone GrpE [Veillonella sp. 6_1_27]
          Length = 181

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 49/168 (29%), Positives = 87/168 (51%), Gaps = 10/168 (5%)

Query: 18  NANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFA 77
              +    E++  +  +       +F ++Y R+ A+ EN +RRT++EK+    Y      
Sbjct: 22  EEPTVEKTEEAVADAAQVLEELKADFDNRYKRLQADFENFKRRTNQEKEQLAGYVKGDVL 81

Query: 78  RDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDA 137
            D+L V DN  RA+ S           +E   K  ++G  M  + +M+ L ++G+  I+A
Sbjct: 82  TDLLPVLDNFERAVQS----------PAEGEAKVFLDGFIMIHQNLMAMLSKHGLAVIEA 131

Query: 138 KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
             Q F+PN HQA+   P D   ++T+ +V+Q GY ++ R +RPA+V +
Sbjct: 132 VGQPFDPNFHQAIMRVPSDEYESDTVCEVLQTGYTVDGRCIRPAMVKV 179


>gi|157962810|ref|YP_001502844.1| heat shock protein GrpE [Shewanella pealeana ATCC 700345]
 gi|226737178|sp|A8H6X2|GRPE_SHEPA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|157847810|gb|ABV88309.1| GrpE protein [Shewanella pealeana ATCC 700345]
          Length = 200

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 58/196 (29%), Positives = 110/196 (56%), Gaps = 16/196 (8%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEE--------KSEINIPEESLNQSEEFRDKYLRVIA 52
           +E  +  + +++    +   +S  +E        +      +E+  + +  +D  +R  A
Sbjct: 13  VEEIVEGELLNENATEATDEASLMDELTQANFRVEELEKALQEAEAKVDAQKDSVIRAAA 72

Query: 53  EMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSL 112
           E++N+RRR+  + + A  +++ KF  ++L V DN+ RAL     +            K++
Sbjct: 73  EVDNIRRRSAMDVEKAHKFALEKFINELLPVLDNMERALQGTDAE--------AEATKAI 124

Query: 113 IEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYA 172
            EG+E+T +  MST+E++G+ ++D +   FNP +HQA+  +P    PANT++ V+Q GY 
Sbjct: 125 YEGVELTAKSFMSTVEKFGLVQVDPQGDTFNPELHQAIGMQPSADFPANTVMMVMQKGYT 184

Query: 173 INERVLRPALVSISKG 188
           +NER+LRPA+V +S+G
Sbjct: 185 LNERLLRPAMVMVSQG 200


>gi|15803134|ref|NP_289166.1| heat shock protein GrpE [Escherichia coli O157:H7 EDL933]
 gi|15832730|ref|NP_311503.1| heat shock protein GrpE [Escherichia coli O157:H7 str. Sakai]
 gi|24113951|ref|NP_708461.1| heat shock protein GrpE [Shigella flexneri 2a str. 301]
 gi|26248977|ref|NP_755017.1| heat shock protein GrpE [Escherichia coli CFT073]
 gi|30064012|ref|NP_838183.1| heat shock protein GrpE [Shigella flexneri 2a str. 2457T]
 gi|74313203|ref|YP_311622.1| heat shock protein GrpE [Shigella sonnei Ss046]
 gi|82545157|ref|YP_409104.1| heat shock protein GrpE [Shigella boydii Sb227]
 gi|82777972|ref|YP_404321.1| heat shock protein GrpE [Shigella dysenteriae Sd197]
 gi|110642774|ref|YP_670504.1| heat shock protein GrpE [Escherichia coli 536]
 gi|157162089|ref|YP_001459407.1| heat shock protein GrpE [Escherichia coli HS]
 gi|170019110|ref|YP_001724064.1| heat shock protein GrpE [Escherichia coli ATCC 8739]
 gi|187733216|ref|YP_001881403.1| heat shock protein GrpE [Shigella boydii CDC 3083-94]
 gi|188492041|ref|ZP_02999311.1| co-chaperone GrpE [Escherichia coli 53638]
 gi|189404136|ref|ZP_03007340.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4501]
 gi|189405288|ref|ZP_03007748.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC869]
 gi|191171373|ref|ZP_03032922.1| co-chaperone GrpE [Escherichia coli F11]
 gi|193071253|ref|ZP_03052173.1| co-chaperone GrpE [Escherichia coli E110019]
 gi|209920088|ref|YP_002294172.1| heat shock protein GrpE [Escherichia coli SE11]
 gi|215487963|ref|YP_002330394.1| heat shock protein GrpE [Escherichia coli O127:H6 str. E2348/69]
 gi|217327690|ref|ZP_03443773.1| co-chaperone GrpE [Escherichia coli O157:H7 str. TW14588]
 gi|218555193|ref|YP_002388106.1| heat shock protein GrpE [Escherichia coli IAI1]
 gi|218696237|ref|YP_002403904.1| heat shock protein GrpE [Escherichia coli 55989]
 gi|218701125|ref|YP_002408754.1| heat shock protein GrpE [Escherichia coli IAI39]
 gi|218706114|ref|YP_002413633.1| heat shock protein GrpE [Escherichia coli UMN026]
 gi|227888179|ref|ZP_04005984.1| co-chaperone GrpE [Escherichia coli 83972]
 gi|253772493|ref|YP_003035324.1| heat shock protein GrpE [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254037690|ref|ZP_04871748.1| grpE [Escherichia sp. 1_1_43]
 gi|254162583|ref|YP_003045691.1| heat shock protein GrpE [Escherichia coli B str. REL606]
 gi|256019568|ref|ZP_05433433.1| heat shock protein GrpE [Shigella sp. D9]
 gi|256024860|ref|ZP_05438725.1| heat shock protein GrpE [Escherichia sp. 4_1_40B]
 gi|260856702|ref|YP_003230593.1| heat shock protein GrpE [Escherichia coli O26:H11 str. 11368]
 gi|260869294|ref|YP_003235696.1| heat shock protein GrpE [Escherichia coli O111:H- str. 11128]
 gi|261227496|ref|ZP_05941777.1| heat shock protein HSP70 cofactor [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261255690|ref|ZP_05948223.1| heat shock protein HSP70 cofactor [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291283885|ref|YP_003500703.1| heat shock protein GrpE [Escherichia coli O55:H7 str. CB9615]
 gi|293406120|ref|ZP_06650046.1| heat shock protein GrpE [Escherichia coli FVEC1412]
 gi|297518860|ref|ZP_06937246.1| heat shock protein HSP70 cofactor [Escherichia coli OP50]
 gi|298381854|ref|ZP_06991451.1| grpE [Escherichia coli FVEC1302]
 gi|300819914|ref|ZP_07100097.1| co-chaperone GrpE [Escherichia coli MS 107-1]
 gi|300825185|ref|ZP_07105275.1| co-chaperone GrpE [Escherichia coli MS 119-7]
 gi|300900200|ref|ZP_07118389.1| co-chaperone GrpE [Escherichia coli MS 198-1]
 gi|300905066|ref|ZP_07122876.1| co-chaperone GrpE [Escherichia coli MS 84-1]
 gi|300921159|ref|ZP_07137537.1| co-chaperone GrpE [Escherichia coli MS 115-1]
 gi|300930661|ref|ZP_07146048.1| co-chaperone GrpE [Escherichia coli MS 187-1]
 gi|300949008|ref|ZP_07163061.1| co-chaperone GrpE [Escherichia coli MS 116-1]
 gi|300957398|ref|ZP_07169612.1| co-chaperone GrpE [Escherichia coli MS 175-1]
 gi|300986817|ref|ZP_07177806.1| co-chaperone GrpE [Escherichia coli MS 45-1]
 gi|300990717|ref|ZP_07179302.1| co-chaperone GrpE [Escherichia coli MS 200-1]
 gi|301026396|ref|ZP_07189840.1| co-chaperone GrpE [Escherichia coli MS 69-1]
 gi|301050484|ref|ZP_07197362.1| co-chaperone GrpE [Escherichia coli MS 185-1]
 gi|301305742|ref|ZP_07211829.1| co-chaperone GrpE [Escherichia coli MS 124-1]
 gi|301644055|ref|ZP_07244071.1| co-chaperone GrpE [Escherichia coli MS 146-1]
 gi|306812469|ref|ZP_07446667.1| heat shock protein HSP70 cofactor [Escherichia coli NC101]
 gi|307139334|ref|ZP_07498690.1| heat shock protein HSP70 cofactor [Escherichia coli H736]
 gi|307315075|ref|ZP_07594659.1| GrpE protein [Escherichia coli W]
 gi|309784643|ref|ZP_07679278.1| protein grpE [Shigella dysenteriae 1617]
 gi|309794124|ref|ZP_07688548.1| co-chaperone GrpE [Escherichia coli MS 145-7]
 gi|312965544|ref|ZP_07779775.1| protein grpE [Escherichia coli 2362-75]
 gi|312973144|ref|ZP_07787317.1| protein grpE [Escherichia coli 1827-70]
 gi|331643329|ref|ZP_08344460.1| co-chaperone GrpE [Escherichia coli H736]
 gi|331648355|ref|ZP_08349443.1| co-chaperone GrpE [Escherichia coli M605]
 gi|331654070|ref|ZP_08355070.1| co-chaperone GrpE [Escherichia coli M718]
 gi|331658761|ref|ZP_08359703.1| co-chaperone GrpE [Escherichia coli TA206]
 gi|331664178|ref|ZP_08365087.1| co-chaperone GrpE [Escherichia coli TA143]
 gi|331669363|ref|ZP_08370209.1| co-chaperone GrpE [Escherichia coli TA271]
 gi|331674053|ref|ZP_08374815.1| co-chaperone GrpE [Escherichia coli TA280]
 gi|331678604|ref|ZP_08379278.1| co-chaperone GrpE [Escherichia coli H591]
 gi|332280692|ref|ZP_08393105.1| grpE [Shigella sp. D9]
 gi|52782896|sp|Q7ABI1|GRPE_ECO57 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|52782897|sp|Q7C0D0|GRPE_SHIFL RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|52782947|sp|Q8FEY9|GRPE_ECOL6 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|123048952|sp|Q0TEM6|GRPE_ECOL5 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|123755551|sp|Q31XD2|GRPE_SHIBS RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|123769568|sp|Q32CX5|GRPE_SHIDS RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|123773469|sp|Q3YYM5|GRPE_SHISS RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|167008732|sp|A8A3C0|GRPE_ECOHS RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|189041740|sp|B1IVM0|GRPE_ECOLC RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737128|sp|B7NSB2|GRPE_ECO7I RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737129|sp|B7M983|GRPE_ECO8A RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737131|sp|B7N6J9|GRPE_ECOLU RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737132|sp|B6I635|GRPE_ECOSE RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737184|sp|B2TYN5|GRPE_SHIB3 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|254799591|sp|B7UH62|GRPE_ECO27 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|254799592|sp|B7LDK2|GRPE_ECO55 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|12517038|gb|AAG57724.1|AE005491_4 phage lambda replication; host DNA synthesis; heat shock protein;
           protein repair [Escherichia coli O157:H7 str. EDL933]
 gi|26109383|gb|AAN81585.1|AE016764_267 GrpE protein [Escherichia coli CFT073]
 gi|13362947|dbj|BAB36899.1| heat shock protein GrpE [Escherichia coli O157:H7 str. Sakai]
 gi|24053058|gb|AAN44168.1| heat shock protein GrpE [Shigella flexneri 2a str. 301]
 gi|30042268|gb|AAP17993.1| heat shock protein GrpE [Shigella flexneri 2a str. 2457T]
 gi|73856680|gb|AAZ89387.1| heat shock protein [Shigella sonnei Ss046]
 gi|81242120|gb|ABB62830.1| GrpE [Shigella dysenteriae Sd197]
 gi|81246568|gb|ABB67276.1| GrpE [Shigella boydii Sb227]
 gi|110344366|gb|ABG70603.1| GrpE protein [Escherichia coli 536]
 gi|157067769|gb|ABV07024.1| co-chaperone GrpE [Escherichia coli HS]
 gi|169754038|gb|ACA76737.1| Ribulose-phosphate 3-epimerase [Escherichia coli ATCC 8739]
 gi|187430208|gb|ACD09482.1| co-chaperone GrpE [Shigella boydii CDC 3083-94]
 gi|188487240|gb|EDU62343.1| co-chaperone GrpE [Escherichia coli 53638]
 gi|189367278|gb|EDU85694.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4501]
 gi|189370861|gb|EDU89277.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC869]
 gi|190908307|gb|EDV67897.1| co-chaperone GrpE [Escherichia coli F11]
 gi|192955406|gb|EDV85889.1| co-chaperone GrpE [Escherichia coli E110019]
 gi|209762508|gb|ACI79566.1| heat shock protein GrpE [Escherichia coli]
 gi|209762510|gb|ACI79567.1| heat shock protein GrpE [Escherichia coli]
 gi|209762514|gb|ACI79569.1| heat shock protein GrpE [Escherichia coli]
 gi|209913347|dbj|BAG78421.1| heat shock protein [Escherichia coli SE11]
 gi|215266035|emb|CAS10450.1| heat shock protein [Escherichia coli O127:H6 str. E2348/69]
 gi|217320057|gb|EEC28482.1| co-chaperone GrpE [Escherichia coli O157:H7 str. TW14588]
 gi|218352969|emb|CAU98769.1| heat shock protein [Escherichia coli 55989]
 gi|218361961|emb|CAQ99562.1| heat shock protein [Escherichia coli IAI1]
 gi|218371111|emb|CAR18939.1| heat shock protein [Escherichia coli IAI39]
 gi|218433211|emb|CAR14109.1| heat shock protein [Escherichia coli UMN026]
 gi|222034315|emb|CAP77056.1| Protein grpE [Escherichia coli LF82]
 gi|226839314|gb|EEH71335.1| grpE [Escherichia sp. 1_1_43]
 gi|227834819|gb|EEJ45285.1| co-chaperone GrpE [Escherichia coli 83972]
 gi|242378208|emb|CAQ32983.1| phage lambda replication; host DNA synthesis; heat shock protein;
           protein repair, subunit of DnaJ/DnaK/GrpE [Escherichia
           coli BL21(DE3)]
 gi|253323537|gb|ACT28139.1| GrpE protein [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253974484|gb|ACT40155.1| heat shock protein [Escherichia coli B str. REL606]
 gi|253978651|gb|ACT44321.1| heat shock protein [Escherichia coli BL21(DE3)]
 gi|257755351|dbj|BAI26853.1| heat shock protein GrpE [Escherichia coli O26:H11 str. 11368]
 gi|257765650|dbj|BAI37145.1| heat shock protein GrpE [Escherichia coli O111:H- str. 11128]
 gi|281179659|dbj|BAI55989.1| heat shock protein [Escherichia coli SE15]
 gi|281602023|gb|ADA75007.1| Protein grpE [Shigella flexneri 2002017]
 gi|290763758|gb|ADD57719.1| heat shock protein GrpE [Escherichia coli O55:H7 str. CB9615]
 gi|291426126|gb|EFE99158.1| heat shock protein GrpE [Escherichia coli FVEC1412]
 gi|298276994|gb|EFI18510.1| grpE [Escherichia coli FVEC1302]
 gi|300297792|gb|EFJ54177.1| co-chaperone GrpE [Escherichia coli MS 185-1]
 gi|300305685|gb|EFJ60205.1| co-chaperone GrpE [Escherichia coli MS 200-1]
 gi|300315833|gb|EFJ65617.1| co-chaperone GrpE [Escherichia coli MS 175-1]
 gi|300356315|gb|EFJ72185.1| co-chaperone GrpE [Escherichia coli MS 198-1]
 gi|300395543|gb|EFJ79081.1| co-chaperone GrpE [Escherichia coli MS 69-1]
 gi|300403053|gb|EFJ86591.1| co-chaperone GrpE [Escherichia coli MS 84-1]
 gi|300407869|gb|EFJ91407.1| co-chaperone GrpE [Escherichia coli MS 45-1]
 gi|300411890|gb|EFJ95200.1| co-chaperone GrpE [Escherichia coli MS 115-1]
 gi|300451535|gb|EFK15155.1| co-chaperone GrpE [Escherichia coli MS 116-1]
 gi|300461481|gb|EFK24974.1| co-chaperone GrpE [Escherichia coli MS 187-1]
 gi|300522347|gb|EFK43416.1| co-chaperone GrpE [Escherichia coli MS 119-7]
 gi|300527502|gb|EFK48564.1| co-chaperone GrpE [Escherichia coli MS 107-1]
 gi|300838996|gb|EFK66756.1| co-chaperone GrpE [Escherichia coli MS 124-1]
 gi|301077600|gb|EFK92406.1| co-chaperone GrpE [Escherichia coli MS 146-1]
 gi|305854507|gb|EFM54945.1| heat shock protein HSP70 cofactor [Escherichia coli NC101]
 gi|306905504|gb|EFN36038.1| GrpE protein [Escherichia coli W]
 gi|307554626|gb|ADN47401.1| co-chaperone GrpE [Escherichia coli ABU 83972]
 gi|308122029|gb|EFO59291.1| co-chaperone GrpE [Escherichia coli MS 145-7]
 gi|308927540|gb|EFP73012.1| protein grpE [Shigella dysenteriae 1617]
 gi|309702993|emb|CBJ02324.1| heat shock protein (heat shock protein B25.3) [Escherichia coli
           ETEC H10407]
 gi|310333086|gb|EFQ00300.1| protein grpE [Escherichia coli 1827-70]
 gi|312289792|gb|EFR17681.1| protein grpE [Escherichia coli 2362-75]
 gi|312947185|gb|ADR28012.1| heat shock protein HSP70 cofactor [Escherichia coli O83:H1 str. NRG
           857C]
 gi|313648291|gb|EFS12735.1| protein grpE [Shigella flexneri 2a str. 2457T]
 gi|315061927|gb|ADT76254.1| heat shock protein [Escherichia coli W]
 gi|315253140|gb|EFU33108.1| co-chaperone GrpE [Escherichia coli MS 85-1]
 gi|315290946|gb|EFU50311.1| co-chaperone GrpE [Escherichia coli MS 153-1]
 gi|315615312|gb|EFU95947.1| protein grpE [Escherichia coli 3431]
 gi|320177030|gb|EFW52051.1| Heat shock protein GrpE [Shigella dysenteriae CDC 74-1112]
 gi|320182473|gb|EFW57367.1| Heat shock protein GrpE [Shigella boydii ATCC 9905]
 gi|320183094|gb|EFW57956.1| Heat shock protein GrpE [Shigella flexneri CDC 796-83]
 gi|320640795|gb|EFX10293.1| heat shock protein HSP70 cofactor [Escherichia coli O157:H7 str.
           G5101]
 gi|320646140|gb|EFX15085.1| heat shock protein HSP70 cofactor [Escherichia coli O157:H- str.
           493-89]
 gi|320651437|gb|EFX19838.1| heat shock protein HSP70 cofactor [Escherichia coli O157:H- str. H
           2687]
 gi|320657042|gb|EFX24865.1| heat shock protein HSP70 cofactor [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320662706|gb|EFX30050.1| heat shock protein HSP70 cofactor [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320667523|gb|EFX34447.1| heat shock protein HSP70 cofactor [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323156267|gb|EFZ42426.1| protein grpE [Escherichia coli EPECa14]
 gi|323167736|gb|EFZ53431.1| protein grpE [Shigella sonnei 53G]
 gi|323173070|gb|EFZ58701.1| protein grpE [Escherichia coli LT-68]
 gi|323177261|gb|EFZ62849.1| protein grpE [Escherichia coli 1180]
 gi|323188395|gb|EFZ73684.1| protein grpE [Escherichia coli RN587/1]
 gi|323377493|gb|ADX49761.1| GrpE protein [Escherichia coli KO11]
 gi|323935673|gb|EGB31990.1| GrpE protein [Escherichia coli E1520]
 gi|323941369|gb|EGB37553.1| GrpE protein [Escherichia coli E482]
 gi|323960529|gb|EGB56158.1| GrpE protein [Escherichia coli H489]
 gi|323963922|gb|EGB59415.1| GrpE protein [Escherichia coli M863]
 gi|323971444|gb|EGB66680.1| GrpE protein [Escherichia coli TA007]
 gi|324005811|gb|EGB75030.1| co-chaperone GrpE [Escherichia coli MS 57-2]
 gi|324012451|gb|EGB81670.1| co-chaperone GrpE [Escherichia coli MS 60-1]
 gi|324016601|gb|EGB85820.1| co-chaperone GrpE [Escherichia coli MS 117-3]
 gi|324120070|gb|EGC13946.1| GrpE protein [Escherichia coli E1167]
 gi|325496319|gb|EGC94178.1| heat shock protein HSP70 cofactor [Escherichia fergusonii ECD227]
 gi|331036800|gb|EGI09024.1| co-chaperone GrpE [Escherichia coli H736]
 gi|331042102|gb|EGI14244.1| co-chaperone GrpE [Escherichia coli M605]
 gi|331047452|gb|EGI19529.1| co-chaperone GrpE [Escherichia coli M718]
 gi|331053343|gb|EGI25372.1| co-chaperone GrpE [Escherichia coli TA206]
 gi|331058635|gb|EGI30613.1| co-chaperone GrpE [Escherichia coli TA143]
 gi|331063031|gb|EGI34944.1| co-chaperone GrpE [Escherichia coli TA271]
 gi|331068792|gb|EGI40185.1| co-chaperone GrpE [Escherichia coli TA280]
 gi|331073434|gb|EGI44755.1| co-chaperone GrpE [Escherichia coli H591]
 gi|332088121|gb|EGI93246.1| protein grpE [Shigella boydii 5216-82]
 gi|332089213|gb|EGI94320.1| protein grpE [Shigella dysenteriae 155-74]
 gi|332092119|gb|EGI97197.1| protein grpE [Shigella boydii 3594-74]
 gi|332103044|gb|EGJ06390.1| grpE [Shigella sp. D9]
 gi|332344482|gb|AEE57816.1| heat shock protein GrpE [Escherichia coli UMNK88]
 gi|332753359|gb|EGJ83739.1| protein grpE [Shigella flexneri 4343-70]
 gi|332755601|gb|EGJ85964.1| protein grpE [Shigella flexneri 2747-71]
 gi|332765591|gb|EGJ95804.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Shigella flexneri 2930-71]
 gi|332999388|gb|EGK18973.1| protein grpE [Shigella flexneri VA-6]
 gi|333000780|gb|EGK20354.1| protein grpE [Shigella flexneri K-218]
 gi|333000985|gb|EGK20555.1| protein grpE [Shigella flexneri K-272]
 gi|333015511|gb|EGK34850.1| protein grpE [Shigella flexneri K-227]
 gi|333015862|gb|EGK35198.1| protein grpE [Shigella flexneri K-304]
          Length = 197

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 57/190 (30%), Positives = 99/190 (52%), Gaps = 9/190 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR-DKYLRVIAEMENLRRR 60
           E  M +    +   P  +         +I   E  L +++    D  LRV AEMENLRRR
Sbjct: 16  EIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLRRR 75

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+ + + A  +++ KF  ++L V D+L RAL+ A              + +++EGIE+T 
Sbjct: 76  TELDIEKAHKFALEKFINELLPVIDSLDRALEVADKA--------NPDMSAMVEGIELTL 127

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + M+  + ++GV+ I   +   +PN+HQA+     D V    ++ ++Q GY +N R +R 
Sbjct: 128 KSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRA 187

Query: 181 ALVSISKGKT 190
           A+V+++K K 
Sbjct: 188 AMVTVAKAKA 197


>gi|149726744|ref|XP_001503832.1| PREDICTED: similar to GrpE protein homolog 2, mitochondrial
           precursor (Mt-GrpE#2) [Equus caballus]
          Length = 225

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 41/174 (23%), Positives = 89/174 (51%), Gaps = 3/174 (1%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
           ++P +    +  E++      +   + ++   +Y R +A+ EN+RRRT R  +DA+ + I
Sbjct: 47  EDPPDGLGPSLAERALKLKAVKLEKEVQDLTVRYQRAVADGENIRRRTQRCVEDAKIFGI 106

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
             F +D++ V+D L +  +    +    ++K    L+ +  G+ +   ++ S   ++G++
Sbjct: 107 QSFCKDLVEVADILEKTTECISEETEPGDQKLT--LEKIFRGLALLEAKLKSVFAKHGLE 164

Query: 134 KIDAKDQKFNPNMHQAMFEEPHD-TVPANTIIKVVQDGYAINERVLRPALVSIS 186
           K+     K++P+ H+ +   P    V   T+  V QDGY ++ R +R A V ++
Sbjct: 165 KMTPIGDKYDPHEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLAQVEVA 218


>gi|109079280|ref|XP_001105579.1| PREDICTED: grpE protein homolog 2, mitochondrial [Macaca mulatta]
          Length = 225

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 41/174 (23%), Positives = 88/174 (50%), Gaps = 3/174 (1%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
           ++P +    +  E++      +   + ++   +Y R +A+ EN+RRRT R  +DA+ + I
Sbjct: 47  EDPPDELGPSLTERALRVKAIKLEKEVQDLTLRYQRAVADCENIRRRTQRCVEDAKIFGI 106

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
             F +D++ V+D L +  +    +     +K    L+ +  G+ +   ++ S   ++G++
Sbjct: 107 QSFCKDLVEVADILEKTTECISEESEPENQKLT--LEKVFRGLLLLEAKLKSVFAKHGLE 164

Query: 134 KIDAKDQKFNPNMHQAMFEEPHD-TVPANTIIKVVQDGYAINERVLRPALVSIS 186
           K+     K++P+ H+ +   P    V   T+  V QDGY ++ R +R A V ++
Sbjct: 165 KLTPIGDKYDPHEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVA 218


>gi|78189386|ref|YP_379724.1| molecular chaperone GrpE (heat shock protein)-like [Chlorobium
           chlorochromatii CaD3]
 gi|78171585|gb|ABB28681.1| Molecular chaperone GrpE (heat shock protein)-like protein
           [Chlorobium chlorochromatii CaD3]
          Length = 215

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 47/161 (29%), Positives = 82/161 (50%), Gaps = 5/161 (3%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
                  E+   Q  +FR++ LR  A+ EN RR+ +RE     S +     RD+L + D+
Sbjct: 60  AELEAELEQQKEQVAKFREEVLRKAADFENFRRQKEREITLTASRAFENVIRDLLPLVDD 119

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNM 146
           + R L  AP +   ++          IEG+EM ++ +   L   GV  I++K  K + N 
Sbjct: 120 IRRLLHHAPPEGEAAQIARP-----YIEGVEMVQKNLEKWLNEKGVVPIESKGMKLDVNF 174

Query: 147 HQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           H+A+ +  H    A+T+I+  Q GY + ++V+R A V +++
Sbjct: 175 HEAISQMEHPDAEADTVIEEYQTGYLLGDKVIRHAKVIVAR 215


>gi|170681212|ref|YP_001744797.1| heat shock protein GrpE [Escherichia coli SMS-3-5]
 gi|226737133|sp|B1LPC1|GRPE_ECOSM RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|170518930|gb|ACB17108.1| co-chaperone GrpE [Escherichia coli SMS-3-5]
          Length = 196

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 57/189 (30%), Positives = 99/189 (52%), Gaps = 9/189 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR-DKYLRVIAEMENLRRR 60
           E  M +    +   P  +         +I   E  L +++    D  LRV AEMENLRRR
Sbjct: 16  EIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLRRR 75

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+ + + A  +++ KF  ++L V D+L RAL+ A              + +++EGIE+T 
Sbjct: 76  TELDIEKAHKFALEKFINELLPVIDSLDRALEVADKA--------NPDMSAMVEGIELTL 127

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + M+  + ++GV+ I   +   +PN+HQA+     D V    ++ ++Q GY +N R +R 
Sbjct: 128 KSMLDVVRKFGVEVISETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRA 187

Query: 181 ALVSISKGK 189
           A+V+++K K
Sbjct: 188 AMVTVAKAK 196


>gi|315500956|ref|YP_004079843.1| grpe protein [Micromonospora sp. L5]
 gi|315407575|gb|ADU05692.1| GrpE protein [Micromonospora sp. L5]
          Length = 245

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 40/175 (22%), Positives = 70/175 (40%), Gaps = 16/175 (9%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
            +P+  N  T          E      EE      RV AE  N R+R DR++   Q  + 
Sbjct: 86  DSPAEPNGGTGTGAPLGAELESLRTDLEERTRDLQRVTAEYANYRKRVDRDRNLVQEQAT 145

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
                 +L + D+L RA +                   L+        ++   L ++G+ 
Sbjct: 146 GAVLTALLPILDDLDRAREHGD----------------LVGPFGSVAEQLTGALAKFGLT 189

Query: 134 KIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
                   F+P  H+A+  +    V   T ++V++ GY + ER+LRPA+V+++  
Sbjct: 190 AFGETGDPFDPTRHEAVAHQTSADVTEPTCVQVMRRGYQLGERLLRPAMVAVADP 244


>gi|29833780|ref|NP_828414.1| GrpE homologue [Streptomyces avermitilis MA-4680]
 gi|52782924|sp|Q826F5|GRPE2_STRAW RecName: Full=Protein grpE 2; AltName: Full=HSP-70 cofactor 2
 gi|29610904|dbj|BAC74949.1| putative GrpE homologue [Streptomyces avermitilis MA-4680]
          Length = 203

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 44/172 (25%), Positives = 78/172 (45%), Gaps = 11/172 (6%)

Query: 16  PSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAK 75
            +       +        +E     +E  D++ R +A+++NLR+R  RE +  ++   ++
Sbjct: 41  EATNGEPGPDAAGPAPAEDEYTTAIQELEDRWRRTLADLDNLRKRHARELERERAVERSR 100

Query: 76  FARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI 135
            A   L V DNL  AL  A  D             +++EGI   R + ++ LE  G  + 
Sbjct: 101 TAAAFLPVLDNLELALTHAGADPG-----------AIVEGIRAVRDQAVNVLELLGYPRH 149

Query: 136 DAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
                 F+P  H+ +        P  T+++V++ GY   ER LRPA V+++K
Sbjct: 150 AETGVAFDPARHEVVGVVQDPDAPPGTVVEVLRPGYGDGERQLRPAAVTVTK 201


>gi|332162707|ref|YP_004299284.1| heat shock protein GrpE [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|318606815|emb|CBY28313.1| heat shock protein GrpE [Yersinia enterocolitica subsp. palearctica
           Y11]
 gi|325666937|gb|ADZ43581.1| heat shock protein GrpE [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|330859471|emb|CBX69815.1| protein grpE [Yersinia enterocolitica W22703]
          Length = 192

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 58/190 (30%), Positives = 101/190 (53%), Gaps = 9/190 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPE-ESLNQSEEFRDKYLRVIAEMENLRRR 60
           E    E     E+       +       +   E + +   +  R+  LR  AE+EN+RRR
Sbjct: 11  EQVSEEMENAAEQQVEATQETGEGVDPRVAELEAQLVAAVQRERESLLRAKAEVENIRRR 70

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+++ + A  +++ KF+ ++L V DNL RALD+A            + L ++IEG+E+T 
Sbjct: 71  TEQDVEKAHKFALEKFSAELLPVIDNLERALDTADKT--------NAELTAMIEGVELTL 122

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + ++  + +YG++ +   +  FNP +HQAM          N ++ V+Q GY +N R+LRP
Sbjct: 123 KSLLDAVGKYGIQVVSETNVPFNPEVHQAMTMLESADHEPNHVMMVMQKGYTLNGRLLRP 182

Query: 181 ALVSISKGKT 190
           A+V++SK K 
Sbjct: 183 AMVAVSKAKA 192


>gi|85059776|ref|YP_455478.1| heat shock protein GrpE [Sodalis glossinidius str. 'morsitans']
 gi|123766410|sp|Q2NS02|GRPE_SODGM RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|84780296|dbj|BAE75073.1| heat shock protein GrpE [Sodalis glossinidius str. 'morsitans']
          Length = 195

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 58/193 (30%), Positives = 99/193 (51%), Gaps = 12/193 (6%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR----DKYLRVIAEMENL 57
           E    E  +++ +    A  +            E      + +    D  LR  AEMEN+
Sbjct: 11  EQVSQESEMEQGQQAEAAPETVDVVDPRDERIAELEAALSQAQQREHDSVLRAKAEMENV 70

Query: 58  RRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIE 117
           RRR++++ + A  +++ +FA ++L V DNL RALD +            + L S IEGIE
Sbjct: 71  RRRSEQDVEKAHKFALERFAGELLPVIDNLERALDMSDKA--------NAELASTIEGIE 122

Query: 118 MTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERV 177
           +T + ++  + ++G+  +      FNP +HQAM     D    N ++ V+Q GY +N R+
Sbjct: 123 LTLKSLLDAVRKFGLDVVGDTHVPFNPEVHQAMTMLESDEHEPNQVMMVMQKGYTLNGRL 182

Query: 178 LRPALVSISKGKT 190
           +RPA+V++SK K+
Sbjct: 183 IRPAMVAVSKAKS 195


>gi|197119868|ref|YP_002140295.1| heat shock protein GrpE [Geobacter bemidjiensis Bem]
 gi|226737137|sp|B5EC43|GRPE_GEOBB RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|197089228|gb|ACH40499.1| DnaJ adenine nucleotide exchange factor GrpE [Geobacter
           bemidjiensis Bem]
          Length = 188

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 55/188 (29%), Positives = 92/188 (48%), Gaps = 16/188 (8%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLN---QSEEFRDKYLRVIAEMENLRRRTDR 63
           EK  D  +         ++      + E       +S    DKYLR  A++EN R+R  +
Sbjct: 12  EKKADASQEKVEVAQPLSDADRIKELEEALAAKGLESAANWDKYLRERADLENYRKRVQK 71

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           EK++   Y   +   ++L   DNL RA+D A  +             +++EG+ +T   +
Sbjct: 72  EKEEILKYGKEEVIMEILPALDNLERAIDHANEES------------AIVEGVRLTLSML 119

Query: 124 MSTLERYGVKKID-AKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           +S L+++GV  ++  +   FNP  HQAM +        NTI+ V Q GY +NER+LRPA+
Sbjct: 120 LSALKKFGVTPVETPQGTPFNPEFHQAMGQVESADQEPNTIVAVFQKGYLLNERLLRPAM 179

Query: 183 VSISKGKT 190
           V+++    
Sbjct: 180 VTVAVKPA 187


>gi|322418115|ref|YP_004197338.1| GrpE protein [Geobacter sp. M18]
 gi|320124502|gb|ADW12062.1| GrpE protein [Geobacter sp. M18]
          Length = 189

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 55/189 (29%), Positives = 94/189 (49%), Gaps = 17/189 (8%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLN----QSEEFRDKYLRVIAEMENLRRRTD 62
           EK  +         +    +   I   EE+L     +S    DKYLR  A++EN R+R  
Sbjct: 12  EKKGEAAPKDKVELAQPLSDADRIKELEEALAAKGLESAGNWDKYLRERADLENYRKRVQ 71

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
           +EK++   Y   +   ++L   D+L RA+D A  +              ++EG+++T   
Sbjct: 72  KEKEEILKYGNEQILLELLPSLDSLERAIDHASEE------------DPIVEGVKLTLTM 119

Query: 123 MMSTLERYGVKKID-AKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           ++STL+R+GV  ++      F+P  HQAM +        NT++ V Q GY +N+R+LRPA
Sbjct: 120 LLSTLKRFGVAPLETPPGTPFDPAFHQAMTQVESADQEPNTVVTVFQKGYLLNDRLLRPA 179

Query: 182 LVSISKGKT 190
           +V+++    
Sbjct: 180 MVTVAVKPA 188


>gi|226226529|ref|YP_002760635.1| GrpE protein [Gemmatimonas aurantiaca T-27]
 gi|226089720|dbj|BAH38165.1| GrpE protein [Gemmatimonas aurantiaca T-27]
          Length = 188

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 47/156 (30%), Positives = 82/156 (52%), Gaps = 10/156 (6%)

Query: 31  NIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRA 90
           +  ++   + +E RDKYLR+ AE EN RRR  +E+++A   S     R +L   D+L+R 
Sbjct: 36  DTADDRQRELDESRDKYLRLAAEFENFRRRAVKERQEAGWRSQGDLVRGILDALDDLNRF 95

Query: 91  LDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAM 150
            +  P  + +         K+++EG+ +  ++++ +L  +G + ID     FNP +H+A+
Sbjct: 96  ANVDPATVDS---------KAVVEGVSLVEKKILKSLAGHGFEVIDPTGHPFNPTLHEAV 146

Query: 151 FEEPHDTVPANT-IIKVVQDGYAINERVLRPALVSI 185
              P  +   +  +    Q GY IN  VLRPA V +
Sbjct: 147 TTTPAASAEEDDLVAACFQAGYVINGLVLRPARVVV 182


>gi|257783905|ref|YP_003179122.1| GrpE protein [Atopobium parvulum DSM 20469]
 gi|257472412|gb|ACV50531.1| GrpE protein [Atopobium parvulum DSM 20469]
          Length = 282

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 47/182 (25%), Positives = 91/182 (50%), Gaps = 7/182 (3%)

Query: 17  SNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKF 76
              +    E  S  +  E +  Q+ E  D++LR+ A+ +N RRRT +E+ D +  +  K 
Sbjct: 85  QERDCLQNELNSVSDQIESAKQQAAEANDRFLRLQADWDNYRRRTAQERLDERQRATEKL 144

Query: 77  ARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID 136
             D+L V D+L RA++ A          ++   K  +EG++   ++++  L + GV+ ++
Sbjct: 145 VVDLLPVIDDLERAIEHADN-------LTDPAAKQFVEGVDAICKKLVGVLNKEGVEVVN 197

Query: 137 AKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEE 196
              + F+P  HQA+ +         T+ +V Q GY +  + +R A+V ++ G  + P E 
Sbjct: 198 PVGEAFDPLSHQAVSQIEDTEAYDETVAQVYQKGYRMGGKDIRTAMVVVTHGGPKRPAEA 257

Query: 197 KK 198
           + 
Sbjct: 258 EA 259


>gi|164657989|ref|XP_001730120.1| hypothetical protein MGL_2502 [Malassezia globosa CBS 7966]
 gi|159104015|gb|EDP42906.1| hypothetical protein MGL_2502 [Malassezia globosa CBS 7966]
          Length = 230

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 52/187 (27%), Positives = 95/187 (50%), Gaps = 3/187 (1%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTA-EEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           E   ++ +        +A S TA EE +     +E   + ++  D  L   AE++N +RR
Sbjct: 39  EQKKTDNDNGAVPEKESAQSETAPEEDATTKQLKEKDARIKDLADDLLYCKAELQNFQRR 98

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSES--VLKSLIEGIEM 118
           T  EKK    ++I++ A+D+    D L  AL S P  L  S +  E    L  L +G+ +
Sbjct: 99  TAEEKKTMGDHAISRLAKDLTESIDVLDLALRSVPESLRKSSQTDEPSRALAELYDGVSL 158

Query: 119 TRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVL 178
           TR+ ++  L  +G++  +   +KF+P +H+A+++ P  +    +++   + GY I  R+L
Sbjct: 159 TRKSILDMLRTHGIEAFNPIGEKFDPLLHEALYQAPVPSKQPGSVLDCNKIGYMIKGRLL 218

Query: 179 RPALVSI 185
           R A V +
Sbjct: 219 RAAQVGV 225


>gi|160900662|ref|YP_001566244.1| heat shock protein GrpE [Delftia acidovorans SPH-1]
 gi|226737124|sp|A9BNG4|GRPE_DELAS RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|160366246|gb|ABX37859.1| GrpE protein [Delftia acidovorans SPH-1]
          Length = 181

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 61/192 (31%), Positives = 97/192 (50%), Gaps = 20/192 (10%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR-------DKYLRVIAEMENL 57
           MSE+N +  ++ +      A   +  +  +    +  E +       D++LR  AE EN+
Sbjct: 1   MSEQNSNPLQDAAPEEIEAAMAANAADELQRLQTELAELKAKSAELADQFLRAKAEAENV 60

Query: 58  RRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIE 117
           RRR + E   A+ + I  FA  +L V D+L  AL                  + L EG +
Sbjct: 61  RRRAEDEVSKARKFGIESFAESLLPVCDSLDAALAIQQATP-----------EQLREGAD 109

Query: 118 MTRREMMSTLERYGVKKIDA-KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINER 176
            T R++ S LER  V  I+    +KF+PN+HQA+   P     ANT++ V+Q GY I +R
Sbjct: 110 ATLRQLTSALERNKVVTINPAAGEKFDPNLHQAISMVP-AQQEANTVVSVLQKGYLIADR 168

Query: 177 VLRPALVSISKG 188
           +LRPALV++++ 
Sbjct: 169 ILRPALVTVAQP 180


>gi|238793786|ref|ZP_04637407.1| hypothetical protein yinte0001_6880 [Yersinia intermedia ATCC
           29909]
 gi|238726850|gb|EEQ18383.1| hypothetical protein yinte0001_6880 [Yersinia intermedia ATCC
           29909]
          Length = 192

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 56/190 (29%), Positives = 103/190 (54%), Gaps = 9/190 (4%)

Query: 2   ETFMSE-KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           E    E +N  +++  +   +    +     +  +     +  R+  LR  AE+EN+RRR
Sbjct: 11  EQVSEEMENAAEQQVEATQETGEGVDPRVAELEAQLAAAVQRERESLLRAKAEVENIRRR 70

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+ + + A  +++ +F+ ++L V DNL RALD+A            + L S+IEG+E+T 
Sbjct: 71  TELDVEKAHKFALERFSSELLPVIDNLERALDTADKT--------NAELTSMIEGVELTL 122

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + ++  + ++G++ +      FNP++HQAM          N ++ V+Q GY +N R+LRP
Sbjct: 123 KSLLDAVGKFGIEVVADTHVPFNPDVHQAMTMLESADHEPNHVMMVMQKGYTLNGRLLRP 182

Query: 181 ALVSISKGKT 190
           A+V++SK K 
Sbjct: 183 AMVAVSKAKA 192


>gi|115496918|ref|NP_001069142.1| grpE protein homolog 2, mitochondrial precursor [Bos taurus]
 gi|122143252|sp|Q0P5N5|GRPE2_BOVIN RecName: Full=GrpE protein homolog 2, mitochondrial; AltName:
           Full=Mt-GrpE#2; Flags: Precursor
 gi|112361983|gb|AAI19819.1| GrpE-like 2, mitochondrial (E. coli) [Bos taurus]
 gi|296485166|gb|DAA27281.1| grpE protein homolog 2, mitochondrial precursor [Bos taurus]
          Length = 224

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 41/176 (23%), Positives = 90/176 (51%), Gaps = 3/176 (1%)

Query: 12  KEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
             ++P +    +  E++      +   + ++   +Y R +A+ EN+RRRT R  +DA+ +
Sbjct: 44  NSEDPPDELGPSLAERALKLKAVKLEKEVQDLTVRYQRAVADSENIRRRTQRCVEDAKIF 103

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
            I  F +D++ V+D L +  +    +   +++K    L+ +  G+ +   ++ S   ++G
Sbjct: 104 GIQSFCKDLVEVADILEKTTECISEETEPADQKLT--LEKIFRGLSLLEAKLKSVFAKHG 161

Query: 132 VKKIDAKDQKFNPNMHQAMFEEPHD-TVPANTIIKVVQDGYAINERVLRPALVSIS 186
           ++K+     K++P+ H+ +   P    V   T+  V QDGY ++ R +R A V ++
Sbjct: 162 LEKMTPIGDKYDPHEHELICHVPAGVGVQPGTVAFVRQDGYKLHGRTIRLAQVEVA 217


>gi|255321426|ref|ZP_05362586.1| co-chaperone GrpE [Campylobacter showae RM3277]
 gi|255301579|gb|EET80836.1| co-chaperone GrpE [Campylobacter showae RM3277]
          Length = 175

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 60/184 (32%), Positives = 96/184 (52%), Gaps = 9/184 (4%)

Query: 4   FMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDR 63
               +N++ E+   +    +   +       E   Q EE  DKY R  A+ EN+++R ++
Sbjct: 1   MNENENVELEQQIPSNFDESISFEGLDAKYVELQKQLEELTDKYYRANADFENIKKRFEK 60

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           EK D  +Y+  KFARD+L V D L  A++         E + +     + EGI +T  + 
Sbjct: 61  EKADIATYANEKFARDLLPVIDALEMAVNF--------ETEGDEYAAKIKEGIYITIDQF 112

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
               E+ G+  I+  ++ F+PN H AM +   + V    I++V+Q GY IN RVLRPA+V
Sbjct: 113 KKCFEKNGITAIE-ANEDFDPNFHNAMLQVESEDVEKGKIVQVIQKGYLINGRVLRPAMV 171

Query: 184 SISK 187
           SI+K
Sbjct: 172 SIAK 175


>gi|262395062|ref|YP_003286916.1| heat shock protein GrpE [Vibrio sp. Ex25]
 gi|262338656|gb|ACY52451.1| heat shock protein GrpE [Vibrio sp. Ex25]
          Length = 198

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 56/168 (33%), Positives = 98/168 (58%), Gaps = 8/168 (4%)

Query: 20  NSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARD 79
           + + A+          S  + +E +D  LR  AE+EN+RRRT++E   A+ +++ KFA +
Sbjct: 39  DETDAKIAQLEAALLSSEAKVKEQQDAVLRSKAEVENMRRRTEQEIDKARKFALNKFAEE 98

Query: 80  MLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKD 139
           +L V DNL RA+ +A  +           +K  +EG+E+T +  +  + ++G+K I+ + 
Sbjct: 99  LLPVIDNLERAIQAADTE--------NETVKPFLEGVELTHKTFVDVVAKFGLKAINPEG 150

Query: 140 QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           + FNP  HQAM  +      +NT++ V+Q GY +N RV+RPA+V ++K
Sbjct: 151 EAFNPEFHQAMSIQESPDHESNTVMFVMQKGYELNGRVIRPAMVMVAK 198


>gi|171464078|ref|YP_001798191.1| GrpE protein [Polynucleobacter necessarius subsp. necessarius
           STIR1]
 gi|226737154|sp|B1XRU2|GRPE_POLNS RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|171193616|gb|ACB44577.1| GrpE protein [Polynucleobacter necessarius subsp. necessarius
           STIR1]
          Length = 182

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 59/194 (30%), Positives = 100/194 (51%), Gaps = 21/194 (10%)

Query: 5   MSEKNIDKEKNPSNANSSTAEE--------KSEINIPEESLNQSEEFRDKYLRVIAEMEN 56
           M+++N        N  +  A E        K+      E   +  E +D +LR  AE EN
Sbjct: 1   MTQENQTPPPEQENLAADPAVETTAETPAVKTPEQEVAELNQKIGELQDNFLRAKAEGEN 60

Query: 57  LRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGI 116
           +RRR   +   A  ++I  FA  ++ V+D+L  AL++   D            K+  EG+
Sbjct: 61  IRRRAVEDIAKAHKFAIESFAEHLVPVTDSLYAALNTDAGDA-----------KAFKEGL 109

Query: 117 EMTRREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINE 175
           E+T ++++S  E+  + +I+     KF+P+ HQA+   P +   +NT++ V+Q GY + +
Sbjct: 110 EITLKQLLSAFEKGRMTEINPAVGDKFDPHHHQAIASVPSEQ-ESNTVVSVLQRGYTVAD 168

Query: 176 RVLRPALVSISKGK 189
           RVLRPALV++S  K
Sbjct: 169 RVLRPALVTVSAPK 182


>gi|56478152|ref|YP_159741.1| heat shock protein GrpE [Aromatoleum aromaticum EbN1]
 gi|81677383|sp|Q5P1H4|GRPE_AZOSE RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|56314195|emb|CAI08840.1| putative GrpE protein (HSP-70 cofactor) [Aromatoleum aromaticum
           EbN1]
          Length = 192

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 56/183 (30%), Positives = 90/183 (49%), Gaps = 12/183 (6%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +++  +     A   T           +   ++ E  D +LR  AE EN+RRR   +   
Sbjct: 21  ESVPPQPTNEQAPPDTDTMPRIEETLRQLELKAAEHHDAWLRARAETENVRRRAQEDIAK 80

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A  ++  KFA  ML V D+L  AL                 L+SL EG+E+T +++ +  
Sbjct: 81  ASKFAAEKFAAAMLPVKDSLEAALTIEK-----------QTLESLREGVELTLKQLNAAF 129

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +  G+ + D   QKF+PN HQA+     +    NT++ V+Q GY ++ RV+RPA+V +SK
Sbjct: 130 QNGGLTEEDPAGQKFDPNKHQAISAIEAEG-EPNTVLNVLQKGYLLHGRVIRPAMVMVSK 188

Query: 188 GKT 190
            K 
Sbjct: 189 AKG 191


>gi|52782985|sp|Q9LCQ6|GRPE_BRECH RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|6855460|dbj|BAA90472.1| GrpE [Brevibacillus choshinensis]
          Length = 179

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 51/184 (27%), Positives = 98/184 (53%), Gaps = 9/184 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E  +++    +E+    A+   + + +          Q+EE +++ LR +A+MENLRRR 
Sbjct: 3   EEKLTQDPTAEEEQTETADQQESADVNWEQEAAHWKAQAEEHQNRMLRTMADMENLRRRV 62

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
            +E++D   Y+  K   ++L + DN  RAL +               ++SL+ G++M  R
Sbjct: 63  RKEQEDLAKYASQKVVEELLPILDNFERALAADKE---------SMTVESLLTGVDMVYR 113

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           +M+   ++ G+  I AK Q F+P++HQA+ +       +  +++ +Q GY   +RV+RPA
Sbjct: 114 QMVQVFDKEGLVAIAAKGQPFDPHVHQAVMQTQDPAFESGVVVEELQKGYMFKDRVVRPA 173

Query: 182 LVSI 185
           +V +
Sbjct: 174 MVKV 177


>gi|186477248|ref|YP_001858718.1| heat shock protein GrpE [Burkholderia phymatum STM815]
 gi|226737116|sp|B2JGE4|GRPE_BURP8 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|184193707|gb|ACC71672.1| GrpE protein [Burkholderia phymatum STM815]
          Length = 202

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 54/185 (29%), Positives = 91/185 (49%), Gaps = 12/185 (6%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
             +    +    +    + A+         E+  +  E ++ +LR  AE EN+RRR   +
Sbjct: 30  EPQDQARQPAAAAGEQPAQAQPAGAEAALAEAQAKLAELQESFLRAKAETENVRRRGQED 89

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
              A  ++I  FA  +L V D+L  A+  +  D           L  + EG+E+T R++ 
Sbjct: 90  VAKAHKFAIESFAEHLLPVMDSLEAAVAHSTDD-----------LAKVREGVELTLRQLT 138

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
             LE+  V  ++   +KF+P+ HQA+   P      NT++ V+Q GY I +RVLRPALV+
Sbjct: 139 GALEKGKVVALNPVGEKFDPHRHQAISMVP-ADQEPNTVVAVLQKGYVIADRVLRPALVT 197

Query: 185 ISKGK 189
           ++  K
Sbjct: 198 VAAPK 202


>gi|254384539|ref|ZP_04999879.1| grpE 1 [Streptomyces sp. Mg1]
 gi|194343424|gb|EDX24390.1| grpE 1 [Streptomyces sp. Mg1]
          Length = 228

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 47/212 (22%), Positives = 92/212 (43%), Gaps = 16/212 (7%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
            SE+        S A   T  E + +   +++     E      R+ AE +N RRR +R+
Sbjct: 32  SSEEEAAAPAGDSAAAQDTGREAALLAQLDQARTALGERTADLQRLQAEYQNYRRRVERD 91

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
           +   Q  ++AK   ++L   D++ RA D                   L+ G +     + 
Sbjct: 92  RIAVQEVAVAKLLTELLPTLDDIGRARDHGE----------------LVGGFKSVAESLE 135

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
           +   + G+++   + + F+P +H+A+       V  +T + ++Q GY I ER +RPA V+
Sbjct: 136 TAAAKMGLQQFGKEGEPFDPTIHEALMHSYAPDVTEDTCVAILQPGYRIGERTIRPARVA 195

Query: 185 ISKGKTQNPTEEKKETIEQPSPLDIEERNKTQ 216
           +++ +       K E+ E  +P D +     +
Sbjct: 196 VAEPQPGAAPAAKSESSEGEAPSDKDTDAPEK 227


>gi|298249054|ref|ZP_06972858.1| GrpE protein [Ktedonobacter racemifer DSM 44963]
 gi|297547058|gb|EFH80925.1| GrpE protein [Ktedonobacter racemifer DSM 44963]
          Length = 218

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 50/189 (26%), Positives = 93/189 (49%), Gaps = 9/189 (4%)

Query: 19  ANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFAR 78
             ++  +   +    +E   ++EE+ D+  R  AE  N RRR  +E+ + +  + +    
Sbjct: 35  EATTAIQSVPQDEAVKEEHRKAEEYLDQLRRTQAEFVNYRRRMGKEQLEGRITAQSSLLY 94

Query: 79  DMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
            +L V D+L  AL SAP ++            + ++G+ +  R + S L++ GV+++ A 
Sbjct: 95  HLLPVLDDLELALRSAPAEMCP---------HAWVQGLFLVARRLESMLDQLGVQRVGAI 145

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKK 198
            ++FNP  H+A+  E     P   I+ V+Q GY I + V+RPA VS++    Q  T   +
Sbjct: 146 GEQFNPRWHEAVTTEARADAPEGAILDVLQQGYIIEDHVIRPARVSVAGASPQRETPTAQ 205

Query: 199 ETIEQPSPL 207
           E  +  +  
Sbjct: 206 EKTDPNNKQ 214


>gi|37958838|gb|AAP51102.1| putative HSP24 [uncultured bacterium]
          Length = 180

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 65/188 (34%), Positives = 98/188 (52%), Gaps = 11/188 (5%)

Query: 5   MSEKNIDKEKNPSNANSSTAE--EKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTD 62
           MS+   + +         T E  E S      E   +  E  D YLR  AE EN RRR D
Sbjct: 1   MSDTPANADNLDPVEPPVTIEPLEASLEQQLAELSAKHTEVSDAYLRAKAEAENTRRRAD 60

Query: 63  REKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRRE 122
            E   A+ +++  FA  +L V D       S    LA    K ++ +++++EG++ T R+
Sbjct: 61  EEISKARKFAVESFADSLLPVKD-------SLEAALAAQLAKPDTPVETVLEGVQATLRQ 113

Query: 123 MMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           + + LER  V +I+     KF+P+ HQA+   P     ANT++ V+Q GY IN+RVLRPA
Sbjct: 114 LGAALERNKVLEINPAAGTKFDPHQHQAISMVP-ADQEANTVVGVLQKGYLINDRVLRPA 172

Query: 182 LVSISKGK 189
           LV+++  K
Sbjct: 173 LVTVAAPK 180


>gi|169608896|ref|XP_001797867.1| hypothetical protein SNOG_07532 [Phaeosphaeria nodorum SN15]
 gi|111063878|gb|EAT84998.1| hypothetical protein SNOG_07532 [Phaeosphaeria nodorum SN15]
          Length = 226

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 56/163 (34%), Positives = 91/163 (55%), Gaps = 3/163 (1%)

Query: 20  NSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARD 79
             +  E        E+   +  E +DKYLR +A+  NL+ RT RE + A+ ++I +FARD
Sbjct: 59  TPANDEASKLKTEMEKKDKEIVELKDKYLRSVADFRNLQERTKRETQAAKDFAIQRFARD 118

Query: 80  MLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK- 138
           ++   DNL RAL + P D    E    + L +L +GI+MT   ++STL+++G+++ D   
Sbjct: 119 LVESVDNLDRALGTVPADKLKPEDG-NADLIALHDGIKMTDSILISTLKKHGLERFDPSD 177

Query: 139 -DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
             +KFNPN+H+A+F+ P             Q G+ +N RVL+ 
Sbjct: 178 AGEKFNPNVHEAVFQAPQPDKEDGICFHTQQKGFLLNGRVLKA 220


>gi|317402180|gb|EFV82771.1| GrpE chaperone [Achromobacter xylosoxidans C54]
          Length = 185

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 57/167 (34%), Positives = 91/167 (54%), Gaps = 13/167 (7%)

Query: 25  EEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVS 84
           E        + +     E +D+ LRV AE EN+RRR   E   A+ + I  FA  ++ V 
Sbjct: 31  ELNELRAQLDAAQATVNEQQDQLLRVRAEAENVRRRAQEEVSKARKFGIESFAESLVPVK 90

Query: 85  DNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDA-KDQKFN 143
           D+L  AL  A           +  + +L EG+E+T +++ +  ER  +K+I   +  KF+
Sbjct: 91  DSLEAALAQA-----------DQTVDTLREGVEVTLKQLAAAFERNLLKEIAPVQGDKFD 139

Query: 144 PNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           P++HQA+   P    PANT+++++Q GY I +R LRPALV +S G+ 
Sbjct: 140 PHLHQAISSIP-AEQPANTVVQLLQKGYVIADRTLRPALVVVSAGQG 185


>gi|299065802|emb|CBJ36980.1| Hsp 24 nucleotide exchange factor, Ribulose-phosphate 3-epimerase
           activity [Ralstonia solanacearum CMR15]
          Length = 214

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 48/177 (27%), Positives = 91/177 (51%), Gaps = 12/177 (6%)

Query: 13  EKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYS 72
           ++      +   +      + + +  ++ +  + + R +AE EN+RRR   +   A  ++
Sbjct: 50  DEATVAEATIEQDTAELRRLLDAAEEKARQNYENWARAVAEGENIRRRAQDDVSRAHKFA 109

Query: 73  IAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGV 132
           I  FA  +L V D+L  AL             +   +  L EG+E+T +++ +  E+  V
Sbjct: 110 IEGFAEYLLPVMDSLQAALA-----------DTSGDVAKLREGVELTLKQLSAAFEKGRV 158

Query: 133 KKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
            +++   +KF+P+ HQA+   P     ANT++ V+Q GY + +RVLRPALV+++  K
Sbjct: 159 TELNPVGEKFDPHRHQAISMVP-ADQEANTVVNVLQRGYTLADRVLRPALVTVAAPK 214


>gi|253702165|ref|YP_003023354.1| heat shock protein GrpE [Geobacter sp. M21]
 gi|259647652|sp|C6E644|GRPE_GEOSM RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|251777015|gb|ACT19596.1| GrpE protein [Geobacter sp. M21]
          Length = 186

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 55/186 (29%), Positives = 91/186 (48%), Gaps = 16/186 (8%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLN---QSEEFRDKYLRVIAEMENLRRRTDR 63
           EK  D  +         ++      + E       +S    DKYLR  A++EN R+R  +
Sbjct: 12  EKKADASQEKVEVAQPVSDADRIKELEEALAAKGLESAANWDKYLRERADLENYRKRVQK 71

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           EK++   Y   +   ++L   DNL RA+D A  +             +++EG+ +T   +
Sbjct: 72  EKEEILKYGKEEIIVEILPALDNLERAIDHANEES------------AIVEGVRLTLSML 119

Query: 124 MSTLERYGVKKID-AKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPAL 182
           +S L+++GV  +D      FNP  HQAM +        NT++ V Q GY +NER+LRPA+
Sbjct: 120 LSALKKFGVTPVDTPPGTPFNPEYHQAMGQVESADQEPNTVVAVFQKGYLLNERLLRPAM 179

Query: 183 VSISKG 188
           V+++  
Sbjct: 180 VTVAVK 185


>gi|161170280|gb|ABX59250.1| molecular chaperone GrpE [uncultured marine bacterium EB000_55B11]
 gi|297183808|gb|ADI19931.1| hypothetical protein [uncultured marine bacterium EB000_55B11]
          Length = 198

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 69/191 (36%), Positives = 114/191 (59%), Gaps = 10/191 (5%)

Query: 2   ETFMSEKNIDKEKNPSNANSS--TAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRR 59
           E  M ++ +   ++ +  ++     EE  EIN  +E   ++ E  D+ +R +AE EN R+
Sbjct: 15  EVXMDDEELVNIEDLTELDTEXLANEESDEINEVDELRAENAELNDRLMRALAEAENQRK 74

Query: 60  RTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMT 119
           R +R+++DA+ Y   K ARD+LSV DN+ RA + A  +            KSL EGI++T
Sbjct: 75  RGERDRRDAEVYGGRKLARDLLSVYDNMKRASEMATDEQR-------EANKSLFEGIDLT 127

Query: 120 RREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVL 178
           +RE+++T  ++ +  I  +   KF+P +HQAMFE P  TV A  I++V+ +G+ I++R+L
Sbjct: 128 QRELINTFAKHNIVPIAPEVGDKFDPELHQAMFEAPMPTVKAGHILQVLDEGFMISDRLL 187

Query: 179 RPALVSISKGK 189
           RPA V +S G 
Sbjct: 188 RPANVGVSSGG 198


>gi|157158969|ref|YP_001463933.1| heat shock protein GrpE [Escherichia coli E24377A]
 gi|194427912|ref|ZP_03060458.1| co-chaperone GrpE [Escherichia coli B171]
 gi|260845295|ref|YP_003223073.1| heat shock protein GrpE [Escherichia coli O103:H2 str. 12009]
 gi|293448965|ref|ZP_06663386.1| co-chaperone GrpE [Escherichia coli B088]
 gi|300925606|ref|ZP_07141476.1| co-chaperone GrpE [Escherichia coli MS 182-1]
 gi|301326734|ref|ZP_07220048.1| co-chaperone GrpE [Escherichia coli MS 78-1]
 gi|167008731|sp|A7ZQ54|GRPE_ECO24 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|157080999|gb|ABV20707.1| co-chaperone GrpE [Escherichia coli E24377A]
 gi|194414145|gb|EDX30421.1| co-chaperone GrpE [Escherichia coli B171]
 gi|257760442|dbj|BAI31939.1| heat shock protein GrpE [Escherichia coli O103:H2 str. 12009]
 gi|291322055|gb|EFE61484.1| co-chaperone GrpE [Escherichia coli B088]
 gi|300418301|gb|EFK01612.1| co-chaperone GrpE [Escherichia coli MS 182-1]
 gi|300846594|gb|EFK74354.1| co-chaperone GrpE [Escherichia coli MS 78-1]
 gi|323159133|gb|EFZ45126.1| protein grpE [Escherichia coli E128010]
 gi|323184511|gb|EFZ69885.1| protein grpE [Escherichia coli 1357]
 gi|323946259|gb|EGB42292.1| GrpE protein [Escherichia coli H120]
          Length = 196

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 57/189 (30%), Positives = 99/189 (52%), Gaps = 9/189 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR-DKYLRVIAEMENLRRR 60
           E  M +    +   P  +         +I   E  L +++    D  LRV AEMENLRRR
Sbjct: 16  EIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLRRR 75

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+ + + A  +++ KF  ++L V D+L RAL+ A              + +++EGIE+T 
Sbjct: 76  TELDIEKAHKFALEKFINELLPVIDSLDRALEVADKA--------NPDMSAMVEGIELTL 127

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + M+  + ++GV+ I   +   +PN+HQA+     D V    ++ ++Q GY +N R +R 
Sbjct: 128 KSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRA 187

Query: 181 ALVSISKGK 189
           A+V+++K K
Sbjct: 188 AMVTVAKAK 196


>gi|302535382|ref|ZP_07287724.1| molecular chaperone DnaK [Streptomyces sp. C]
 gi|302444277|gb|EFL16093.1| molecular chaperone DnaK [Streptomyces sp. C]
          Length = 225

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 41/207 (19%), Positives = 89/207 (42%), Gaps = 16/207 (7%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
           S K  D+     +      +E + +   +++     E      R+ AE +N RRR +R++
Sbjct: 30  SSKKEDEAAPAGDKAQGAGQEAALLAQLDQARTALGERTADLQRLQAEYQNYRRRVERDR 89

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
              +  ++A    ++L   D++ RA +                   L+ G +     + +
Sbjct: 90  VAVKEIAVASLLTELLPTLDDIGRAREHGE----------------LVGGFKSVAESLET 133

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
              + G+++   + + F+P +H+A+       V   T + ++Q GY I ER +RPA V++
Sbjct: 134 AAAKMGLQQFGKEGEPFDPTIHEALMHSYAPDVTETTCVAILQPGYRIGERTIRPARVAV 193

Query: 186 SKGKTQNPTEEKKETIEQPSPLDIEER 212
           ++ +       K E+ +  +P D +  
Sbjct: 194 AEPQPGAAPAAKSESGDGDTPSDKDTD 220


>gi|218288637|ref|ZP_03492914.1| GrpE protein [Alicyclobacillus acidocaldarius LAA1]
 gi|218241294|gb|EED08469.1| GrpE protein [Alicyclobacillus acidocaldarius LAA1]
          Length = 207

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 53/178 (29%), Positives = 93/178 (52%), Gaps = 10/178 (5%)

Query: 9   NIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDA 68
            + +E     A  S  EE +  + P+    Q EE   + LR  A+ +N RRRT +E+++ 
Sbjct: 39  EVAEEDISYEAGDSAEEESTSASEPDPRDAQIEELTQQLLRTRADFDNFRRRTRQEREEL 98

Query: 69  QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLE 128
             ++  K   D+L V DN  RA+ +                  + +GIEM  R+++  L 
Sbjct: 99  VQFATKKLLADLLPVLDNFDRAIQALEGVDEP----------QMKQGIEMVHRQLLQVLH 148

Query: 129 RYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           +YGV +++A    F+P+ H+A+ +E  +      +I+V+Q GY ++ +VLRPA+V +S
Sbjct: 149 QYGVTEMEAVGALFDPSQHEAVMQEQVEGQEPGRVIEVLQKGYLLHGKVLRPAMVKVS 206


>gi|170727814|ref|YP_001761840.1| heat shock protein GrpE [Shewanella woodyi ATCC 51908]
 gi|226737183|sp|B1KQY9|GRPE_SHEWM RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|169813161|gb|ACA87745.1| GrpE protein [Shewanella woodyi ATCC 51908]
          Length = 209

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 57/197 (28%), Positives = 109/197 (55%), Gaps = 12/197 (6%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQ----SEEFRDKYLRVIAEMENLR 58
             ++E  ++   + ++      +    +   E++L +     EE +D   R  A   N+R
Sbjct: 20  EILTESEVETGNDEASLMDELTQANFRVEELEQALAEANAKIEEQKDSVTRAAASEANIR 79

Query: 59  RRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEM 118
           RR  ++ + A  +++ KFA ++L V DN+ RAL     +            K++ EG+E+
Sbjct: 80  RRAAQDVEKAHKFALEKFANELLPVIDNMERALQGTNAE--------AEETKAIYEGVEL 131

Query: 119 TRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVL 178
           T +  +ST++++G+K+++   + FNP  HQA+  +P    PANT++ V+Q GY +N+R+L
Sbjct: 132 TLKSFVSTVDKFGLKEVNPHGESFNPEHHQAIGMQPSPEFPANTVMMVMQKGYILNDRLL 191

Query: 179 RPALVSISKGKTQNPTE 195
           RPA+V +S+G +   T+
Sbjct: 192 RPAMVMVSQGGSGVDTQ 208


>gi|308069967|ref|YP_003871572.1| GrpE protein (HSP-70 cofactor) [Paenibacillus polymyxa E681]
 gi|305859246|gb|ADM71034.1| GrpE protein (HSP-70 cofactor) [Paenibacillus polymyxa E681]
          Length = 190

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 53/182 (29%), Positives = 94/182 (51%), Gaps = 9/182 (4%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
            E     ++      ++  E++       +   Q+EE + ++LR  A+ +N RRRT +EK
Sbjct: 18  EEAAETSQQEEPVNEAAALEDQESETELTKLRAQAEEHQQRFLRAQADFDNFRRRTLKEK 77

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
           +D   Y+  K   +++ V DN  RAL +AP    +         +S  +G+EM  R+  S
Sbjct: 78  EDLAKYASMKLVTELVPVLDNFERALATAPQGAES---------ESFSKGVEMIFRQFES 128

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
            L+  GV  +++  Q FNP+ HQA+ +   +      +++ VQ GY + ++VLRPA+V +
Sbjct: 129 VLQAEGVTAMNSVGQPFNPDFHQAIMQVESEEHEEGIVVEEVQKGYMLKDKVLRPAMVKV 188

Query: 186 SK 187
           S 
Sbjct: 189 SM 190


>gi|50549019|ref|XP_501980.1| YALI0C18513p [Yarrowia lipolytica]
 gi|49647847|emb|CAG82300.1| YALI0C18513p [Yarrowia lipolytica]
          Length = 248

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 56/173 (32%), Positives = 99/173 (57%), Gaps = 1/173 (0%)

Query: 16  PSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAK 75
            +    +  E ++ +   E+   +  +F++ Y R I +  +L+  T RE K A  +++AK
Sbjct: 76  ETKTAPTAEEYEALLAKFEKKDKECAQFKEHYQRAITDFRHLQETTKREIKKAHDFALAK 135

Query: 76  FARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI 135
           FA+D+L   DN  RAL   P D   +++++   + +  +GI+MT+     TL ++G+KK+
Sbjct: 136 FAKDLLDSVDNFDRALGVVP-DEIKNDRENNKEIMNFYDGIKMTQDIFEKTLGKHGMKKL 194

Query: 136 DAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           +   + F+PNMH+A+FE P     A T+  V Q G+ +N+R+LR A V + KG
Sbjct: 195 EPVGEVFDPNMHEAVFEAPQPDKEAGTVFFVQQTGFTLNDRILRAAKVGVVKG 247


>gi|254253169|ref|ZP_04946487.1| Molecular chaperone GrpE [Burkholderia dolosa AUO158]
 gi|124895778|gb|EAY69658.1| Molecular chaperone GrpE [Burkholderia dolosa AUO158]
          Length = 181

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 56/188 (29%), Positives = 93/188 (49%), Gaps = 12/188 (6%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   +    D   +      +    ++      E+  +  E ++ YLR  AE EN+RRR 
Sbjct: 6   ENPATPSAEDIGSDKQAEQGAAPAAEAADAALAEAQAKVAELQESYLRAKAETENVRRRA 65

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
             +   A  ++I  FA  +L V D+L  A+             +   +  + EG+E+T R
Sbjct: 66  QEDVAKAHKFAIESFAEHLLPVLDSLEAAV-----------GDTSGDIAKVREGVELTLR 114

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           ++ S LE+  V  I+   +KF+P+ HQA+   P      NT++ V+Q GY I +RVLRPA
Sbjct: 115 QLTSALEKGRVVAINPVGEKFDPHQHQAISMVP-AEQEPNTVVTVLQKGYMIADRVLRPA 173

Query: 182 LVSISKGK 189
           LV++++ K
Sbjct: 174 LVTVAQPK 181


>gi|303256615|ref|ZP_07342629.1| co-chaperone GrpE [Burkholderiales bacterium 1_1_47]
 gi|330999254|ref|ZP_08322971.1| co-chaperone GrpE [Parasutterella excrementihominis YIT 11859]
 gi|302860106|gb|EFL83183.1| co-chaperone GrpE [Burkholderiales bacterium 1_1_47]
 gi|329575112|gb|EGG56663.1| co-chaperone GrpE [Parasutterella excrementihominis YIT 11859]
          Length = 181

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 52/177 (29%), Positives = 90/177 (50%), Gaps = 11/177 (6%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
            D+    + A++    +        ++  ++ E  D Y+R +AE +N RRR   +   A+
Sbjct: 15  QDEAAQQAPADAPELPDLDLSAELAKAQAKAAENYDLYVRAVAEADNTRRRASEDVAKAR 74

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
            + I KFA  ML V D++ +AL+++  +              L EG+E+T R+++S LE 
Sbjct: 75  KFGIEKFAESMLPVVDSMEKALEASANEKGP-----------LKEGLEITYRQLLSALEH 123

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
            G+K  +    KF+PN  QA+       V    +  V Q G+ I +RVLRPA+V+++
Sbjct: 124 NGMKCENPVGLKFDPNTMQAITMVKDPAVQPGCVATVFQRGWKIADRVLRPAMVAVA 180


>gi|261867534|ref|YP_003255456.1| heat shock protein GrpE [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|261412866|gb|ACX82237.1| co-chaperone GrpE [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 192

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 54/186 (29%), Positives = 107/186 (57%), Gaps = 7/186 (3%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           +E  +  +++  E      +           +  +    S++ +D  LR  AE++N+RRR
Sbjct: 13  LEQEIQPEDVVDELKEQGEDPLEEAIARVQELEAQLAETSKKEQDLLLRTRAEIDNIRRR 72

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+++ + A  +++ KFA+D+L+  DNL RAL +            +  +K+L +G+E+T 
Sbjct: 73  TEQDIEKAHKFALEKFAKDILNTIDNLERALAT-------PANTEDDSVKALFDGVELTL 125

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           +E+++T+ R+G++ + A  + F+P +HQA+  +P +   +N I  V+Q GY +N RV+RP
Sbjct: 126 KELLATVARFGIEPVGAVGEVFDPELHQAISMQPAEGFQSNQITAVLQKGYLLNGRVIRP 185

Query: 181 ALVSIS 186
           A+V ++
Sbjct: 186 AMVMVA 191


>gi|332234949|ref|XP_003266667.1| PREDICTED: grpE protein homolog 2, mitochondrial-like [Nomascus
           leucogenys]
          Length = 225

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 41/174 (23%), Positives = 88/174 (50%), Gaps = 3/174 (1%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
           ++P +       E++      +   + ++   +Y R +A+ EN+RRRT R  +DA+ + I
Sbjct: 47  EDPPDELGPPLAEQALRVKAVKLEKEVQDLTVRYQRAVADCENIRRRTQRCVEDAKIFGI 106

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
             F +D++ V+D L +  +    +    ++K    L+ +  G+ +   ++ S   ++G++
Sbjct: 107 QSFCKDLVEVADILEKTTECISEESEPEDQKLT--LEKVFRGLLLLEAKLKSVFAKHGLE 164

Query: 134 KIDAKDQKFNPNMHQAMFEEPHD-TVPANTIIKVVQDGYAINERVLRPALVSIS 186
           K+     K++P+ H+ +   P    V   T+  V QDGY ++ R +R A V ++
Sbjct: 165 KLTPIGDKYDPHEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVA 218


>gi|301155918|emb|CBW15388.1| heat shock protein [Haemophilus parainfluenzae T3T1]
          Length = 191

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 60/197 (30%), Positives = 111/197 (56%), Gaps = 22/197 (11%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKY---------------LR 49
           MSE+  +  +N         E  +  +  EE++ + +E  ++                LR
Sbjct: 1   MSEQAQNLNENEELVEEVQQETTATEDPLEEAIARVQELEEQLKAQVEETSKKEQDLLLR 60

Query: 50  VIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVL 109
             AE++N+RRR++++ + A  +++ KF++D+L+  DNL RAL +          K +  +
Sbjct: 61  TRAEIDNMRRRSEQDIEKAHKFALEKFSKDILNTIDNLERALAT-------PANKEDENI 113

Query: 110 KSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQD 169
           K+L +G+E+T +E++ST+ R+GV+ + A    FNP++HQA+  +P +    N I  V+Q 
Sbjct: 114 KALFDGVELTLKELLSTVSRFGVEPVGAVGDTFNPDLHQAISMQPAEGFTTNQITTVLQK 173

Query: 170 GYAINERVLRPALVSIS 186
           GY +N RV+RPA+V ++
Sbjct: 174 GYTLNGRVIRPAMVMVA 190


>gi|269836746|ref|YP_003318974.1| GrpE protein [Sphaerobacter thermophilus DSM 20745]
 gi|269786009|gb|ACZ38152.1| GrpE protein [Sphaerobacter thermophilus DSM 20745]
          Length = 195

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 49/180 (27%), Positives = 94/180 (52%), Gaps = 10/180 (5%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
            E     +       +     +   N+ E+   ++ E+ ++  R  AE+ N RRRT++E 
Sbjct: 12  DETTTTGDDQAEAPPTEEPSAQELQNLLEQERARAAEYLEQAQRARAELINFRRRTEQEV 71

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
           ++ + ++       +L V D+L+RA++S P +  +            I+GI +  R++ S
Sbjct: 72  QEIRKHASENLIARLLPVLDDLNRAVESVPAEHRDDPW---------IQGILLIERKLWS 122

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
            LE  GV+ I+A  + F+P +H+A+  E      A+T+++  Q GY +++RVLRPA+V +
Sbjct: 123 ILEAEGVRPIEAVGKPFDPALHEAVTVEEGAES-ADTVVQEFQRGYLLHDRVLRPAIVKV 181


>gi|115350698|ref|YP_772537.1| heat shock protein GrpE [Burkholderia ambifaria AMMD]
 gi|170700492|ref|ZP_02891497.1| GrpE protein [Burkholderia ambifaria IOP40-10]
 gi|172059727|ref|YP_001807379.1| heat shock protein GrpE [Burkholderia ambifaria MC40-6]
 gi|115280686|gb|ABI86203.1| GrpE protein [Burkholderia ambifaria AMMD]
 gi|170134616|gb|EDT02939.1| GrpE protein [Burkholderia ambifaria IOP40-10]
 gi|171992244|gb|ACB63163.1| GrpE protein [Burkholderia ambifaria MC40-6]
          Length = 181

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 57/188 (30%), Positives = 93/188 (49%), Gaps = 12/188 (6%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   +    D       A  +    ++      E+  +  E ++ YLR  AE EN+RRR 
Sbjct: 6   ENPATPSADDIGSEKQAAQGAAPAAEAADAALAEAQAKVAELQESYLRAKAETENVRRRA 65

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
             +   A  ++I  FA  +L V D+L  A+             +   +  + EG+E+T R
Sbjct: 66  QDDVSKAHKFAIESFAEHLLPVLDSLEAAV-----------GDTSGDITKVREGVELTLR 114

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           ++ S LE+  V  I+   +KF+P+ HQA+   P      NT++ V+Q GY I +RVLRPA
Sbjct: 115 QLTSALEKGRVVAINPVGEKFDPHQHQAISMVP-AEQEPNTVVTVLQKGYMIADRVLRPA 173

Query: 182 LVSISKGK 189
           LV++++ K
Sbjct: 174 LVTVAQPK 181


>gi|167571128|ref|ZP_02364002.1| co-chaperone GrpE [Burkholderia oklahomensis C6786]
          Length = 185

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 52/151 (34%), Positives = 86/151 (56%), Gaps = 12/151 (7%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           +  E ++ +LR  AE EN+RRR   +   A  ++I  FA ++L V D+L  A+       
Sbjct: 47  KIAELQESFLRAKAETENVRRRAQDDVAKAHKFAIENFAENLLPVLDSLEAAV------- 99

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
                 +   L  + EG+E+T R++ S LE+  V  ++   +KF+P++HQA+   P    
Sbjct: 100 ----GDTSGDLAKVREGVELTLRQLQSALEKGRVAALNPVGEKFDPHLHQAISMVP-ADQ 154

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISKGK 189
             NT++ V+Q GY I +RVLRPALV++++ K
Sbjct: 155 EPNTVVAVLQKGYTIADRVLRPALVTVAQPK 185


>gi|16130533|ref|NP_417104.1| heat shock protein [Escherichia coli str. K-12 substr. MG1655]
 gi|89109414|ref|AP_003194.1| heat shock protein [Escherichia coli str. K-12 substr. W3110]
 gi|170082216|ref|YP_001731536.1| heat shock protein [Escherichia coli str. K-12 substr. DH10B]
 gi|238901773|ref|YP_002927569.1| heat shock protein [Escherichia coli BW2952]
 gi|121638|sp|P09372|GRPE_ECOLI RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor; AltName:
           Full=HSP24; AltName: Full=Heat shock protein B25.3
 gi|226737130|sp|B1XBT4|GRPE_ECODH RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|259647651|sp|C4ZYN1|GRPE_ECOBW RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|41619|emb|CAA30711.1| unnamed protein product [Escherichia coli]
 gi|786517|gb|AAB32515.1| GrpE=heat shock protein [Escherichia coli, mutant grpE25, Peptide
           Mutant, 197 aa]
 gi|1788967|gb|AAC75663.1| heat shock protein [Escherichia coli str. K-12 substr. MG1655]
 gi|1800018|dbj|BAA16498.1| heat shock protein [Escherichia coli str. K12 substr. W3110]
 gi|169890051|gb|ACB03758.1| heat shock protein [Escherichia coli str. K-12 substr. DH10B]
 gi|238861403|gb|ACR63401.1| heat shock protein [Escherichia coli BW2952]
 gi|260448313|gb|ACX38735.1| Ribulose-phosphate 3-epimerase [Escherichia coli DH1]
 gi|315137231|dbj|BAJ44390.1| heat shock protein HSP70 cofactor [Escherichia coli DH1]
          Length = 197

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 56/190 (29%), Positives = 99/190 (52%), Gaps = 9/190 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR-DKYLRVIAEMENLRRR 60
           E  M +    +   P  +         ++   E  L +++    D  LRV AEMENLRRR
Sbjct: 16  EIIMDQHEEIEAVEPEASAEQVDPRDEKVANLEAQLAEAQTRERDGILRVKAEMENLRRR 75

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+ + + A  +++ KF  ++L V D+L RAL+ A              + +++EGIE+T 
Sbjct: 76  TELDIEKAHKFALEKFINELLPVIDSLDRALEVADKA--------NPDMSAMVEGIELTL 127

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + M+  + ++GV+ I   +   +PN+HQA+     D V    ++ ++Q GY +N R +R 
Sbjct: 128 KSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRA 187

Query: 181 ALVSISKGKT 190
           A+V+++K K 
Sbjct: 188 AMVTVAKAKA 197


>gi|294055585|ref|YP_003549243.1| GrpE protein [Coraliomargarita akajimensis DSM 45221]
 gi|293614918|gb|ADE55073.1| GrpE protein [Coraliomargarita akajimensis DSM 45221]
          Length = 196

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 43/167 (25%), Positives = 84/167 (50%), Gaps = 9/167 (5%)

Query: 28  SEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNL 87
            ++   E++  ++ E + +YLR +A+MEN R+R  REK+D    + +     +L V DN+
Sbjct: 39  PKLTELEKAQAEAAEMKSRYLRSVADMENFRKRIAREKQDIIRSAASGVVESLLPVLDNM 98

Query: 88  SRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMH 147
              L +A       +            G +M   ++   L   G++++    + F+PN+H
Sbjct: 99  KLGLQAAENHPEAKDVSF---------GFKMVDDQLKKILSDQGLEELIPDGEVFDPNLH 149

Query: 148 QAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPT 194
           + +  +P D +  + +I+ V+ GY +NER++R A V +S G  +   
Sbjct: 150 ECISHQPSDEIEEDKVIQTVRAGYRLNERLIRAANVIVSSGPAKAED 196


>gi|302552957|ref|ZP_07305299.1| co-chaperone GrpE [Streptomyces viridochromogenes DSM 40736]
 gi|302470575|gb|EFL33668.1| co-chaperone GrpE [Streptomyces viridochromogenes DSM 40736]
          Length = 218

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 39/207 (18%), Positives = 87/207 (42%), Gaps = 16/207 (7%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           +    +      +  +     T ++ + +   +++     E      R+ AE +N RRR 
Sbjct: 22  DDAEPKAASPSAEEGAAPAGDTGQDVALVAQLDQARTALSERTADLQRLQAEFQNYRRRV 81

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           +R++   +  +IA    ++L V D++ RA +                   L+ G +    
Sbjct: 82  ERDRIAVKEIAIANLLTELLPVLDDIGRAREHGE----------------LVGGFKSVAE 125

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
            +  T  + G+++   + + F+P +H+A+       V   T + ++Q GY I ER +RPA
Sbjct: 126 SLEGTAAKMGLQQFGKEGEPFDPTIHEALMHSYAPDVTETTCVAILQPGYRIGERTIRPA 185

Query: 182 LVSISKGKTQNPTEEKKETIEQPSPLD 208
            V++++ +    T +  E+ +      
Sbjct: 186 RVAVAEPQPGAQTVKADESADADDKES 212


>gi|319788939|ref|YP_004090254.1| GrpE protein [Ruminococcus albus 7]
 gi|315450806|gb|ADU24368.1| GrpE protein [Ruminococcus albus 7]
          Length = 186

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 47/176 (26%), Positives = 88/176 (50%), Gaps = 12/176 (6%)

Query: 11  DKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQS 70
           D    P    +    E +E +  ++   +  + +DKYLR++AE +N R+R+ +E+ D  +
Sbjct: 21  DTADTPEETENEENNESTEQSEEDKLKAELADTKDKYLRLMAEYDNFRKRSAKERLDISA 80

Query: 71  YSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERY 130
              A    D+L V DN  RAL +   D            ++  +GIEM  ++    + + 
Sbjct: 81  SVKADTVADILPVLDNFERALGTETQD------------EAYKQGIEMIFKQFTDAMAKL 128

Query: 131 GVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           G++ ID   + F+PN+  A+ +     +  N + +V Q GY I ++V+R A+V ++
Sbjct: 129 GIEAIDPVGEVFDPNIANAVNQIEDPELGENVVAQVFQKGYRIGDKVIRYAMVVVA 184


>gi|171059256|ref|YP_001791605.1| GrpE protein [Leptothrix cholodnii SP-6]
 gi|259647756|sp|B1Y785|GRPE_LEPCP RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|170776701|gb|ACB34840.1| GrpE protein [Leptothrix cholodnii SP-6]
          Length = 181

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 54/180 (30%), Positives = 86/180 (47%), Gaps = 10/180 (5%)

Query: 11  DKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQS 70
                      ++           E   ++ +  D YLR  AE +N+RRR D +   ++ 
Sbjct: 11  SDNAALEAQGIASELIDDSAARIAELEAKNADLADAYLRAKAEADNIRRRADDDIAKSRK 70

Query: 71  YSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERY 130
           +++  FA  +L V D+L  A+ S      + E         +IEG+  T R++   LER 
Sbjct: 71  FAVESFAESLLPVKDSLEAAIVSHAAGKGSPE--------QVIEGVHATLRQLGQALERN 122

Query: 131 GV-KKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
            V +       KF+P+ HQA+   P     ANT++ V+Q GY I +RVLRPALV+++  K
Sbjct: 123 KVLEVNPPAGTKFDPHQHQAISVVP-AEQEANTVVAVLQKGYLIADRVLRPALVTVAAAK 181


>gi|330447335|ref|ZP_08310984.1| grpE domain protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328491526|dbj|GAA05481.1| grpE domain protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 204

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 60/171 (35%), Positives = 96/171 (56%), Gaps = 8/171 (4%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
                    S  Q+ E +D  LR  AE EN+RRR+++E   A+ Y++ KFA ++L V DN
Sbjct: 42  AELEAALLASEAQANEAKDMALRARAEGENVRRRSEQEIDKARKYALNKFAEELLPVIDN 101

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNM 146
           L RAL+ A           +   K+++EG+E+T + M  T+ ++G+ +I+ + + FNP  
Sbjct: 102 LERALEMADKT--------DESSKAMMEGVELTLKTMTDTVAKFGLTQINPQGEAFNPEF 153

Query: 147 HQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEK 197
           HQAM  +       NT++ V+Q GY +N RV+RPA+V +SK    N   + 
Sbjct: 154 HQAMAIQESTEFAPNTVMMVMQKGYELNGRVIRPAMVMVSKAAAGNVNTQA 204


>gi|46579225|ref|YP_010033.1| heat shock protein GrpE [Desulfovibrio vulgaris str. Hildenborough]
 gi|120603208|ref|YP_967608.1| GrpE protein [Desulfovibrio vulgaris DP4]
 gi|52782884|sp|Q72DW7|GRPE_DESVH RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|46448638|gb|AAS95292.1| heat shock protein GrpE [Desulfovibrio vulgaris str. Hildenborough]
 gi|120563437|gb|ABM29181.1| GrpE protein [Desulfovibrio vulgaris DP4]
 gi|311233056|gb|ADP85910.1| GrpE protein [Desulfovibrio vulgaris RCH1]
          Length = 191

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 44/152 (28%), Positives = 81/152 (53%), Gaps = 9/152 (5%)

Query: 39  QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDL 98
           +  +  ++ LR +A++EN ++R  REK +   Y+      D+L   DNL  AL       
Sbjct: 49  EKAQADEQRLRALADLENTKKRLQREKDEQVRYAAETVLADLLPTLDNLDLALQYGQG-- 106

Query: 99  ANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV 158
                   +  ++++ G+EMTR+ ++  L R+G++ +    + F P +H+AM  E    +
Sbjct: 107 -------SAECRNMLVGVEMTRKLLLEALGRHGLEAVGEAGEPFTPELHEAMSHEDRGDM 159

Query: 159 PANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           PA+ +  V+  GY + ER+LRPA V++S+   
Sbjct: 160 PADHVATVMMKGYRLKERLLRPAKVTVSRTPG 191


>gi|319411852|emb|CBQ73895.1| related to MGE1-heat shock protein-chaperone [Sporisorium
           reilianum]
          Length = 254

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 47/189 (24%), Positives = 95/189 (50%), Gaps = 6/189 (3%)

Query: 3   TFMSEKNIDKEK-NPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
               E     E    ++ +++ A  ++     ++   + +E ++  L   A+ +NL+RR+
Sbjct: 61  KKEEETKASGEAMGATDKDAAAASTEALQAQIKDKDTKIKELQEAILYGKADYQNLQRRS 120

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESV-----LKSLIEGI 116
             EK  A  ++I K A+D+ S  D L  AL S P +L  + +  +S      +  L  G+
Sbjct: 121 KDEKAQAGDFAITKLAKDLTSSIDILGLALRSVPEELRAASQDIDSKDPRRVIADLYSGV 180

Query: 117 EMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINER 176
           ++T + ++  L  +G+ + D   +KF+P  H+A+++ P       T+++  + GY I +R
Sbjct: 181 DLTSKSLLDMLRTHGIVQFDPTGEKFDPKEHEALYQAPVPGKEPGTVLECSKVGYKIKDR 240

Query: 177 VLRPALVSI 185
           +LR A V +
Sbjct: 241 LLRAAEVGV 249


>gi|294139889|ref|YP_003555867.1| heat shock protein GrpE [Shewanella violacea DSS12]
 gi|293326358|dbj|BAJ01089.1| heat shock protein GrpE [Shewanella violacea DSS12]
          Length = 209

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 59/197 (29%), Positives = 105/197 (53%), Gaps = 11/197 (5%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEE---KSEINIPEESLNQSEEFRDKYLRVIAEMENLR 58
           E   +++ +      S  +  T      +       ES  + +E  D   R  A   N+R
Sbjct: 20  EILTADEAVTSTDEASLVDELTQANFRIEELEQALAESQAKIKEQLDSVTRAAASEANIR 79

Query: 59  RRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEM 118
           RR  ++ + A+ +++ KFA ++L V DN+ RALD    +            K + EG+E+
Sbjct: 80  RRAAQDVEKARKFALEKFANELLPVIDNMERALDGTDAE--------AEETKVIYEGVEL 131

Query: 119 TRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVL 178
           T +  +ST++++G+K ++ + + FNP  HQA+  +P    PANT++ V+Q GY +N+R+L
Sbjct: 132 TLKSFISTVDKFGLKIVNPQGETFNPEHHQAIGMQPSPDFPANTVMMVMQKGYILNDRLL 191

Query: 179 RPALVSISKGKTQNPTE 195
           RPA+V +S+G     T+
Sbjct: 192 RPAMVMVSQGAGSVDTK 208


>gi|292489107|ref|YP_003531994.1| protein grpE (HSP-70 cofactor) [Erwinia amylovora CFBP1430]
 gi|292900227|ref|YP_003539596.1| heat shock protein [Erwinia amylovora ATCC 49946]
 gi|291200075|emb|CBJ47201.1| heat shock protein [Erwinia amylovora ATCC 49946]
 gi|291554541|emb|CBA22128.1| Protein grpE (HSP-70 cofactor) [Erwinia amylovora CFBP1430]
          Length = 194

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 57/192 (29%), Positives = 103/192 (53%), Gaps = 12/192 (6%)

Query: 3   TFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEE----FRDKYLRVIAEMENLR 58
             +S++   ++    +A ++            +   Q  E     RD  LR  AE+EN+R
Sbjct: 11  EQVSDEIEMEQAQNQDAETAAEVVDPRDERIAQLEVQLAESQNGVRDAQLRAQAEIENIR 70

Query: 59  RRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEM 118
           RR + + + A  +++ KF+ ++L V D+L RAL+ A              L ++IEGIE+
Sbjct: 71  RRAELDVEKAHKFALEKFSNELLPVIDSLERALEVADKS--------NPELAAMIEGIEL 122

Query: 119 TRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVL 178
           T + ++  + ++GV+ +   +  FNP +HQAM     + V  N ++ V+Q GY +N R+L
Sbjct: 123 TMKSLLGAVRKFGVEVVGDTNVPFNPEVHQAMSMMESEEVEPNHVMMVMQRGYTLNGRLL 182

Query: 179 RPALVSISKGKT 190
           RPA+V+++K K+
Sbjct: 183 RPAMVAVAKSKS 194


>gi|237729529|ref|ZP_04560010.1| heat shock protein GrpE [Citrobacter sp. 30_2]
 gi|226908135|gb|EEH94053.1| heat shock protein GrpE [Citrobacter sp. 30_2]
          Length = 197

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 61/190 (32%), Positives = 101/190 (53%), Gaps = 9/190 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR-DKYLRVIAEMENLRRR 60
           E  M +    +   P  +         +I   E  L ++E    D  LR+ AEMENLRRR
Sbjct: 16  EIIMDQHEEVEAVEPDASAEQVDPRDEKIANLEAQLAEAETRERDSVLRIKAEMENLRRR 75

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+ + + A  +++ KF  ++L V D+L RAL+ A              + +++EGIE+TR
Sbjct: 76  TELDVEKAHKFALEKFVNELLPVLDSLDRALEVADKG--------NDAMAAMVEGIELTR 127

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + M+  + ++GV+ +   D   +PN+HQA+     D V A  ++ V+Q GY +N R +R 
Sbjct: 128 KSMLDVVAKFGVQVVADIDVPMDPNVHQAIAMVESDDVAAGNVLMVMQKGYTLNGRTIRA 187

Query: 181 ALVSISKGKT 190
           A+VS++K K 
Sbjct: 188 AMVSVAKAKG 197


>gi|91211948|ref|YP_541934.1| heat shock protein GrpE [Escherichia coli UTI89]
 gi|218559533|ref|YP_002392446.1| heat shock protein GrpE [Escherichia coli S88]
 gi|218690731|ref|YP_002398943.1| heat shock protein GrpE [Escherichia coli ED1a]
 gi|237706799|ref|ZP_04537280.1| grpE [Escherichia sp. 3_2_53FAA]
 gi|122990747|sp|Q1R8B1|GRPE_ECOUT RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|226737126|sp|B7MIV1|GRPE_ECO45 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|254799593|sp|B7MYA6|GRPE_ECO81 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|91073522|gb|ABE08403.1| GrpE protein [Escherichia coli UTI89]
 gi|218366302|emb|CAR04053.1| heat shock protein [Escherichia coli S88]
 gi|218428295|emb|CAR09072.1| heat shock protein [Escherichia coli ED1a]
 gi|226899839|gb|EEH86098.1| grpE [Escherichia sp. 3_2_53FAA]
 gi|294489936|gb|ADE88692.1| co-chaperone GrpE [Escherichia coli IHE3034]
 gi|307625837|gb|ADN70141.1| heat shock protein GrpE [Escherichia coli UM146]
 gi|315284846|gb|EFU44291.1| co-chaperone GrpE [Escherichia coli MS 110-3]
 gi|323951188|gb|EGB47064.1| GrpE protein [Escherichia coli H252]
 gi|323957020|gb|EGB52746.1| GrpE protein [Escherichia coli H263]
          Length = 197

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 57/189 (30%), Positives = 99/189 (52%), Gaps = 9/189 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR-DKYLRVIAEMENLRRR 60
           E  M +    +   P  +         +I   E  L +++    D  LRV AEMENLRRR
Sbjct: 16  EIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLRRR 75

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+ + + A  +++ KF  ++L V D+L RAL+ A              + +++EGIE+T 
Sbjct: 76  TELDIEKAHKFALEKFINELLPVIDSLDRALEVADKA--------NPDMSAMVEGIELTL 127

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + M+  + ++GV+ I   +   +PN+HQA+     D V    ++ ++Q GY +N R +R 
Sbjct: 128 KSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRA 187

Query: 181 ALVSISKGK 189
           A+V+++K K
Sbjct: 188 AMVTVAKAK 196


>gi|223040625|ref|ZP_03610895.1| co-chaperone GrpE [Campylobacter rectus RM3267]
 gi|222878083|gb|EEF13194.1| co-chaperone GrpE [Campylobacter rectus RM3267]
          Length = 175

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 59/184 (32%), Positives = 96/184 (52%), Gaps = 9/184 (4%)

Query: 4   FMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDR 63
               +N++ E+   +    +   +       E   Q EE  DKY R  A+ EN+++R ++
Sbjct: 1   MNENENVELEQQIPSNFDESISFEGLDAKYIELQKQLEELTDKYYRANADFENIKKRFEK 60

Query: 64  EKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREM 123
           EK D  +Y+  KFARD+L V D L  A++         E + +     + EGI +T  + 
Sbjct: 61  EKADIATYANEKFARDLLPVIDALEMAVNF--------ETEGDEYAAKIKEGIYITIDQF 112

Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALV 183
               E+ G+  I+  ++ F+PN H AM +   + V    I++V+Q GY IN R+LRPA+V
Sbjct: 113 KKCFEKNGITAIE-ANEDFDPNFHNAMLQVESEDVEKGKIVQVIQKGYLINGRILRPAMV 171

Query: 184 SISK 187
           SI+K
Sbjct: 172 SIAK 175


>gi|293391410|ref|ZP_06635744.1| co-chaperone GrpE [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290951944|gb|EFE02063.1| co-chaperone GrpE [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 192

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 54/186 (29%), Positives = 107/186 (57%), Gaps = 7/186 (3%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           +E  +  +++  E      +           +  +    S++ +D  LR  AE++N+RRR
Sbjct: 13  LEQEIQSEDVVDELKEQGEDPLEEAIARVQELEAQLAETSKKEQDLLLRTRAEIDNIRRR 72

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+++ + A  +++ KFA+D+L+  DNL RAL +            +  +K+L +G+E+T 
Sbjct: 73  TEQDIEKAHKFALEKFAKDILNTIDNLERALAT-------PANTEDDSVKALFDGVELTL 125

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           +E+++T+ R+G++ + A  + F+P +HQA+  +P +   +N I  V+Q GY +N RV+RP
Sbjct: 126 KELLATVARFGIEPVGAVGEVFDPELHQAISMQPAEGFQSNQITAVLQKGYLLNGRVIRP 185

Query: 181 ALVSIS 186
           A+V ++
Sbjct: 186 AMVMVA 191


>gi|300768172|ref|ZP_07078077.1| co-chaperone GrpE [Lactobacillus plantarum subsp. plantarum ATCC
           14917]
 gi|300494236|gb|EFK29399.1| co-chaperone GrpE [Lactobacillus plantarum subsp. plantarum ATCC
           14917]
          Length = 207

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 52/180 (28%), Positives = 90/180 (50%), Gaps = 10/180 (5%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           +      + ++  +             +   Q +   D+ LR  AE+ N++ R  +E+  
Sbjct: 36  EATQAATSATDDQAEQTTAVDPTQQITDLKAQLDAKDDQLLRAQAEIVNMQNRNKKEQAA 95

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
              Y     A+D+L V DNL RAL +   D            + L +G+EM    +   L
Sbjct: 96  LLKYDGQALAKDVLPVLDNLERALATPADD---------EAAQQLKKGVEMVYGHLQDAL 146

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEP-HDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           +++GV +I A  +KF+PN+HQA+   P  D  PA+T+++V+Q GY + +R LRPA+V ++
Sbjct: 147 KKHGVTEIAAAGEKFDPNIHQAVQTVPVDDDHPADTVVQVLQRGYLLKDRTLRPAMVVVA 206


>gi|167630498|ref|YP_001680997.1| co-chaperone grpe [Heliobacterium modesticaldum Ice1]
 gi|167593238|gb|ABZ84986.1| co-chaperone grpe [Heliobacterium modesticaldum Ice1]
          Length = 225

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 44/183 (24%), Positives = 87/183 (47%), Gaps = 10/183 (5%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
                           +E        +++    +++ ++YLR+ A+ +N RRRT +EK++
Sbjct: 52  DEKTTSHAAEELGRLLSEMAKTKEALDKAKQDLQDWENRYLRLQADFDNFRRRTRQEKEE 111

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
             +Y+     + +L V DN  RAL +                 +L+ G+ M  R+    L
Sbjct: 112 LGTYANEGLVKKLLPVLDNFQRALGA---------MAKAGAADNLLAGVAMIERQFSDIL 162

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTV-PANTIIKVVQDGYAINERVLRPALVSIS 186
            + G++ ++A  ++F+P  H+A+     D V P   +++ +Q GY    +V+RPA+V ++
Sbjct: 163 TKEGLQPLEAVGKEFDPQSHEAVLFGEADEVYPDGIVMEEMQKGYLFKSKVIRPAMVKVA 222

Query: 187 KGK 189
           KG 
Sbjct: 223 KGG 225


>gi|59712603|ref|YP_205379.1| heat shock protein [Vibrio fischeri ES114]
 gi|75506949|sp|Q5E3A5|GRPE_VIBF1 RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|59480704|gb|AAW86491.1| heat shock protein [Vibrio fischeri ES114]
          Length = 194

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 62/179 (34%), Positives = 102/179 (56%), Gaps = 8/179 (4%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
              D E N S  +S  A+          S  Q +E +D  LR  AE +N+RRR + +   
Sbjct: 23  TEADVEWNESAEDSQEAKIAELEAALLASQAQVKEQQDTVLRAKAEEQNVRRRAEEDVDK 82

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127
           A+ Y++ KFA ++L V DNL RAL+S   +            K+L+EG+E+T +  +ST+
Sbjct: 83  ARKYALKKFAGELLPVLDNLERALESGDKE--------NEAAKALLEGVELTLQTFVSTV 134

Query: 128 ERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           E++G+  I+   + FNP +HQA+  +      +NT++ V+Q GY +N++VLRPA+V ++
Sbjct: 135 EKFGLTVINPMGEAFNPELHQAIGMQASPDHESNTVMIVMQKGYTLNDQVLRPAMVMVA 193


>gi|320530085|ref|ZP_08031155.1| co-chaperone GrpE [Selenomonas artemidis F0399]
 gi|320137518|gb|EFW29430.1| co-chaperone GrpE [Selenomonas artemidis F0399]
          Length = 199

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 48/162 (29%), Positives = 84/162 (51%), Gaps = 11/162 (6%)

Query: 25  EEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVS 84
           +   E    +    Q +E  D+ LR+ A+ EN RRRT +EK++  +        D+L + 
Sbjct: 47  DIPPEEVSADALEAQLKEKNDRILRLQADFENFRRRTAKEKEELAAVITQNMLGDLLPLL 106

Query: 85  DNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNP 144
           DN  RA+     D            ++  +G+EM   ++   L++ G++ I+A+ Q F+P
Sbjct: 107 DNFERAMAVEQTDG-----------EAFRKGVEMIFTQLKEVLDKNGLEHIEAEGQPFDP 155

Query: 145 NMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           N+HQA+    +  V   T+ +V+Q GY    RV+RPA+V ++
Sbjct: 156 NVHQAVMRVENPDVSDGTVTQVLQKGYRAKGRVIRPAMVQVA 197


>gi|154281695|ref|XP_001541660.1| predicted protein [Ajellomyces capsulatus NAm1]
 gi|150411839|gb|EDN07227.1| predicted protein [Ajellomyces capsulatus NAm1]
          Length = 252

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 56/188 (29%), Positives = 96/188 (51%), Gaps = 7/188 (3%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKD 67
           K     +   N   +   E+      E +  +  + +DKYLR +A+  NL+ RT RE + 
Sbjct: 64  KKESASEKNGNEKKTEDAEELVKKELEAAKKEIVDLKDKYLRSVADFRNLQERTRREIET 123

Query: 68  AQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN-SEKKSESVLKSLIEGIEMTRREMMST 126
           A+S++I +FA D+L   DNL RAL + P++  +   ++    L  L+ G+ MT R + ST
Sbjct: 124 ARSFAIQRFATDLLDSIDNLDRALAAVPVEKISGPGEQENKELAELVSGLRMTERVLFST 183

Query: 127 LERYGVKKIDAKD------QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           L ++G+++ D  +      QKF+P +H+A F    +      ++     G+ +N R LR 
Sbjct: 184 LNKHGLERFDPSELVDGKPQKFDPKLHEATFMAAAEGKEDGDVLHTQTKGFILNGRTLRA 243

Query: 181 ALVSISKG 188
           A V + K 
Sbjct: 244 AKVGVVKN 251


>gi|324518850|gb|ADY47220.1| GrpE protein [Ascaris suum]
          Length = 277

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 52/161 (32%), Positives = 93/161 (57%), Gaps = 6/161 (3%)

Query: 27  KSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDN 86
            +     +  L +   F+DKY R +A+ EN+RRR  ++ ++A+ ++I  F +D+L V+D 
Sbjct: 117 DALATEYDALLEECTSFKDKYTRALADTENVRRRGQKQVEEAKLFAIQGFCKDLLEVADI 176

Query: 87  LSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNM 146
           L  A+ S   +    + ++   +KSL EG+EMTR  +     ++G+KK+  + +KF+PNM
Sbjct: 177 LDLAVGSMKKE----DVETNPQIKSLHEGVEMTRTVLEKVFTKHGLKKLSPEGEKFDPNM 232

Query: 147 HQAMFEEPHDTVP--ANTIIKVVQDGYAINERVLRPALVSI 185
           H+A+F+ P D        + +V+  GYA+  R +R A V +
Sbjct: 233 HEAVFQVPKDQTKYGPGYVAQVMTIGYALQGRPIRAAKVGV 273


>gi|291387603|ref|XP_002710345.1| PREDICTED: GrpE-like 1, mitochondrial-like [Oryctolagus cuniculus]
          Length = 225

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 40/174 (22%), Positives = 90/174 (51%), Gaps = 3/174 (1%)

Query: 14  KNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSI 73
           ++P +    +  E++      +   + ++   +Y R +A+ EN+RRRT R  +DA+ + I
Sbjct: 47  EDPPDELGPSLTERALRLKAVKLEKEVQDLTIRYQRAVADCENIRRRTQRCVEDAKIFGI 106

Query: 74  AKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVK 133
             F +D++ V+D L +  +    +  + ++    +L+ +  G+ +   ++ S   ++G++
Sbjct: 107 QSFCKDLVEVADILEKTTECISEETESGDQTL--ILEKVFRGLSLLEAKLKSVFAKHGLE 164

Query: 134 KIDAKDQKFNPNMHQAMFEEPHD-TVPANTIIKVVQDGYAINERVLRPALVSIS 186
           K+     K++P+ H+ +   P    V   T+  V QDGY ++ R +R A V ++
Sbjct: 165 KMAPIGDKYDPHEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLAQVEVA 218


>gi|94676994|ref|YP_589038.1| co-chaperone GrpE [Baumannia cicadellinicola str. Hc (Homalodisca
           coagulata)]
 gi|123260501|sp|Q1LSM6|GRPE_BAUCH RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|94220144|gb|ABF14303.1| co-chaperone GrpE [Baumannia cicadellinicola str. Hc (Homalodisca
           coagulata)]
          Length = 198

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 59/184 (32%), Positives = 100/184 (54%), Gaps = 9/184 (4%)

Query: 8   KNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR-DKYLRVIAEMENLRRRTDREKK 66
           + + + +  S  N         I   E  L Q+++   D  LR  AE+EN+RRR + E +
Sbjct: 23  EAVSETEAVSETNEIIDMRDDRIQKLEVELVQAQQRERDLLLRSKAEIENMRRRNEIEVE 82

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
               +S+ +F  ++L V DNL RAL+ +              L S IEGIE+T + +++ 
Sbjct: 83  KVYKFSLERFVSELLPVIDNLERALEMSDKS--------SQNLASTIEGIELTLKSLLNV 134

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           ++++G+K +      FNP++HQAM     +    N +I V+Q GY +N R++RPA+V++S
Sbjct: 135 VQKFGIKVVSETHVPFNPDIHQAMTILESEEHEPNHVIIVMQKGYLLNGRLIRPAMVTVS 194

Query: 187 KGKT 190
           K K+
Sbjct: 195 KTKS 198


>gi|37679009|ref|NP_933618.1| molecular chaperone GrpE [Vibrio vulnificus YJ016]
 gi|320157238|ref|YP_004189617.1| heat shock protein GrpE [Vibrio vulnificus MO6-24/O]
 gi|52782902|sp|Q7MN92|GRPE_VIBVY RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|37197751|dbj|BAC93589.1| molecular chaperone GrpE [Vibrio vulnificus YJ016]
 gi|319932550|gb|ADV87414.1| heat shock protein GrpE [Vibrio vulnificus MO6-24/O]
          Length = 198

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 59/172 (34%), Positives = 100/172 (58%), Gaps = 8/172 (4%)

Query: 16  PSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAK 75
              A+ S  +          S  + +E +D  LR  AE+EN+RRRT++E   A+ Y++ +
Sbjct: 35  NEEADESAVKIAELEAALLASEARVKEQQDSVLRAKAEVENMRRRTEQEIDKARKYALNR 94

Query: 76  FARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKI 135
           FA ++L V DNL RA+ +A  +           +K L+EG+E+T +  +  + ++G+K+I
Sbjct: 95  FAEELLPVIDNLERAIQAADAE--------SEAVKPLLEGVELTHKTFVDVVSKFGLKEI 146

Query: 136 DAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           + + Q FNP  HQAM  +      +NT++ V+Q GY +N RV+RPA+V ++K
Sbjct: 147 NPEGQPFNPEWHQAMSIQESPDHESNTVMFVMQKGYELNGRVIRPAMVMVAK 198


>gi|168773461|ref|ZP_02798468.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4196]
 gi|189009971|ref|ZP_03006161.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4076]
 gi|189402159|ref|ZP_03006607.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4401]
 gi|189403162|ref|ZP_03006980.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4486]
 gi|195939664|ref|ZP_03085046.1| heat shock protein GrpE [Escherichia coli O157:H7 str. EC4024]
 gi|208805710|ref|ZP_03248047.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4206]
 gi|208812975|ref|ZP_03254304.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4045]
 gi|208821074|ref|ZP_03261394.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4042]
 gi|209400581|ref|YP_002272083.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4115]
 gi|254794559|ref|YP_003079396.1| heat shock protein GrpE [Escherichia coli O157:H7 str. TW14359]
 gi|226737127|sp|B5Z231|GRPE_ECO5E RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|187770604|gb|EDU34448.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4196]
 gi|189003442|gb|EDU72428.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4076]
 gi|189357337|gb|EDU75756.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4401]
 gi|189362004|gb|EDU80423.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4486]
 gi|208725511|gb|EDZ75112.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4206]
 gi|208734252|gb|EDZ82939.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4045]
 gi|208741197|gb|EDZ88879.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4042]
 gi|209161981|gb|ACI39414.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4115]
 gi|209762512|gb|ACI79568.1| heat shock protein GrpE [Escherichia coli]
 gi|209762516|gb|ACI79570.1| heat shock protein GrpE [Escherichia coli]
 gi|254593959|gb|ACT73320.1| heat shock protein [Escherichia coli O157:H7 str. TW14359]
          Length = 197

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 57/190 (30%), Positives = 99/190 (52%), Gaps = 9/190 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR-DKYLRVIAEMENLRRR 60
           E  M +    +   P  +         +I   E  L +++    D  LRV AEMENLRRR
Sbjct: 16  EIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLRRR 75

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+ + + A  +++ KF  ++L V D+L RAL+ A              + +++EGIE+T 
Sbjct: 76  TELDIEKAHKFALEKFINELLPVIDSLDRALEVADKA--------NPDMSAMVEGIELTL 127

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + M+  + ++GV+ I   +   +PN+HQA+     D V    ++ ++Q GY +N R +R 
Sbjct: 128 KSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRA 187

Query: 181 ALVSISKGKT 190
           A+V+++K K 
Sbjct: 188 AMVTVAKVKA 197


>gi|254446976|ref|ZP_05060443.1| co-chaperone GrpE [gamma proteobacterium HTCC5015]
 gi|198263115|gb|EDY87393.1| co-chaperone GrpE [gamma proteobacterium HTCC5015]
          Length = 198

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 61/177 (34%), Positives = 102/177 (57%), Gaps = 8/177 (4%)

Query: 12  KEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
           +    ++A S+   E   +   EE+  ++EE  D  LR  AEMENL+RRT+++   A+ +
Sbjct: 29  EATEDASAESAVEAEAPTVEALEEAQKKAEENYDLALRTKAEMENLKRRTEKDIDSARKF 88

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
           ++ K A ++L V D++   LD+A  D        +  +  L EG E+T + + S +E++ 
Sbjct: 89  ALEKIANELLGVRDSMEMGLDAAQSD--------DVDIAKLREGSELTLKMLSSLMEKFN 140

Query: 132 VKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           ++ +D   +KFNP+ HQAM     +    NT+I V+Q GY +N R+LRPALV ++K 
Sbjct: 141 IEPVDPTGEKFNPDFHQAMQMIESEEHEPNTVINVLQKGYTLNGRLLRPALVMVAKA 197


>gi|149912898|ref|ZP_01901432.1| GrpE protein HSP-70 cofactor, putative [Roseobacter sp. AzwK-3b]
 gi|149813304|gb|EDM73130.1| GrpE protein HSP-70 cofactor, putative [Roseobacter sp. AzwK-3b]
          Length = 186

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 57/178 (32%), Positives = 103/178 (57%), Gaps = 8/178 (4%)

Query: 12  KEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
           ++        +  E        E    + +  +DK++R +A+ EN R+R+D+++++A++Y
Sbjct: 14  EQAEAEEHALANEEISDTDAEIETLRAERDALQDKFMRALADAENARKRSDKDRREAENY 73

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
             +K ARDML V DN+ RAL++A  +          V  +L+EG+E+T RE+++   R+G
Sbjct: 74  GGSKLARDMLPVYDNMKRALEAATEEQK-------QVSAALLEGVELTMRELLNVFSRHG 126

Query: 132 VKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG 188
           + +I  +   +F+P  H+AMFE P     A  II+V  +G+ +++R+LRPA V +S  
Sbjct: 127 ITRISPEVGDRFDPQQHEAMFEAPLPGTKAGDIIQVSTEGFMLHDRILRPAQVGVSSN 184


>gi|15602199|ref|NP_245271.1| hypothetical protein PM0334 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12720574|gb|AAK02418.1| GrpE [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 201

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 52/167 (31%), Positives = 95/167 (56%), Gaps = 7/167 (4%)

Query: 20  NSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARD 79
           +           +  +     ++ +D  LR  AEM+N+RRR +++ + A  + + KF++D
Sbjct: 41  DPLEEAILRVQELEAQLTEMVKKEQDFLLRSRAEMDNIRRRAEQDVEKAHKFGLEKFSKD 100

Query: 80  MLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKD 139
           +L+  DNL RAL +            +  +KSL +G+E+T +E+++T+ R+GV+ +    
Sbjct: 101 ILNTIDNLERALAT-------PANLEDESIKSLFDGVELTLKELLATVSRFGVEAVGVVG 153

Query: 140 QKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           + FNP +HQA+  +P +    N I  V+Q GY +N RV+RPA+V ++
Sbjct: 154 ETFNPEVHQAISMQPMEGFETNQITVVLQKGYLLNGRVIRPAMVMVA 200


>gi|134294822|ref|YP_001118557.1| heat shock protein GrpE [Burkholderia vietnamiensis G4]
 gi|226737118|sp|A4JBR9|GRPE_BURVG RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|134137979|gb|ABO53722.1| GrpE protein [Burkholderia vietnamiensis G4]
          Length = 181

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 57/188 (30%), Positives = 93/188 (49%), Gaps = 12/188 (6%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61
           E   ++   D       A  +    ++      E+  +  E ++ YLR  AE EN+RRR 
Sbjct: 6   ENPATQSAEDIGSAKQAAQGAAPAAEAADAALAEAQAKVAELQESYLRAKAETENVRRRA 65

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
             +   A  ++I  FA  +L V D+L  A              +   +  + EG+E+T R
Sbjct: 66  QDDVSKAHKFAIESFAEHLLPVLDSLEAA-----------AVDTSGDIAKVREGVELTLR 114

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           ++ S LE+  V  I+   +KF+P+ HQA+   P      NT++ V+Q GY I +RVLRPA
Sbjct: 115 QLTSALEKGRVVAINPVGEKFDPHQHQAISMVP-AEQEPNTVVAVLQKGYMIADRVLRPA 173

Query: 182 LVSISKGK 189
           LV++++ K
Sbjct: 174 LVTVAQPK 181


>gi|114769784|ref|ZP_01447394.1| putative chaperone protein GrpE (heat shock protein) [alpha
           proteobacterium HTCC2255]
 gi|114549489|gb|EAU52371.1| putative chaperone protein GrpE (heat shock protein) [alpha
           proteobacterium HTCC2255]
          Length = 198

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 69/191 (36%), Positives = 114/191 (59%), Gaps = 10/191 (5%)

Query: 2   ETFMSEKNIDKEKNPSNANSST--AEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRR 59
           E  M ++ +   ++ +  ++     EE  EIN  +E   ++ E  D+ +R +AE EN R+
Sbjct: 15  EVPMDDEELVNIEDLTELDTKELANEESDEINEVDELRAENAELNDRLMRALAEAENQRK 74

Query: 60  RTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMT 119
           R +R+++DA+ Y   K ARD+LSV DN+ RA + A  +            KSL EGI++T
Sbjct: 75  RGERDRRDAEVYGGRKLARDLLSVYDNMKRASEMATDEQR-------EANKSLFEGIDLT 127

Query: 120 RREMMSTLERYGVKKIDAK-DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVL 178
           +RE+++T  ++ +  I  +   KF+P +HQAMFE P  TV A  I++V+ +G+ I++R+L
Sbjct: 128 QRELINTFAKHNIVPIAPEVGDKFDPELHQAMFEAPMPTVKAGHILQVLDEGFMISDRLL 187

Query: 179 RPALVSISKGK 189
           RPA V +S G 
Sbjct: 188 RPANVGVSSGG 198


>gi|200388944|ref|ZP_03215556.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|199606042|gb|EDZ04587.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
          Length = 253

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 57/189 (30%), Positives = 104/189 (55%), Gaps = 9/189 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR-DKYLRVIAEMENLRRR 60
           E  M +    +   P+++         +I   E  L +++    D  LR+ AEMENLRRR
Sbjct: 73  EIIMDQHEEVEAVEPNDSAEQVDPRDEKIANLEVQLAEAQTRERDTVLRIKAEMENLRRR 132

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+++ + A  +++ KF  ++L V D+L RAL+ A              + +++EGIE+T 
Sbjct: 133 TEQDIEKAHKFALEKFVNELLPVIDSLDRALEVADKA--------NPDMAAMVEGIELTL 184

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + M+  + ++GV+ I   +   +PN+HQA+     + VPA  ++ ++Q GY +N R +R 
Sbjct: 185 KSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESEEVPAGNVLGIMQKGYTLNGRTIRA 244

Query: 181 ALVSISKGK 189
           A+V+++K K
Sbjct: 245 AMVTVAKAK 253


>gi|67924055|ref|ZP_00517504.1| GrpE protein [Crocosphaera watsonii WH 8501]
 gi|67854087|gb|EAM49397.1| GrpE protein [Crocosphaera watsonii WH 8501]
          Length = 189

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 47/195 (24%), Positives = 93/195 (47%), Gaps = 8/195 (4%)

Query: 13  EKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYS 72
           E   +   + T + ++     +E   Q +  ++ ++R+ AE +N R+RT +EK+D ++  
Sbjct: 1   ESCNTTITALTEQIEALQGKLQEQGQQYDVLKNSHIRLTAEFDNYRKRTAKEKQDLETIV 60

Query: 73  IAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGV 132
                 ++LSV DN  RA ++                 ++ +  +   + ++ +L+R GV
Sbjct: 61  KRNTIGELLSVVDNFERARNTIKPANDGET--------AIHKSYQGVYKNLVDSLKRLGV 112

Query: 133 KKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQN 192
             +  + + F+P  H+AM  E  D  P   II+ +  GY I E+VLR A+V ++  K   
Sbjct: 113 SPMRPEGEPFDPLYHEAMLREYTDEYPEGIIIEELMRGYMIGEQVLRHAMVKVAAPKPTE 172

Query: 193 PTEEKKETIEQPSPL 207
            +E  + +    +P 
Sbjct: 173 SSENTESSTSDETPS 187


>gi|326624447|gb|EGE30792.1| co-chaperone GrpE [Salmonella enterica subsp. enterica serovar
           Dublin str. 3246]
          Length = 253

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 57/189 (30%), Positives = 104/189 (55%), Gaps = 9/189 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR-DKYLRVIAEMENLRRR 60
           E  M +    +   P+++         +I   E  L +++    D  LR+ AEMENLRRR
Sbjct: 73  EIIMDQHEEVEAVEPNDSAEQVDPRDEKIANLEVQLAEAQTRERDTVLRIKAEMENLRRR 132

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+++ + A  +++ KF  ++L V D+L RAL+ A              + +++EGIE+T 
Sbjct: 133 TEQDIEKAHKFALEKFVNELLPVIDSLDRALEVADKA--------NPDMAAMVEGIELTL 184

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + M+  + ++GV+ I   +   +PN+HQA+     + VPA  ++ ++Q GY +N R +R 
Sbjct: 185 KSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESEEVPAGNVLGIMQKGYTLNGRTIRA 244

Query: 181 ALVSISKGK 189
           A+V+++K K
Sbjct: 245 AMVTVAKAK 253


>gi|17547358|ref|NP_520760.1| HEAT shock protein 24 [Ralstonia solanacearum GMI1000]
 gi|52782964|sp|Q8XW36|GRPE_RALSO RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|17429661|emb|CAD16346.1| probable protein grpe (hsp-70 cofactor) [Ralstonia solanacearum
           GMI1000]
          Length = 214

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 51/177 (28%), Positives = 91/177 (51%), Gaps = 12/177 (6%)

Query: 13  EKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYS 72
           ++      +   +        E +  ++ +  + + R +AE EN+RRR   +   A  ++
Sbjct: 50  DEAAVAEATIEPDTAELRRQLEAADEKARQNYENWARAVAEGENIRRRAQDDVARAHKFA 109

Query: 73  IAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGV 132
           I  FA  +L V D+L  AL  A  D           +  L EG+E+T +++ +  E+  V
Sbjct: 110 IEGFAEYLLPVMDSLQAALADASGD-----------VAKLREGVELTLKQLNAAFEKGRV 158

Query: 133 KKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
            +++   +KF+P+ HQA+   P     ANT++ V+Q GY + +RVLRPALV+++  K
Sbjct: 159 TELNPVGEKFDPHRHQAISMVP-ADQEANTVVNVLQRGYTLADRVLRPALVTVAAPK 214


>gi|255081366|ref|XP_002507905.1| mitochondrial protein translocase family [Micromonas sp. RCC299]
 gi|226523181|gb|ACO69163.1| mitochondrial protein translocase family [Micromonas sp. RCC299]
          Length = 216

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 60/184 (32%), Positives = 99/184 (53%), Gaps = 4/184 (2%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
             +  +  ++ +    +  E +       E   Q ++  DK LR +A+MENLR RT R+ 
Sbjct: 30  ETEGAEDGEDVNEDEVADEEVQKLTAELSEKTAQVKDLNDKLLRTLADMENLRERTRRQA 89

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPL---DLANSEKKSESVLKSLIEGIEMTRRE 122
           + A+ ++I  F +D+L V+DNL+RA  +      +        ++VL SL EG+ M  ++
Sbjct: 90  ETAEKFAIQGFCKDLLDVADNLARASATVDPEALETETDAANIKNVLASLHEGVLMVEKQ 149

Query: 123 MMSTLERYGVKKIDA-KDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
           +MST  ++GV K D  +   FNPN H A+F  P     A T+  V + GY +++RV+RPA
Sbjct: 150 LMSTFGKHGVVKFDPAEGDPFNPNDHMALFNVPKGEKEAGTVAAVTKVGYKLHDRVIRPA 209

Query: 182 LVSI 185
            V +
Sbjct: 210 EVGV 213


>gi|312173265|emb|CBX81520.1| Protein grpE (HSP-70 cofactor) [Erwinia amylovora ATCC BAA-2158]
          Length = 194

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 57/189 (30%), Positives = 102/189 (53%), Gaps = 12/189 (6%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEE----FRDKYLRVIAEMENLRRRT 61
           S++   ++    +A ++            +   Q  E     RD  LR  AE+EN+RRR 
Sbjct: 14  SDEIEMEQAQNQDAETAAEVVDPRDERIAQLEVQLAESQNGVRDAQLRAQAEIENIRRRA 73

Query: 62  DREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRR 121
           + + + A  +++ KF+ ++L V D+L RAL+ A              L ++IEGIE+T +
Sbjct: 74  ELDVEKAHKFALEKFSNELLPVIDSLERALEVADKS--------NPELAAMIEGIELTMK 125

Query: 122 EMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPA 181
            ++  + ++GV+ +   +  FNP +HQAM     + V  N ++ V+Q GY +N R+LRPA
Sbjct: 126 SLLGAVRKFGVEVVGDTNVPFNPEVHQAMSMMESEEVEPNHVMMVMQRGYTLNGRLLRPA 185

Query: 182 LVSISKGKT 190
           +V+++K K+
Sbjct: 186 MVAVAKSKS 194


>gi|229824137|ref|ZP_04450206.1| hypothetical protein GCWU000282_01441 [Catonella morbi ATCC 51271]
 gi|229786491|gb|EEP22605.1| hypothetical protein GCWU000282_01441 [Catonella morbi ATCC 51271]
          Length = 198

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 55/187 (29%), Positives = 95/187 (50%), Gaps = 10/187 (5%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
           ++      +  + +   ++ S     +   +   +   + E   D+ LR+ AE++N+RR 
Sbjct: 20  LDKIQDSADQAEVQVDQSSESLDQAIEEAEDQVSQLEAEKEALSDQLLRLQAEIQNMRRI 79

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
             RE++DA  Y     A  +L V+DNL RAL +                K++ +GIEM  
Sbjct: 80  NQRERQDAAKYRSQSLASHLLDVADNLERALAT---------PAESEDAKAIHKGIEMVY 130

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEP-HDTVPANTIIKVVQDGYAINERVLR 179
           ++     E+ G+  ID  +Q F+PN HQA+   P  +   A+T+I V+Q GY + +RVLR
Sbjct: 131 KQFQQAFEKEGISVIDPLNQAFDPNFHQAVSMMPAGEGQEADTVINVLQKGYMLQDRVLR 190

Query: 180 PALVSIS 186
           PA+V ++
Sbjct: 191 PAMVIVA 197


>gi|218295293|ref|ZP_03496129.1| GrpE protein [Thermus aquaticus Y51MC23]
 gi|218244496|gb|EED11021.1| GrpE protein [Thermus aquaticus Y51MC23]
          Length = 179

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 45/190 (23%), Positives = 92/190 (48%), Gaps = 14/190 (7%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           M E+N+ +     + N    E ++     + +  + +  +D+YLR++A+ +N R+R + E
Sbjct: 1   MEERNLGENALEKDLNEVAQEAEALEARLKAAEEELKSLKDRYLRLLADFDNYRKRMEEE 60

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
            K  +     K  R +L V D+L RAL+ A  +            +S+++G+   R    
Sbjct: 61  LKAREREGALKVLRALLPVLDDLDRALEFAQANP-----------ESILQGVRAVREGFF 109

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
             L   GV+++  + Q F+P  H+A+   P        + +V Q G+ + + ++RPA V+
Sbjct: 110 RILAGLGVEEVPGEGQAFDPRYHEAIGLLPG---EPGKVARVFQRGFRMGDSLVRPARVA 166

Query: 185 ISKGKTQNPT 194
           + + K ++  
Sbjct: 167 VGEEKPEDEA 176


>gi|21674305|ref|NP_662370.1| GrpE protein [Chlorobium tepidum TLS]
 gi|52782952|sp|Q8KCD7|GRPE_CHLTE RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|21647478|gb|AAM72712.1| grpE protein [Chlorobium tepidum TLS]
          Length = 194

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 49/178 (27%), Positives = 89/178 (50%), Gaps = 5/178 (2%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
             +      A    A E            + ++ R++ +R  AE EN R++ +RE   + 
Sbjct: 22  AAETPAEETAAIPAATEADMDAEISARDAEIQKLREEVMRRAAEFENFRKQKEREAALSG 81

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
           +  +    R++L + D+L R +   P     +E ++ +  K  IEG+E+  +  MS LER
Sbjct: 82  TRMLENIVRELLPLIDDLKRLMSHIP-----AEMQAMAEAKPFIEGVELIHKNFMSLLER 136

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            GVK+I+AK +  + N H+A+ +        +TI++  Q GY + +RV+R A V ++K
Sbjct: 137 KGVKEIEAKGKMLDVNFHEAITQIDAPGAEPDTIVEEYQTGYTLGDRVIRHAKVIVAK 194


>gi|283835677|ref|ZP_06355418.1| co-chaperone GrpE [Citrobacter youngae ATCC 29220]
 gi|291068891|gb|EFE07000.1| co-chaperone GrpE [Citrobacter youngae ATCC 29220]
          Length = 197

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 63/190 (33%), Positives = 102/190 (53%), Gaps = 9/190 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR-DKYLRVIAEMENLRRR 60
           E  M +    +   P  +         +I   E  L ++E    D  LR+ AEMENLRRR
Sbjct: 16  EIIMDQHEEVEAVEPDASAEQVDPRDEKIANLEAQLAEAETRERDSVLRIKAEMENLRRR 75

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+ + + A  +++ KF  ++L V D+L RAL+ A  D           + ++IEGIE+TR
Sbjct: 76  TELDVEKAHKFALEKFVNELLPVLDSLDRALEVADKD--------NEAMAAMIEGIELTR 127

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + M+  + ++GV+ +   D   +PN+HQA+     D V A  ++ V+Q GY +N R +R 
Sbjct: 128 KSMLDVVAKFGVQVVADIDVPMDPNVHQAIAMVESDDVAAGNVLMVMQKGYTLNGRTIRA 187

Query: 181 ALVSISKGKT 190
           A+VS++K K 
Sbjct: 188 AMVSVAKAKG 197


>gi|258516363|ref|YP_003192585.1| GrpE protein [Desulfotomaculum acetoxidans DSM 771]
 gi|257780068|gb|ACV63962.1| GrpE protein [Desulfotomaculum acetoxidans DSM 771]
          Length = 204

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 50/169 (29%), Positives = 91/169 (53%), Gaps = 5/169 (2%)

Query: 19  ANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFAR 78
              ++A+ K   +   E   +++++ DK LR+ A+ EN RRR+ +EK+D   Y       
Sbjct: 39  DEQASADPKVLQDRLREQTVRAQDYYDKLLRMQADFENFRRRSKQEKEDLARYVTEHLLL 98

Query: 79  DMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAK 138
           ++L V DN  RAL     +      +     +S +EG++M  R+    L + G+  I A 
Sbjct: 99  NLLQVVDNFERALCIQVKEGNQEAFQ-----ESFMEGMKMVYRQFNEVLGKEGLCPIKAV 153

Query: 139 DQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
            ++F+PN H+A+ +E     P NT+   ++ GY + ++V+RPA+V ++K
Sbjct: 154 GEQFDPNKHEAVMQEETSEFPDNTVAAELRRGYMLKDKVIRPAMVKVAK 202


>gi|42525192|ref|NP_970572.1| GrpE protein [Bdellovibrio bacteriovorus HD100]
 gi|52782877|sp|Q6MGQ3|GRPE_BDEBA RecName: Full=Protein grpE; AltName: Full=HSP-70 cofactor
 gi|39577403|emb|CAE81226.1| GrpE protein [Bdellovibrio bacteriovorus HD100]
          Length = 172

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 51/181 (28%), Positives = 93/181 (51%), Gaps = 9/181 (4%)

Query: 10  IDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQ 69
           + +E N  N+N    E     +  ++   Q+E+F++ YL + AE EN +R   +E+ +  
Sbjct: 1   MSEENNSQNSNPPNPENGEIASEIQKLQEQAEKFKNDYLYLRAEFENYKRNAIKERSELM 60

Query: 70  SYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLER 129
            Y   +  RD+L V DN  RAL             S     +  +G++MT +E+ S L+R
Sbjct: 61  KYGGERLVRDLLEVVDNFDRALSV---------NVSAENFNTFKQGVDMTAQELKSLLQR 111

Query: 130 YGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
           + V +I A    F+P++H+A+  E  D +    I++V +  Y ++++V+RP  V ++K  
Sbjct: 112 HNVIEIPAHGAPFDPSVHEALSSEATDQMAPGHIVRVFKKPYKLHDKVIRPGQVVVAKKP 171

Query: 190 T 190
            
Sbjct: 172 E 172


>gi|88812329|ref|ZP_01127579.1| GrpE protein [Nitrococcus mobilis Nb-231]
 gi|88790336|gb|EAR21453.1| GrpE protein [Nitrococcus mobilis Nb-231]
          Length = 206

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 55/211 (26%), Positives = 103/211 (48%), Gaps = 19/211 (9%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQS-----------EEFRDKYLRV 50
           E   +E   + E +    +   A+    I   ++++ +            EE  +++LR 
Sbjct: 3   EEERNEAQRNDEPSAQAHSELDAQGNESIERLQQAVERLTVECESARTRAEENWNQFLRA 62

Query: 51  IAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLK 110
            AE+EN  RR+ R+ + A  Y++ K A ++L V D+L   +  A              + 
Sbjct: 63  RAELENQHRRSQRDVEQAHRYALEKLANELLGVRDSLEMGVSVAQEA--------HGDVS 114

Query: 111 SLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDG 170
            L EG+E+T + +   +E++ + +++ + ++F+P  H+AM  +       NT+I VVQ G
Sbjct: 115 KLREGVELTLKMLNQVMEKFDIHEVNPQGERFDPEKHEAMAAQESAEHDPNTVIHVVQKG 174

Query: 171 YAINERVLRPALVSISKGKTQNPTEEKKETI 201
           Y +N+R+LRPALV +SK     P+    +  
Sbjct: 175 YLLNDRLLRPALVIVSKPDNHRPSGGAIDEQ 205


>gi|254487866|ref|ZP_05101071.1| co-chaperone GrpE [Roseobacter sp. GAI101]
 gi|214044735|gb|EEB85373.1| co-chaperone GrpE [Roseobacter sp. GAI101]
          Length = 187

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 56/176 (31%), Positives = 104/176 (59%), Gaps = 8/176 (4%)

Query: 12  KEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
            +       S   E   E    ++   + +  +D+++R +A+ EN R+R+D+++++A++Y
Sbjct: 14  DDAEAEAYASEMEEIDDEALELDQLRAERDLLKDRFMRALADAE