RPSBLAST alignment for GI: 255764487 and conserved domain: pfam01025

>gnl|CDD|144566 pfam01025, GrpE, GrpE. Length = 162
 Score =  163 bits (416), Expect = 3e-41
 Identities = 70/165 (42%), Positives = 114/165 (69%), Gaps = 9/165 (5%)

Query: 23  TAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLS 82
             EE++     EE   + EE +D+ LR++AE EN R+RT+RE+++A+ Y+I KFA+D+L 
Sbjct: 7   EDEEEALEEELEELEEEIEELKDRLLRLLAEFENYRKRTEREREEAKKYAIEKFAKDLLP 66

Query: 83  VSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKF 142
           V DNL RAL +A         K    +KSL+EG+EM  ++++  LE++GV+KI+ + + F
Sbjct: 67  VLDNLERALAAA---------KENEDVKSLVEGVEMILKQLLKVLEKHGVEKIEPEGEPF 117

Query: 143 NPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187
           +PN+H+A+ + P D  P  T+++V+Q GY +++RVLRPA+V +SK
Sbjct: 118 DPNLHEAVSQVPSDEKPPGTVVEVLQKGYKLHDRVLRPAMVVVSK 162