RPSBLAST alignment for GI: 255764487 and conserved domain: PRK14151

>gnl|CDD|172640 PRK14151, PRK14151, heat shock protein GrpE; Provisional. Length = 176
 Score =  118 bits (298), Expect = 1e-27
 Identities = 56/181 (30%), Positives = 104/181 (57%), Gaps = 11/181 (6%)

Query: 7   EKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKK 66
             ++   +      ++  +  + +   EE L      +D+ LR  A+++N+RRR +++ +
Sbjct: 6   TLDLQAPEAAQAEAAAGDDLTARVQELEEQL---AAAKDQSLRAAADLQNVRRRAEQDVE 62

Query: 67  DAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
            A  +++ KFA D+L V D+L R L+     L++++ ++   +K + EG+E+T +    T
Sbjct: 63  KAHKFALEKFAGDLLPVVDSLERGLE-----LSSADDEA---IKPMREGVELTLKMFQDT 114

Query: 127 LERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSIS 186
           L+RY ++ +D   + FNP  HQAM  +    V  N+++KV Q GY +N R+LRPA+V +S
Sbjct: 115 LKRYQLEAVDPHGEPFNPEHHQAMAMQESADVEPNSVLKVFQKGYLLNGRLLRPAMVVVS 174

Query: 187 K 187
           K
Sbjct: 175 K 175