RPSBLAST alignment for GI: 255764487 and conserved domain: PRK14149

>gnl|CDD|184538 PRK14149, PRK14149, heat shock protein GrpE; Provisional. Length = 191
 Score = 96.1 bits (239), Expect = 7e-21
 Identities = 61/192 (31%), Positives = 98/192 (51%), Gaps = 15/192 (7%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQS-----EEFRDKYLRVIAEME 55
               +S+K  + E+          EEK E +  E  + +      +E  +KYLRV A+ E
Sbjct: 8   EHDHLSQKEPESEEKACACKEQQGEEKQEASEKEGEIKEDFELKYKEMHEKYLRVHADFE 67

Query: 56  NLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEG 115
           N+++R +R+K  A  Y+  K A D+L V D L  AL SA                +L +G
Sbjct: 68  NVKKRLERDKSMALEYAYEKIALDLLPVIDALLGALKSA---------AEVDKESALTKG 118

Query: 116 IEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINE 175
           +E+T  ++   L R+G++ I    ++F+PN H A+ +   +      I++V+Q GY    
Sbjct: 119 LELTMEKLHEVLARHGIEGI-ECLEEFDPNFHNAIMQVKSEEKENGKIVQVLQQGYKYKG 177

Query: 176 RVLRPALVSISK 187
           RVLRPA+VSI+K
Sbjct: 178 RVLRPAMVSIAK 189