RPSBLAST alignment for GI: 255764487 and conserved domain: PRK14155

>gnl|CDD|184541 PRK14155, PRK14155, heat shock protein GrpE; Provisional. Length = 208
 Score =  139 bits (352), Expect = 5e-34
 Identities = 73/181 (40%), Positives = 115/181 (63%), Gaps = 12/181 (6%)

Query: 13  EKNPSNANSSTAEEKSEINIPEESLN-QSEEFRDKYLRVIAEMENLRRRTDREKKDAQSY 71
           E+ P+      A++ ++     E+L  +    +D+ LR  AE EN +RR +RE  DA++Y
Sbjct: 4   EQTPAEDGPFEADDAAQ---EIEALKAEVAALKDQALRYAAEAENTKRRAEREMNDARAY 60

Query: 72  SIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
           +I KFARD+L  +DNL RA  ++P D A      +  +K+ I G+EMT +E++   ER G
Sbjct: 61  AIQKFARDLLGAADNLGRATAASPKDSA------DPAVKNFIIGVEMTEKELLGAFERNG 114

Query: 132 VKKID-AKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI-SKGK 189
           +KKID AK  KF+P++HQAM E+P   V A  +++V+Q GY +  R++RPA+V++ +KG 
Sbjct: 115 LKKIDPAKGDKFDPHLHQAMMEQPSTEVAAGGVLQVMQAGYELMGRLVRPAMVAVAAKGS 174

Query: 190 T 190
           T
Sbjct: 175 T 175