RPSBLAST alignment for GI: 255764487 and conserved domain: PRK14160

>gnl|CDD|184544 PRK14160, PRK14160, heat shock protein GrpE; Provisional. Length = 211
 Score = 71.3 bits (175), Expect = 2e-13
 Identities = 52/183 (28%), Positives = 96/183 (52%), Gaps = 14/183 (7%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESL-NQSEEFRDKYLRVIAEMENLRRRTDRE 64
            E   D E++         +E +++    + L N+ E  +D+ LR +AE +N R+RT +E
Sbjct: 42  EEIIEDSEESNEVKIEELKDENNKLKEENKKLENELEALKDRLLRTVAEYDNYRKRTAKE 101

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
           K+   S +     +++L V DNL RA               E  ++ L +GIEMT ++  
Sbjct: 102 KEGIYSDACEDVLKELLPVLDNLERAA------------AVEGSVEDLKKGIEMTVKQFK 149

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
           ++LE+ GV++I   + +F+PN+H A+     +    N I++V Q GY   ++V+R ++V 
Sbjct: 150 TSLEKLGVEEIST-EGEFDPNLHNAVMHVEDENYGENEIVEVFQKGYKRGDKVIRYSMVK 208

Query: 185 ISK 187
           ++ 
Sbjct: 209 VAN 211