RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|255764487|ref|YP_003065115.2| heat shock protein [Candidatus Liberibacter asiaticus str. psy62] (219 letters) >gnl|CDD|144566 pfam01025, GrpE, GrpE. Length = 162 Score = 163 bits (416), Expect = 3e-41 Identities = 70/165 (42%), Positives = 114/165 (69%), Gaps = 9/165 (5%) Query: 23 TAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLS 82 EE++ EE + EE +D+ LR++AE EN R+RT+RE+++A+ Y+I KFA+D+L Sbjct: 7 EDEEEALEEELEELEEEIEELKDRLLRLLAEFENYRKRTEREREEAKKYAIEKFAKDLLP 66 Query: 83 VSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKF 142 V DNL RAL +A K +KSL+EG+EM ++++ LE++GV+KI+ + + F Sbjct: 67 VLDNLERALAAA---------KENEDVKSLVEGVEMILKQLLKVLEKHGVEKIEPEGEPF 117 Query: 143 NPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK 187 +PN+H+A+ + P D P T+++V+Q GY +++RVLRPA+V +SK Sbjct: 118 DPNLHEAVSQVPSDEKPPGTVVEVLQKGYKLHDRVLRPAMVVVSK 162 >gnl|CDD|73207 cd00446, GrpE, GrpE is the adenine nucleotide exchange factor of DnaK (Hsp70)-type ATPases. The GrpE dimer binds to the ATPase domain of Hsp70 catalyzing the dissociation of ADP, which enables rebinding of ATP, one step in the Hsp70 reaction cycle in protein folding. In eukaryotes, only the mitochondrial Hsp70, not the cytosolic form, is GrpE dependent.. Length = 137 Score = 154 bits (391), Expect = 1e-38 Identities = 65/145 (44%), Positives = 104/145 (71%), Gaps = 9/145 (6%) Query: 41 EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100 EE +DK LR +AE EN R+RT+RE+++A+ Y+I KFA+D+L V DNL RAL++A Sbjct: 2 EELKDKLLRALAEFENYRKRTEREREEARKYAIEKFAKDLLPVLDNLERALEAAK----- 56 Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPA 160 E LK+L+EG+EMT ++++ LE++GV+KI+ + + F+PN+H+A+ + P V Sbjct: 57 ----KEEELKNLVEGVEMTLKQLLDVLEKHGVEKIEPEGEPFDPNLHEAVMQVPSPDVEP 112 Query: 161 NTIIKVVQDGYAINERVLRPALVSI 185 T+++V+Q GY + +RVLRPA+V + Sbjct: 113 GTVVEVLQKGYKLGDRVLRPAMVVV 137 >gnl|CDD|30921 COG0576, GrpE, Molecular chaperone GrpE (heat shock protein) [Posttranslational modification, protein turnover, chaperones]. Length = 193 Score = 136 bits (344), Expect = 4e-33 Identities = 74/185 (40%), Positives = 117/185 (63%), Gaps = 12/185 (6%) Query: 5 MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64 SE+ +E+ P N E+ E Q EE +DKYLR AE ENLR+RT+RE Sbjct: 21 KSEEEEAEEEEPEEENELEEEQ----QEIAELEAQLEELKDKYLRAQAEFENLRKRTERE 76 Query: 65 KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124 +++A+ Y+I KFA+D+L V DNL RAL + + + K+L+EG+EMT +++ Sbjct: 77 REEAKKYAIEKFAKDLLPVIDNLERAL--------EAAEDDKDPEKALLEGVEMTLDQLL 128 Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184 LE+ GV++I + +KF+PN+H+A+ + V NT+++V+Q GY +N+RVLRPA+V Sbjct: 129 DALEKLGVEEIGPEGEKFDPNLHEAVQRVESEDVEPNTVVEVLQKGYKLNDRVLRPAMVK 188 Query: 185 ISKGK 189 ++K + Sbjct: 189 VAKKE 193 >gnl|CDD|38213 KOG3003, KOG3003, KOG3003, Molecular chaperone of the GrpE family [Posttranslational modification, protein turnover, chaperones]. Length = 236 Score = 114 bits (286), Expect = 2e-26 Identities = 62/183 (33%), Positives = 107/183 (58%), Gaps = 2/183 (1%) Query: 6 SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65 ++ + E P + + EK+ + + + +E +DKYLR +AE ENLR RT R+ Sbjct: 52 YGEDCESELAPDDKLGPSLAEKALLEKVLKLEKEEQELKDKYLRSLAECENLRDRTIRDV 111 Query: 66 KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125 +DA+ ++I F +D+L V+DNL +A + + ++K + LK L EG+ MT ++ Sbjct: 112 EDAKKFAIQSFCKDLLEVADNLEKATECVKEESEKEDQKKD--LKDLFEGLSMTEAQLKE 169 Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185 ++G++K+D +KF+PN H+A+F+ P T+ V + GY +N RV+RPA+V + Sbjct: 170 VFAKHGLEKLDPIGEKFDPNEHEAVFQVPDAAKEPGTVALVTKKGYKLNGRVIRPAMVGV 229 Query: 186 SKG 188 KG Sbjct: 230 VKG 232 >gnl|CDD|36212 KOG0994, KOG0994, KOG0994, Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]. Length = 1758 Score = 28.9 bits (64), Expect = 1.2 Identities = 24/123 (19%), Positives = 54/123 (43%), Gaps = 17/123 (13%) Query: 7 EKNIDKEKNPSNANSSTAEEKSEI--NIPEESLNQSEEFR--DKYLRVIAEM-------- 54 E +++ K+ + NS+ A++ + + E++L+ + KY ++ + Sbjct: 1625 ETRMEELKHKAAQNSAEAKQAEKTAGSAKEQALSAEQGLEILQKYYELVDRLLEKRMEGS 1684 Query: 55 ENLRRRTDREKKDA-----QSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVL 109 + R R ++ + +A Q+ +D+ +AL+ +LA EK+ ESVL Sbjct: 1685 QAARERAEQLRTEAEKLLGQANEKLDRLKDLELEYLRNEQALEDKAAELAGLEKRVESVL 1744 Query: 110 KSL 112 + Sbjct: 1745 DHI 1747 >gnl|CDD|36110 KOG0892, KOG0892, KOG0892, Protein kinase ATM/Tel1, involved in telomere length regulation and DNA repair [Signal transduction mechanisms, Chromatin structure and dynamics, Replication, recombination and repair, Cell cycle control, cell division, chromosome partitioning]. Length = 2806 Score = 28.5 bits (63), Expect = 1.7 Identities = 9/44 (20%), Positives = 16/44 (36%) Query: 6 SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLR 49 S E+ + + ++ + EE L E R K+L Sbjct: 2196 STVEASNEREEQMRKNHHVRVQRQLILDEEELLALSEDRSKFLT 2239 >gnl|CDD|111811 pfam02963, EcoRI, Restriction endonuclease EcoRI. Length = 257 Score = 28.0 bits (62), Expect = 2.0 Identities = 16/65 (24%), Positives = 30/65 (46%), Gaps = 3/65 (4%) Query: 105 SESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTII 164 S+ V K L E ++++ K+I+ +K +P++ Q +F E P I+ Sbjct: 23 SKLVKKKLSEDYPQLSFRYRDSIKK---KEINEALKKIDPDLGQTLFVENASIKPDGGIV 79 Query: 165 KVVQD 169 +V D Sbjct: 80 EVKDD 84 >gnl|CDD|37173 KOG1962, KOG1962, KOG1962, B-cell receptor-associated protein and related proteins [Defense mechanisms]. Length = 216 Score = 27.6 bits (61), Expect = 2.8 Identities = 13/65 (20%), Positives = 25/65 (38%) Query: 2 ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRT 61 E + D EK + + + + QSE +D+Y R++ E L+ + Sbjct: 150 EEENDKLKADLEKLETELEKKQKKLEKAQKKVDALKKQSEGLQDEYDRLLEEYSKLQEQI 209 Query: 62 DREKK 66 + K Sbjct: 210 ESGGK 214 >gnl|CDD|30672 COG0324, MiaA, tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis]. Length = 308 Score = 27.1 bits (60), Expect = 3.7 Identities = 25/114 (21%), Positives = 47/114 (41%), Gaps = 14/114 (12%) Query: 51 IAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLK 110 + E+ + + +SYS A+F RD L+ D++ P+ + LK Sbjct: 52 LEELAGVPHHLIDIRDPTESYSAAEFQRDALAAIDDILAR-GKLPI----LVGGTGLYLK 106 Query: 111 SLIEGI-------EMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDT 157 +L+EG+ RR + + L G + A+ +K +P + P+D Sbjct: 107 ALLEGLSLLPEADPEVRRRLEAELAELGNDALHAELKKIDPEAAAKI--HPNDP 158 >gnl|CDD|72977 cd03218, ABC_YhbG, The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids. The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis. YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein. Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli. The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.. Length = 232 Score = 27.0 bits (60), Expect = 3.8 Identities = 13/47 (27%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Query: 81 LSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTL 127 L+V +N+ L+ L E+K E +L+ I R+ S+L Sbjct: 90 LTVEENILAVLEIRGLSKKEREEKLEELLEEF--HITHLRKSKASSL 134 >gnl|CDD|34627 COG5022, COG5022, Myosin heavy chain [Cytoskeleton]. Length = 1463 Score = 26.9 bits (59), Expect = 4.2 Identities = 43/211 (20%), Positives = 77/211 (36%), Gaps = 15/211 (7%) Query: 7 EKNIDKEKNPSNANSSTAEEKSEINIPE--ESLNQSEEFRDK-----YLRVIAEMENLRR 59 +K I +EK K+E+ I + SL + F YL+ +E R Sbjct: 823 QKTIKREKKLRETEEVEFSLKAEVLIQKFGRSLKAKKRFSLLKKETIYLQSAQRVELAER 882 Query: 60 RTDREKKDAQSYSIAKFARDML-SVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEM 118 + K D +S S K L S L ++L S ++ + + + LK L+ I++ Sbjct: 883 QLQELKIDVKSISSLKLVNLELESEIIELKKSLSSDLIENLEFKTELIARLKKLLNNIDL 942 Query: 119 TRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVL 178 Y K + + + EE D + +TI+ + + Sbjct: 943 E----EGPSIEYVKLPELNKLHEVESKLKETS-EEYEDLLKKSTILVREGNKANSELKNF 997 Query: 179 RPALVSISKGKT--QNPTEEKKETIEQPSPL 207 + L +SK Q T++ KE + + L Sbjct: 998 KKELAELSKQYGALQESTKQLKELPVEVAEL 1028 >gnl|CDD|36189 KOG0971, KOG0971, KOG0971, Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning, Cytoskeleton]. Length = 1243 Score = 26.6 bits (58), Expect = 5.1 Identities = 19/72 (26%), Positives = 39/72 (54%), Gaps = 5/72 (6%) Query: 37 LNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPL 96 L Q +EF+ K + A+++ +R +E K+AQ ++ +M +D ++ A L Sbjct: 264 LEQLQEFKSKIMEQQADLQRELKRARKEAKEAQEAK-ERYKEEMADTADA----IEMATL 318 Query: 97 DLANSEKKSESV 108 D +E+++ES+ Sbjct: 319 DKEMAEERAESL 330 >gnl|CDD|114310 pfam05580, Peptidase_S55, SpoIVB peptidase S55. The protein SpoIVB plays a key role in signalling in the final sigma-K checkpoint of Bacillus subtilis. Length = 219 Score = 26.2 bits (58), Expect = 6.3 Identities = 12/48 (25%), Positives = 18/48 (37%), Gaps = 5/48 (10%) Query: 166 VVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQPSPLDIEERN 213 +++G I + SI KG NP E K + P+ N Sbjct: 52 SIKNGEIIKSSI-----TSIDKGSNGNPGELKGIFSNERKPIGNISNN 94 >gnl|CDD|36479 KOG1265, KOG1265, KOG1265, Phospholipase C [Lipid transport and metabolism]. Length = 1189 Score = 25.7 bits (56), Expect = 9.1 Identities = 16/67 (23%), Positives = 31/67 (46%), Gaps = 1/67 (1%) Query: 13 EKNPSNANSSTAEEKSEIN-IPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSY 71 + P+ A+ A E E++ IP E L + + F R E+ +LR++ +E+ Q Sbjct: 913 IRAPTTADQPVAVEAFEVDPIPLEELREHKSFVKLLKRHEKELRDLRKKHQKERDTLQKQ 972 Query: 72 SIAKFAR 78 + + Sbjct: 973 HQTQVDK 979 >gnl|CDD|31474 COG1283, NptA, Na+/phosphate symporter [Inorganic ion transport and metabolism]. Length = 533 Score = 25.9 bits (57), Expect = 10.0 Identities = 20/86 (23%), Positives = 39/86 (45%), Gaps = 6/86 (6%) Query: 34 EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDS 93 E+++++ E YL +++ E L ++ E + I A ++ + D + R L+ Sbjct: 372 EDAVDRLYEEIKLYLARLSK-EGL---SEEESRRWAE--IIDAAINLEHIGDIIERLLEL 425 Query: 94 APLDLANSEKKSESVLKSLIEGIEMT 119 A +AN SE L+ L +T Sbjct: 426 ADKKIANGRAFSEDGLEELDALFALT 451 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.306 0.123 0.318 Gapped Lambda K H 0.267 0.0668 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,317,708 Number of extensions: 109785 Number of successful extensions: 231 Number of sequences better than 10.0: 1 Number of HSP's gapped: 228 Number of HSP's successfully gapped: 43 Length of query: 219 Length of database: 6,263,737 Length adjustment: 90 Effective length of query: 129 Effective length of database: 4,318,927 Effective search space: 557141583 Effective search space used: 557141583 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (22.0 bits) S2: 55 (25.1 bits)