RPSBLAST alignment of GI: 255764487 and protein with PDBid: 1dkg

>1dkg_A Nucleotide exchange factor GRPE; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: b.73.1.1 h.1.9.1 Length = 197
 Score = 97.9 bits (243), Expect = 1e-21
 Identities = 54/184 (29%), Positives = 96/184 (52%), Gaps = 8/184 (4%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
             + I+  +  ++A      ++   N+  +        RD  LRV AEMENLRRRT+ + 
Sbjct: 21  QHEEIEAVEPEASAEQVDPRDEKVANLEAQLAEAQTRERDGILRVKAEMENLRRRTELDI 80

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
           + A  +++ KF  ++L V D+L RAL+ A     +            +E IE+T + M+ 
Sbjct: 81  EKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAM--------VEDIELTLKSMLD 132

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
            + ++GV+ I   +   +PN+HQA+     D V    ++ ++Q GY +N R +R A+V++
Sbjct: 133 VVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 192

Query: 186 SKGK 189
           +K K
Sbjct: 193 AKAK 196