RPSBLAST alignment of GI: 255764487 and protein with PDBid: 3a6m

>3a6m_A Protein GRPE, HSP-70 cofactor; coiled-coil, four-helix bundle, dimer, chaperone, cytoplasm, stress response; 3.23A {Thermus thermophilus HB8} Length = 177
 Score =  121 bits (304), Expect = 2e-28
 Identities = 46/192 (23%), Positives = 86/192 (44%), Gaps = 15/192 (7%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           M E+N +              +  E  + + +  + +  +DKYLR++A+ +N R+R + E
Sbjct: 1   MEERNHENTLEKDLEAVGQEAQALEERL-KAAEEELKGLKDKYLRLLADFDNYRKRMEEE 59

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
            K  +   + K  R +L V D+L RAL+ A     +             +G+   R    
Sbjct: 60  LKAREREGVLKALRALLPVLDDLDRALEFAEASPESI-----------RQGVRAIRDGFF 108

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
             L   GV+++  + + F+P  H+A+   P        + KV Q G+ + E ++RPA V+
Sbjct: 109 RILAGLGVEEVPGEGEAFDPRYHEAVGLLP---GEPGKVAKVFQRGFRMGEALVRPARVA 165

Query: 185 ISKGKTQNPTEE 196
           + + K +    E
Sbjct: 166 VGEEKREEADLE 177