RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|255764487|ref|YP_003065115.2| heat shock protein [Candidatus
Liberibacter asiaticus str. psy62]
         (219 letters)



>3a6m_A Protein GRPE, HSP-70 cofactor; coiled-coil, four-helix bundle,
           dimer, chaperone, cytoplasm, stress response; 3.23A
           {Thermus thermophilus HB8}
          Length = 177

 Score =  121 bits (304), Expect = 2e-28
 Identities = 46/192 (23%), Positives = 86/192 (44%), Gaps = 15/192 (7%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           M E+N +              +  E  + + +  + +  +DKYLR++A+ +N R+R + E
Sbjct: 1   MEERNHENTLEKDLEAVGQEAQALEERL-KAAEEELKGLKDKYLRLLADFDNYRKRMEEE 59

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
            K  +   + K  R +L V D+L RAL+ A     +             +G+   R    
Sbjct: 60  LKAREREGVLKALRALLPVLDDLDRALEFAEASPESI-----------RQGVRAIRDGFF 108

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
             L   GV+++  + + F+P  H+A+   P        + KV Q G+ + E ++RPA V+
Sbjct: 109 RILAGLGVEEVPGEGEAFDPRYHEAVGLLP---GEPGKVAKVFQRGFRMGEALVRPARVA 165

Query: 185 ISKGKTQNPTEE 196
           + + K +    E
Sbjct: 166 VGEEKREEADLE 177


>1dkg_A Nucleotide exchange factor GRPE; HSP70, GRPE, nucleotide exchange
           factor, coiled-coil, complex (HSP24/HSP70); 2.80A
           {Escherichia coli} SCOP: b.73.1.1 h.1.9.1
          Length = 197

 Score = 97.9 bits (243), Expect = 1e-21
 Identities = 54/184 (29%), Positives = 96/184 (52%), Gaps = 8/184 (4%)

Query: 6   SEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREK 65
             + I+  +  ++A      ++   N+  +        RD  LRV AEMENLRRRT+ + 
Sbjct: 21  QHEEIEAVEPEASAEQVDPRDEKVANLEAQLAEAQTRERDGILRVKAEMENLRRRTELDI 80

Query: 66  KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMS 125
           + A  +++ KF  ++L V D+L RAL+ A     +            +E IE+T + M+ 
Sbjct: 81  EKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAM--------VEDIELTLKSMLD 132

Query: 126 TLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSI 185
            + ++GV+ I   +   +PN+HQA+     D V    ++ ++Q GY +N R +R A+V++
Sbjct: 133 VVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 192

Query: 186 SKGK 189
           +K K
Sbjct: 193 AKAK 196


>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 2006

 Score = 39.9 bits (93), Expect = 4e-04
 Identities = 31/147 (21%), Positives = 54/147 (36%), Gaps = 52/147 (35%)

Query: 80  MLSVSDNLSR-ALDSAPLDLANS---EKKSESVLKSLIEGIEMTRREMM-----STLERY 130
           MLS+S+ L++  +    ++  NS     K   +  SL+ G     + ++      +L  Y
Sbjct: 338 MLSISN-LTQEQVQDY-VNKTNSHLPAGKQVEI--SLVNG----AKNLVVSGPPQSL--Y 387

Query: 131 G----VKKIDA---KDQK---FN---PNM-HQ-----AMFEEPHDTVPANTIIKVVQDGY 171
           G    ++K  A    DQ    F+       ++     + F      VPA+ +I   +D  
Sbjct: 388 GLNLTLRKAKAPSGLDQSRIPFSERKLKFSNRFLPVASPFHSHL-LVPASDLIN--KD-- 442

Query: 172 AINERVLRPALVSISKGKTQNP---TE 195
                 L    VS +    Q P   T 
Sbjct: 443 ------LVKNNVSFNAKDIQIPVYDTF 463



 Score = 38.0 bits (88), Expect = 0.002
 Identities = 23/164 (14%), Positives = 52/164 (31%), Gaps = 44/164 (26%)

Query: 30  INIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLS-VSDNLS 88
           + +P  S   + + ++++ +       L   T+    D +  + A+     L  VS    
Sbjct: 20  LLVPTASFFIASQLQEQFNK------ILPEPTEGFAADDEPTTPAELVGKFLGYVSS--- 70

Query: 89  RALDSAP------LDLANSEKKSE--------SVLKSLIEGIEMTRREMMSTLERYGVKK 134
               S        L+L  +E ++         ++   L++  + T  +    ++ Y +  
Sbjct: 71  LVEPSKVGQFDQVLNLCLTEFENCYLEGNDIHALAAKLLQENDTTLVKTKELIKNY-ITA 129

Query: 135 IDAKDQKFNPNMHQ-AMFEEPHDTVPANTIIKVVQDG----YAI 173
                + F       A+F               V +G     AI
Sbjct: 130 RIMAKRPF-DKKSNSALFRA-------------VGEGNAQLVAI 159



 Score = 34.9 bits (80), Expect = 0.015
 Identities = 25/155 (16%), Positives = 49/155 (31%), Gaps = 66/155 (42%)

Query: 7   EKNIDKEKNPSNANSSTAEEK----SEIN------I--PEESL----------------N 38
           +  ++K       NS     K    S +N      +  P +SL                +
Sbjct: 350 QDYVNK------TNSHLPAGKQVEISLVNGAKNLVVSGPPQSLYGLNLTLRKAKAPSGLD 403

Query: 39  QSE--------EFRDKYLRVIAEMEN--LRRRTDREKKDAQSYSIAKFARDMLSVSDNLS 88
           QS         +F +++L V +   +  L   +D   KD    ++  F    + +     
Sbjct: 404 QSRIPFSERKLKFSNRFLPVASPFHSHLLVPASDLINKDLVKNNV-SFNAKDIQI----- 457

Query: 89  RALDSAPL-------DLANSEKKSESVLKSLIEGI 116
                 P+       DL      S S+ + +++ I
Sbjct: 458 ------PVYDTFDGSDLRVL---SGSISERIVDCI 483



 Score = 29.9 bits (67), Expect = 0.42
 Identities = 31/146 (21%), Positives = 59/146 (40%), Gaps = 37/146 (25%)

Query: 71   YSIAKFARDMLSVSDNLSR------ALD---SAPLDLA---NSEKK-------SESVLKS 111
            Y  +K A+D+ + +DN  +       LD   + P++L      EK        S  + ++
Sbjct: 1636 YKTSKAAQDVWNRADNHFKDTYGFSILDIVINNPVNLTIHFGGEKGKRIRENYSAMIFET 1695

Query: 112  LIEG---IEMTRREMMSTLERYGV---KKIDAKDQKFNPN---MHQAMFEE--PHDTVPA 160
            +++G    E   +E+      Y     K + +  Q   P    M +A FE+      +PA
Sbjct: 1696 IVDGKLKTEKIFKEINEHSTSYTFRSEKGLLSATQFTQPALTLMEKAAFEDLKSKGLIPA 1755

Query: 161  NTIIKVVQDGYAINERVLRPALVSIS 186
            +        G+++ E     AL S++
Sbjct: 1756 DATFA----GHSLGEYA---ALASLA 1774


>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant
           photosynthetic reaction center, peripheral antenna; HET:
           CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1
          Length = 154

 Score = 31.5 bits (70), Expect = 0.16
 Identities = 15/54 (27%), Positives = 21/54 (38%), Gaps = 27/54 (50%)

Query: 64  EK---KDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIE 114
           EK   K  Q+ S+  +A       D      DSAP  LA         +K+ +E
Sbjct: 18  EKQALKKLQA-SLKLYA-------D------DSAPA-LA---------IKATME 47



 Score = 30.0 bits (66), Expect = 0.40
 Identities = 10/45 (22%), Positives = 18/45 (40%), Gaps = 18/45 (40%)

Query: 128 ERYGVKKIDAKDQKFNPNMHQA---MFEEPHDTVPANTIIKVVQD 169
           E+  +KK+            QA   ++ +  D+ PA   IK   +
Sbjct: 18  EKQALKKL------------QASLKLYAD--DSAPA-LAIKATME 47


>2qc0_A Uncharacterized protein; NP_719793.1, uncharacterized protein,
           structural genomics, joint center for structural
           genomics, JCSG; HET: MSE; 1.60A {Shewanella oneidensis}
           PDB: 3eqx_A*
          Length = 373

 Score = 27.4 bits (60), Expect = 2.3
 Identities = 17/103 (16%), Positives = 29/103 (28%), Gaps = 1/103 (0%)

Query: 77  ARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKID 136
           AR  L+        L +  L L N     E+   S IE I  T  ++    +        
Sbjct: 38  ARAALAELKQAGELLPNQGL-LINLLPLLEAQGSSEIENIVTTTDKLFQYAQEDSQADPM 96

Query: 137 AKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLR 179
            K+           F +  +     T    +       +  +R
Sbjct: 97  TKEALRYRTALYQCFTQLSNRPLCVTTALEICSTIKSVQMDVR 139


>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold,
           winged-helix-turn-helix, antiparallel-coiled-COI domain,
           ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces
           cerevisiae}
          Length = 1108

 Score = 26.4 bits (57), Expect = 5.9
 Identities = 14/149 (9%), Positives = 37/149 (24%)

Query: 1   METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60
            + F          +    N+ T    +  +  ++     EE  +         +    +
Sbjct: 42  FDVFEETPVELPTDSNGEKNADTNVGDTPDHTQDKKHGLEEEKEEHEENNSENKKIKSNK 101

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           +  E K+ +              S  +  +      +    E+  +  L   +       
Sbjct: 102 SKTEDKNKKVVVPVLADSFEQEASREVDASKGLTNSETLQVEQDGKVRLSHQVRHQVALP 161

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQA 149
                T      +  +A+   F  +  Q 
Sbjct: 162 PNYDYTPIAEHKRVNEARTYPFTLDPFQD 190


>2oez_A UPF0289 protein VP2528; immunoglobulin fold, alpha-structure,
           structural genomics, PSI-2, protein structure
           initiative; HET: MSE; 1.97A {Vibrio parahaemolyticus
           rimd 2210633} SCOP: e.68.1.1
          Length = 247

 Score = 25.9 bits (57), Expect = 7.8
 Identities = 22/111 (19%), Positives = 40/111 (36%), Gaps = 19/111 (17%)

Query: 28  SEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNL 87
           +  +  E  LN  E+ R  YLRV    E+L R+       A ++    F R +  + +  
Sbjct: 3   ATTHKFEHPLN--EKTR-IYLRV----ESLLRQAHLASGFADNHQYQLFFRALFDMVEIF 55

Query: 88  SRA------------LDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
            +                +     N E   +  L SL+  I++   ++M  
Sbjct: 56  EQIQLKSELAKDLEKQRLSYRHWLNVEGVDQEALNSLLNEIDVVHSQLMGA 106


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.306    0.123    0.318 

Gapped
Lambda     K      H
   0.267   0.0450    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 1,651,467
Number of extensions: 71540
Number of successful extensions: 169
Number of sequences better than 10.0: 1
Number of HSP's gapped: 165
Number of HSP's successfully gapped: 26
Length of query: 219
Length of database: 5,693,230
Length adjustment: 89
Effective length of query: 130
Effective length of database: 3,535,514
Effective search space: 459616820
Effective search space used: 459616820
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 55 (25.7 bits)