Score = 85.8 bits (213), Expect = 3e-18 Identities = 19/58 (32%), Positives = 34/58 (58%) Query: 132 VKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189 V+ I + +PN+HQA+ D V ++ ++Q GY +N R +R A+V+++K K Sbjct: 1 VEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTVAKAK 58
class: All beta proteins
fold: Head domain of nucleotide exchange factor GrpE
superfamily: Head domain of nucleotide exchange factor GrpE
family: Head domain of nucleotide exchange factor GrpE
domain: Head domain of nucleotide exchange factor GrpE
species: Escherichia coli [TaxId: 562]