RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|255764487|ref|YP_003065115.2| heat shock protein [Candidatus
Liberibacter asiaticus str. psy62]
         (219 letters)



>d1dkga1 b.73.1.1 (A:139-197) Head domain of nucleotide exchange
           factor GrpE {Escherichia coli [TaxId: 562]}
          Length = 59

 Score = 85.8 bits (213), Expect = 3e-18
 Identities = 19/58 (32%), Positives = 34/58 (58%)

Query: 132 VKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
           V+ I   +   +PN+HQA+     D V    ++ ++Q GY +N R +R A+V+++K K
Sbjct: 1   VEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTVAKAK 58


>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal
           (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]}
          Length = 267

 Score = 27.2 bits (59), Expect = 1.1
 Identities = 11/57 (19%), Positives = 23/57 (40%)

Query: 25  EEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDML 81
            E+ E  +P E   + + FR + L  I E +        E ++    ++ K   + +
Sbjct: 179 GEEREAEVPPEERERVQRFRQEVLEAIVETDEGLLEKYLEGEEVTGEALEKAFHEAV 235


>d2oeza1 e.68.1.1 (A:1-245) Uncharacterized protein VP2528 {Vibrio
           parahaemolyticus [TaxId: 670]}
          Length = 245

 Score = 25.9 bits (57), Expect = 2.8
 Identities = 23/105 (21%), Positives = 40/105 (38%), Gaps = 19/105 (18%)

Query: 34  EESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRA--- 90
           E  LN  E+ R  YLRV    E+L R+       A ++    F R +  + +   +    
Sbjct: 7   EHPLN--EKTR-IYLRV----ESLLRQAHLASGFADNHQYQLFFRALFDMVEIFEQIQLK 59

Query: 91  ------LD---SAPLDLANSEKKSESVLKSLIEGIEMTRREMMST 126
                 L+    +     N E   +  L SL+  I++   ++M  
Sbjct: 60  SELAKDLEKQRLSYRHWLNVEGVDQEALNSLLNEIDVVHSQLMGA 104


>d1bwda_ d.126.1.2 (A:) L-arginine: inosamine-phosphate
           amidinotransferase {Streptomyces griseus [TaxId: 1911]}
          Length = 348

 Score = 25.3 bits (54), Expect = 4.3
 Identities = 8/78 (10%), Positives = 20/78 (25%), Gaps = 1/78 (1%)

Query: 103 KKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNM-HQAMFEEPHDTVPAN 161
             S +    +++  E     + + L + GV       +  +  +       +        
Sbjct: 48  IPSGAYPDRVLKETEEELHVLAAELTKLGVTVRRPGPRDHSALIKTPDWETDGFHDYCPR 107

Query: 162 TIIKVVQDGYAINERVLR 179
             +  V          LR
Sbjct: 108 DGLLSVGQTIIETPMALR 125


>d1jlxa1 b.42.3.1 (A:1-153) Agglutinin {Love-lies-bleeding
          (Amaranthus caudatus) [TaxId: 3567]}
          Length = 153

 Score = 24.8 bits (54), Expect = 5.6
 Identities = 4/18 (22%), Positives = 6/18 (33%)

Query: 42 EFRDKYLRVIAEMENLRR 59
              KYLR  ++      
Sbjct: 12 NNHQKYLRYQSDNIQQYG 29


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.306    0.123    0.318 

Gapped
Lambda     K      H
   0.267   0.0643    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 705,362
Number of extensions: 30262
Number of successful extensions: 59
Number of sequences better than 10.0: 1
Number of HSP's gapped: 59
Number of HSP's successfully gapped: 13
Length of query: 219
Length of database: 2,407,596
Length adjustment: 82
Effective length of query: 137
Effective length of database: 1,281,736
Effective search space: 175597832
Effective search space used: 175597832
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 51 (23.6 bits)