BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|255764491|ref|YP_003065078.2| hypothetical protein CLIBASIA_02760 [Candidatus Liberibacter asiaticus str. psy62] (55 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|255764491|ref|YP_003065078.2| hypothetical protein CLIBASIA_02760 [Candidatus Liberibacter asiaticus str. psy62] Length = 55 Score = 112 bits (279), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 55/55 (100%), Positives = 55/55 (100%) Query: 1 MLLNILIVNDQIKTISLECEYGRPYNGLGKRLEKYNNQRTQQDGKQIREKYVTQM 55 MLLNILIVNDQIKTISLECEYGRPYNGLGKRLEKYNNQRTQQDGKQIREKYVTQM Sbjct: 1 MLLNILIVNDQIKTISLECEYGRPYNGLGKRLEKYNNQRTQQDGKQIREKYVTQM 55 >gi|254780182|ref|YP_003064595.1| DNA gyrase subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 910 Score = 23.1 bits (48), Expect = 0.98, Method: Composition-based stats. Identities = 10/29 (34%), Positives = 17/29 (58%) Query: 27 GLGKRLEKYNNQRTQQDGKQIREKYVTQM 55 G GKR Y+ + + + GK IR V+++ Sbjct: 807 GFGKRTSSYDFRISNRSGKGIRATDVSKI 835 >gi|254780670|ref|YP_003065083.1| phosphopyruvate hydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 424 Score = 20.4 bits (41), Expect = 5.5, Method: Composition-based stats. Identities = 9/20 (45%), Positives = 13/20 (65%) Query: 1 MLLNILIVNDQIKTISLECE 20 +L I VND+I+T L C+ Sbjct: 62 VLKAIAFVNDEIRTALLGCD 81 >gi|254781163|ref|YP_003065576.1| hypothetical protein CLIBASIA_05350 [Candidatus Liberibacter asiaticus str. psy62] Length = 214 Score = 20.0 bits (40), Expect = 6.9, Method: Composition-based stats. Identities = 7/18 (38%), Positives = 12/18 (66%) Query: 26 NGLGKRLEKYNNQRTQQD 43 NG G+ LEK + + ++D Sbjct: 124 NGYGQYLEKISQKNVEKD 141 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.317 0.137 0.383 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,580 Number of Sequences: 1233 Number of extensions: 906 Number of successful extensions: 5 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 55 length of database: 328,796 effective HSP length: 27 effective length of query: 28 effective length of database: 295,505 effective search space: 8274140 effective search space used: 8274140 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.2 bits) S2: 31 (16.5 bits)