BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|255764492|ref|YP_003065069.2| hypothetical protein CLIBASIA_02715 [Candidatus Liberibacter asiaticus str. psy62] (56 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|255764492|ref|YP_003065069.2| hypothetical protein CLIBASIA_02715 [Candidatus Liberibacter asiaticus str. psy62] Length = 56 Score = 113 bits (282), Expect = 6e-28, Method: Compositional matrix adjust. Identities = 56/56 (100%), Positives = 56/56 (100%) Query: 1 MLIQNNLTSCTGDKIKSTVDELNSISSRRQNIPPSSVISDLVVHPHEKKEPKKHHE 56 MLIQNNLTSCTGDKIKSTVDELNSISSRRQNIPPSSVISDLVVHPHEKKEPKKHHE Sbjct: 1 MLIQNNLTSCTGDKIKSTVDELNSISSRRQNIPPSSVISDLVVHPHEKKEPKKHHE 56 >gi|254780904|ref|YP_003065317.1| tRNA/rRNA methyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 268 Score = 21.2 bits (43), Expect = 3.6, Method: Composition-based stats. Identities = 9/18 (50%), Positives = 13/18 (72%) Query: 15 IKSTVDELNSISSRRQNI 32 I ST+D+ + SSRR N+ Sbjct: 242 IVSTLDKFSRQSSRRNNV 259 >gi|254781094|ref|YP_003065507.1| glycyl-tRNA synthetase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 702 Score = 20.8 bits (42), Expect = 4.7, Method: Compositional matrix adjust. Identities = 8/21 (38%), Positives = 13/21 (61%) Query: 36 SVISDLVVHPHEKKEPKKHHE 56 +VISD H E + K++H+ Sbjct: 629 AVISDFGTHIQESMDHKRYHQ 649 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.308 0.125 0.350 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,200 Number of Sequences: 1233 Number of extensions: 995 Number of successful extensions: 6 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 56 length of database: 328,796 effective HSP length: 28 effective length of query: 28 effective length of database: 294,272 effective search space: 8239616 effective search space used: 8239616 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (20.8 bits) S2: 31 (16.5 bits)