BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|255764493|ref|YP_003065056.2| hypothetical protein CLIBASIA_02650 [Candidatus Liberibacter asiaticus str. psy62] (60 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|255764493|ref|YP_003065056.2| hypothetical protein CLIBASIA_02650 [Candidatus Liberibacter asiaticus str. psy62] Length = 60 Score = 120 bits (301), Expect = 4e-30, Method: Compositional matrix adjust. Identities = 60/60 (100%), Positives = 60/60 (100%) Query: 1 MFDSSKISFSSGADIDLLASRWQNSSKKLKIVKDAIDYVLDTQREALNAEILKFWKRVCN 60 MFDSSKISFSSGADIDLLASRWQNSSKKLKIVKDAIDYVLDTQREALNAEILKFWKRVCN Sbjct: 1 MFDSSKISFSSGADIDLLASRWQNSSKKLKIVKDAIDYVLDTQREALNAEILKFWKRVCN 60 >gi|254780482|ref|YP_003064895.1| ribonuclease P [Candidatus Liberibacter asiaticus str. psy62] Length = 123 Score = 21.6 bits (44), Expect = 2.7, Method: Compositional matrix adjust. Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 4/30 (13%) Query: 31 IVKDAIDYVLDTQREALNAEILKFWKRVCN 60 ++K DYVL +R+AL +K +CN Sbjct: 75 VLKHGHDYVLIAKRDALFIP----FKELCN 100 >gi|254780534|ref|YP_003064947.1| acyl carrier protein [Candidatus Liberibacter asiaticus str. psy62] Length = 85 Score = 20.8 bits (42), Expect = 4.6, Method: Compositional matrix adjust. Identities = 7/17 (41%), Positives = 13/17 (76%) Query: 23 QNSSKKLKIVKDAIDYV 39 + S+ K+ VKDA+D++ Sbjct: 62 EESANKILTVKDAVDFI 78 >gi|254780979|ref|YP_003065392.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Candidatus Liberibacter asiaticus str. psy62] Length = 500 Score = 20.8 bits (42), Expect = 4.8, Method: Compositional matrix adjust. Identities = 9/29 (31%), Positives = 18/29 (62%) Query: 23 QNSSKKLKIVKDAIDYVLDTQREALNAEI 51 +N ++ L+ +DA+DY ++ + L EI Sbjct: 278 KNETRSLRTKEDALDYRYFSEPDLLPLEI 306 >gi|254780795|ref|YP_003065208.1| homoserine kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 316 Score = 20.4 bits (41), Expect = 5.6, Method: Composition-based stats. Identities = 11/36 (30%), Positives = 18/36 (50%), Gaps = 4/36 (11%) Query: 12 GADIDLLASRWQNSSK----KLKIVKDAIDYVLDTQ 43 GA + +R +S L I KD ++Y+L T+ Sbjct: 268 GAALRFFLTRLYDSQNMPCNALTITKDPMEYILKTR 303 >gi|254780274|ref|YP_003064687.1| lysophospholipase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 317 Score = 20.4 bits (41), Expect = 6.2, Method: Composition-based stats. Identities = 7/21 (33%), Positives = 14/21 (66%) Query: 22 WQNSSKKLKIVKDAIDYVLDT 42 W+N K + K++ +Y+LD+ Sbjct: 184 WKNFLKDHSVKKNSQNYILDS 204 >gi|254780143|ref|YP_003064556.1| DNA-directed RNA polymerase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 1386 Score = 19.6 bits (39), Expect = 9.8, Method: Composition-based stats. Identities = 10/20 (50%), Positives = 13/20 (65%) Query: 12 GADIDLLASRWQNSSKKLKI 31 G IDL SR +NS+K +I Sbjct: 1358 GLSIDLENSRTKNSAKMEEI 1377 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.130 0.379 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,120 Number of Sequences: 1233 Number of extensions: 880 Number of successful extensions: 7 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of query: 60 length of database: 328,796 effective HSP length: 32 effective length of query: 28 effective length of database: 289,340 effective search space: 8101520 effective search space used: 8101520 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.9 bits) S2: 31 (16.5 bits)