HHsearch alignment for GI: 255764495 and conserved domain: COG0737

>COG0737 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesterase and related esterases [Nucleotide transport and metabolism].
Probab=99.12  E-value=9.7e-09  Score=76.33  Aligned_cols=228  Identities=18%  Similarity=0.188  Sum_probs=111.3

Q ss_pred             CCCEEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHCCC-CEEEECCCCCCCCCHHHH-
Q ss_conf             553278899411142788541000222100012100000123308999999999962699-799993744448998999-
Q gi|255764495|r    6 TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV-DHVSITGDIVNFTCNREI-   83 (309)
Q Consensus         6 ~~~m~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~p-D~vvitGDl~~~~~~~~~-   83 (309)
T Consensus        23 ~~~~l~ilhtnD~H~~l~~~~~~~~------------~~~-~~g~~~~~~~v~~~ra~~~~~llld~GD~~~G~~l~~~~   89 (517)
T COG0737          23 ETVKLTILHTNDLHGHLEPYDYDDD------------GDT-DGGLARIATLVKQLRAENKNVLLLDAGDLIQGSPLSDYL   89 (517)
T ss_pred             CCEEEEEEEECCHHHCCCCCCCCCC------------CCC-CCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCHHCC
T ss_conf             6415899982342314231233445------------545-477899999999998647984999278757884501136


Q ss_pred             ---HHHHHHHHHHCCCCCEEEEECCCCCCCCCHH-HHHH-HHHHHHHCCCCCCC---CCCCCCEE-EEECCCE--EEEEE
Q ss_conf             ---9999999861899718999458842222035-6766-43245431344444---55562127-9971987--99983
Q gi|255764495|r   84 ---FTSTHWLRSIGNPHDISIVPGNHDAYISGAK-EKSL-HAWKDYITSDTTCS---TGKKLFPY-LRIRNNI--ALIGC  152 (309)
Q Consensus        84 ---~~~~~~~~~l~~~~~v~~v~GNHD~~~~~~~-~~~~-~~~~~~~~~~~~~~---~~~~~~~~-~~~~~~~--~~i~l  152 (309)
T Consensus        90 ~~g~~~~~~mN~m~--yD-a~tiGNHEFd~g~~~l~~~~~~~~fp~l~aNv~~~~~~~~~~~~Py~I~~~~g~KIgiIG~  166 (517)
T COG0737          90 TKGEPTVDLLNALG--YD-AMTLGNHEFDYGLEALARLLDEAKFPVLSANVYDKNSTGPPFFKPYAIKEVGGVKIGIIGL  166 (517)
T ss_pred             CCCCHHHHHHHCCC--CC-EEEECCCCCCCCHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCEEEEEECCEEEEEEEE
T ss_conf             67875899986469--87-8951353334578999998740578779867863587776777876999619879999985


Q ss_pred             CCCCCCCCCCC---CCEECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEC
Q ss_conf             28888887554---760089999999999852433697089998376888764311012797899999987498199998
Q gi|255764495|r  153 STAIATPPFSA---NGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHG  229 (309)
Q Consensus       153 ~s~~~~~~~~~---~g~~~~~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~~~~~~~~~l~~~l~~~~v~lvl~G  229 (309)
T Consensus       167 ~~~~~~~~~~~~~~~~~~f~d~~e~~~~~i~elk~~~vD~iI~LsH~G~~~d~~~~~~~~~~~~~~---~-~~iD~i~~G  242 (517)
T COG0737         167 TTPTIPTWEKPNAIEGVTFRDPIEAAKKYIPELKGEGVDVIIALSHLGIEDDLELASEVPGDVDVA---V-PGIDLIIGG  242 (517)
T ss_pred             CCCCCCCCCCCCCCCCEEECCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHCCCCCCCCC---C-CCCCEEEEC
T ss_conf             145432344656557816667999999999998735798999912678663345542266520235---5-667558835


Q ss_pred             CCCCCEEEEE-ECCCCCEEEEEECC
Q ss_conf             7675324787-16998689999576
Q gi|255764495|r  230 HTHLNSLHWI-KNEKKLIPVVGIAS  253 (309)
Q Consensus       230 H~H~~~~~~~-~~~~~~~~~~~~~s  253 (309)
T Consensus       243 H~H~~~~~~~~~~~~~~t~ivqag~  267 (517)
T COG0737         243 HSHTVFPGGDKPGTVNGTPIVQAGE  267 (517)
T ss_pred             CCCCCCCCCCCCCCCCCEEEEECCC
T ss_conf             7774446775457658889996687