HHsearch alignment for GI: 255764495 and conserved domain: COG1311

>COG1311 HYS2 Archaeal DNA polymerase II, small subunit/DNA polymerase delta, subunit B [DNA replication, recombination, and repair].
Probab=98.88  E-value=1.1e-07  Score=69.32  Aligned_cols=186  Identities=20%  Similarity=0.166  Sum_probs=96.2

Q ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHC-----CCCEEEECCCCCCCC------
Q ss_conf             788994111427885410002221000121000001233089999999999626-----997999937444489------
Q gi|255764495|r   10 FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH-----NVDHVSITGDIVNFT------   78 (309)
Q Consensus        10 ~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~-----~pD~vvitGDl~~~~------   78 (309)
T Consensus       226 v~v~~isDih~GSk-----------------------~F~~~~f~~fi~wl~g~~~~a~~vkyliiagd~VDGigiYpgq  282 (481)
T COG1311         226 VYVALISDIHRGSK-----------------------EFLEDEFEKFIDWLNGPGDLASRVKYLIIAGDVVDGIGIYPGQ  282 (481)
T ss_pred             EEEEEEEEEECCCH-----------------------HHHHHHHHHHHHHHCCCCCCCCCEEEEEEECCCCCCCCCCCCC
T ss_conf             57999761110528-----------------------8888899999998638754321237999705521343444686


Q ss_pred             --------CHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCC-CCCCCCEEEEECCCEEE
Q ss_conf             --------989999999999861899718999458842222035676643245431344444-55562127997198799
Q gi|255764495|r   79 --------CNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCS-TGKKLFPYLRIRNNIAL  149 (309)
Q Consensus        79 --------~~~~~~~~~~~~~~l~~~~~v~~v~GNHD~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~  149 (309)
T Consensus       283 ~~eL~i~di~~qy~~~A~~L~~vp~~I~v~i~PGnhDa~r~a~PQp~~~~---~~kslf~~~n~~~v~NP~~~~l~G~~v  359 (481)
T COG1311         283 EEELVIADIYEQYEELAEFLDQVPEHIKVFIMPGNHDAVRQALPQPHFPE---LIKSLFSLNNLLFVSNPALVSLHGVDV  359 (481)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCCCH---HHCCCCCCCCEEECCCCCEEEECCEEE
T ss_conf             12100055167899999988538777569981588875541358877511---202331026537617973798888899


Q ss_pred             EEE-----CCCCCCCCCCCCCEECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCC-CCHHHHHHHHHHCCC
Q ss_conf             983-----28888887554760089999999999852433697089998376888764311012-797899999987498
Q gi|255764495|r  150 IGC-----STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRM-FGIQRFQKMIWHEGA  223 (309)
Q Consensus       150 i~l-----~s~~~~~~~~~~g~~~~~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~~~~-~~~~~l~~~l~~~~v  223 (309)
T Consensus       360 L~~hG~sidDii~~vP~~~----~~~~~~ame~lLk~-----------rHlaPtygg~~p~aP~~kD~---l-VIee-vP  419 (481)
T COG1311         360 LIYHGRSIDDIIKLVPGAD----YDSPLKAMEELLKR-----------RHLAPTYGGTLPIAPETKDY---L-VIEE-VP  419 (481)
T ss_pred             EEECCCCHHHHHHHCCCCC----CCCHHHHHHHHHHH-----------CCCCCCCCCCCCCCCCCCCC---E-EECC-CC
T ss_conf             9854899899986477877----32467899999986-----------14578889952026677685---5-6505-88


Q ss_pred             EEEEECCCCCCEEEEEEC
Q ss_conf             199998767532478716
Q gi|255764495|r  224 DLILHGHTHLNSLHWIKN  241 (309)
Q Consensus       224 ~lvl~GH~H~~~~~~~~~  241 (309)
T Consensus       420 Dv~~~Ghvh~~g~~~y~g  437 (481)
T COG1311         420 DVFHTGHVHKFGTGVYEG  437 (481)
T ss_pred             CEEEECCCCCCCEEEEEC
T ss_conf             679976602212038862