HHsearch alignment for GI: 255764495 and conserved domain: COG1407

>COG1407 Predicted ICC-like phosphoesterases [General function prediction only].
Probab=98.50  E-value=6.4e-07  Score=64.35  Aligned_cols=90  Identities=21%  Similarity=0.244  Sum_probs=59.5

Q ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCC---HHHHHHH
Q ss_conf             7889941114278854100022210001210000012330899999999996269979999374444899---8999999
Q gi|255764495|r   10 FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTC---NREIFTS   86 (309)
Q Consensus        10 ~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~pD~vvitGDl~~~~~---~~~~~~~   86 (309)
T Consensus        20 ~~~lVvADlHlG~e~~~~r~-Gi~lP----------~~~~~~~~~~l~~ii~~~~p~~lIilGD~KH~~~~~~~~e~~~~   88 (235)
T COG1407          20 GRTLVVADLHLGYEESLARR-GINLP----------RYQTDRILKRLDRIIERYGPKRLIILGDLKHEFGKSLRQEKEEV   88 (235)
T ss_pred             CCEEEEEECCCCHHHHHHHC-CCCCC----------CHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCHHHH
T ss_conf             76799971233316988735-76267----------01589999999999986098779990753443675442328999


Q ss_pred             HHHHHHHCCCCCEEEEECCCCCCCC
Q ss_conf             9999861899718999458842222
Q gi|255764495|r   87 THWLRSIGNPHDISIVPGNHDAYIS  111 (309)
Q Consensus        87 ~~~~~~l~~~~~v~~v~GNHD~~~~  111 (309)
T Consensus        89 ~~f~~~~~~~-evi~i~GNHD~~i~  112 (235)
T COG1407          89 REFLELLDER-EVIIIRGNHDNGIE  112 (235)
T ss_pred             HHHHHHHCCC-CEEEEECCCCCCCC
T ss_conf             9999974138-68999566777640