HHsearch alignment for GI: 255764495 and conserved domain: COG1768

>COG1768 Predicted phosphohydrolase [General function prediction only].
Probab=99.62  E-value=9.8e-15  Score=115.78  Aligned_cols=194  Identities=19%  Similarity=0.174  Sum_probs=117.7

Q ss_pred             EEEEEEECCCCCCC-CCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHH
Q ss_conf             78899411142788-54100022210001210000012330899999999996269979999374444899899999999
Q gi|255764495|r   10 FVLAHISDIHLSYS-PSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTH   88 (309)
Q Consensus        10 ~ri~hlSDlHlg~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~pD~vvitGDl~~~~~~~~~~~~~~   88 (309)
T Consensus         1 M~iyaiaDLHLa~~~pKpM~vFGe~W~gh-----------~ekI~k~W~~~v~~e--DiVllpGDiSWaM~l~ea~~Dl~   67 (230)
T COG1768           1 MRIYAIADLHLALGVPKPMEVFGEPWSGH-----------HEKIKKHWRSKVSPE--DIVLLPGDISWAMRLEEAEEDLR   67 (230)
T ss_pred             CCEEEEEHHHHHHCCCCCEEECCCCCCCC-----------HHHHHHHHHHCCCHH--HEEEECCCCHHHEECHHHHHHHH
T ss_conf             94366323257537998613228754574-----------589999887227841--27884365245410534443145


Q ss_pred             HHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCEEEEE---ECCCCC-CCCC-CC
Q ss_conf             998618997189994588422220356766432454313444445556212799719879998---328888-8875-54
Q gi|255764495|r   89 WLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG---CSTAIA-TPPF-SA  163 (309)
Q Consensus        89 ~~~~l~~~~~v~~v~GNHD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~---l~s~~~-~~~~-~~  163 (309)
T Consensus        68 ~i~~L--PG~K~m~rGNHDYWw~s~-skl~n~lp~~l~~------~n~~----f~l~n~aI~G~RgW~s~~~~~e~~te~  134 (230)
T COG1768          68 FIGDL--PGTKYMIRGNHDYWWSSI-SKLNNALPPILFY------LNNG----FELLNYAIVGVRGWDSPSFDSEPLTEQ  134 (230)
T ss_pred             HHHCC--CCCEEEEECCCCCCCCHH-HHHHHHCCCHHHH------HCCC----EEEEEEEEEEEECCCCCCCCCCCCCHH
T ss_conf             65048--996798726776321028-9998655726756------5053----157427898741232787776756456


Q ss_pred             CCEECHHHHHHHHH-HHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEECCCCCCEE
Q ss_conf             76008999999999-98524336970899983768887643110127978999999874981999987675324
Q gi|255764495|r  164 NGYFGQEQAHATSK-LLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSL  236 (309)
Q Consensus       164 ~g~~~~~q~~~l~~-~L~~~~~~~~~~iv~~Hhpp~~~~~~~~~~~~~~~~l~~~l~~~~v~lvl~GH~H~~~~  236 (309)
T Consensus       135 Deki~~RE~~RLrlsa~a~l~k~~~~fivM~HYPP~s~~~t-------~~~~sevlee~rv~~~lyGHlHgv~~  201 (230)
T COG1768         135 DEKIFLREIGRLRLSADAALPKGVSKFIVMTHYPPFSDDGT-------PGPFSEVLEEGRVSKCLYGHLHGVPR  201 (230)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCC-------CCCHHHHHHHCCEEEEEEEECCCCCC
T ss_conf             78899999999987798754667675999970699899999-------74168888626421577620157898