HHsearch alignment for GI: 255764495 and conserved domain: COG5555

>COG5555 Cytolysin, a secreted calcineurin-like phosphatase [Cell motility and secretion].
Probab=96.82  E-value=0.002  Score=41.30  Aligned_cols=165  Identities=13%  Similarity=-0.029  Sum_probs=90.2

Q ss_pred             CCEEEECCCCCCCCCHH-----HHHHHHHHHHHHC-------CCCCEEEEECCCCCCCCCHH---HHHHHHHHHHHC---
Q ss_conf             97999937444489989-----9999999998618-------99718999458842222035---676643245431---
Q gi|255764495|r   65 VDHVSITGDIVNFTCNR-----EIFTSTHWLRSIG-------NPHDISIVPGNHDAYISGAK---EKSLHAWKDYIT---  126 (309)
Q Consensus        65 pD~vvitGDl~~~~~~~-----~~~~~~~~~~~l~-------~~~~v~~v~GNHD~~~~~~~---~~~~~~~~~~~~---  126 (309)
T Consensus       127 plGlV~ggDitddgggq~~qprEg~ql~qf~~RYsq~vG~~h~H~PvYvGlgnhdldq~gpph~~DWyRrElrdyve~~H  206 (392)
T COG5555         127 PLGLVEGGDITDDGGGQSFQPREGNQLKQFELRYSQDVGNIHMHYPVYVGLGNHDLDQKGPPHSLDWYRRELRDYVENYH  206 (392)
T ss_pred             CEEEEEECCEECCCCCCCCCCCCCCHHHCHHHHHCCCCCCCEEEEEEEECCCCHHHCCCCCCCCHHHHHHHHHHHHHHHC
T ss_conf             32678611132168873457655531214576631277873465535763572122025999740689988789998603


Q ss_pred             --------CCCCCCCCCCCCEEEEECCCEEEEEECCCCCCCCCCCCCEECHHHHHHHHHHHHHCCCCCCEEEEEEECCCC
Q ss_conf             --------344444555621279971987999832888888755476008999999999985243369708999837688
Q gi|255764495|r  127 --------SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPV  198 (309)
Q Consensus       127 --------~~~~~~~~~~~~~~~~~~~~~~~i~l~s~~~~~~~~~~g~~~~~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~  198 (309)
T Consensus       207 r~~vf~Kppvp~atYd~l~d~ySwdwgglhlvh~hrf~Gd~~-----~ga~sslpwlk~dl~~~aadgrpv~LfqhyGwd  281 (392)
T COG5555         207 RSDVFWKPPVPPATYDQLKDRYSWDWGGLHLVHYHRFIGDAE-----PGANSSLPWLKVDLIYSAADGRPVYLFQHYGWD  281 (392)
T ss_pred             CCCCCCCCCCCCCCCCCCCHHEECCCCCEEEEEEEEECCCCC-----CCCCCCCCCEECCCEEECCCCCCEEEHHHHCCC
T ss_conf             767666899885433201011001343135788764215667-----776556731211202112579836631220710


Q ss_pred             CCCC-CC--C--------------CCCCCHHHHHHHHHHCCCEEEEECCCCCC
Q ss_conf             8764-31--1--------------01279789999998749819999876753
Q gi|255764495|r  199 LDTS-SL--Y--------------NRMFGIQRFQKMIWHEGADLILHGHTHLN  234 (309)
Q Consensus       199 ~~~~-~~--~--------------~~~~~~~~l~~~l~~~~v~lvl~GH~H~~  234 (309)
T Consensus       282 tfsteawdpAsrT~Dd~Gsgaphww~a~er~all~~lqGYNvvg~fhGhkhd~  334 (392)
T COG5555         282 TFSTEAWDPASRTLDDTGSGAPHWWPAPERGALLFFLQGYNVVGTFHGHKHDF  334 (392)
T ss_pred             CEECCCCCCHHCCCCCCCCCCCCCCCCCCCCHHHHHHCCCEEEEECCCCCCCC
T ss_conf             01021368300133668998998788987105888643750677515633564