HHsearch alignment for GI: 255764495 and conserved domain: KOG3325

>KOG3325 consensus.
Probab=96.82  E-value=0.035  Score=33.16  Aligned_cols=97  Identities=21%  Similarity=0.191  Sum_probs=55.8

Q ss_pred             CCEEEEEEECC-CCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEECCCCCCEEEEEECCCCCEEEEEECCCCCCCC---CC
Q ss_conf             97089998376-888764311012797899999987498199998767532478716998689999576235778---88
Q gi|255764495|r  186 GFFRIIMMHHP-PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVH---SN  261 (309)
Q Consensus       186 ~~~~iv~~Hhp-p~~~~~~~~~~~~~~~~l~~~l~~~~v~lvl~GH~H~~~~~~~~~~~~~~~~~~~~s~~~~~~---~~  261 (309)
T Consensus        78 GqfkIG~chGhqViP~g--------d~~sL~~LaRqldvDILl~G~Th~f~Aye~eg----~ffvnPGSaTGAfn~~~t~  145 (183)
T KOG3325          78 GQFKIGLCHGHQVIPWG--------DPESLALLARQLDVDILLTGHTHKFEAYEHEG----KFFVNPGSATGAFNVSDTD  145 (183)
T ss_pred             CCEEEEEECCCEEECCC--------CHHHHHHHHHHCCCCEEEECCCEEEEEEEECC----CEEECCCCCCCCCCCCCCC
T ss_conf             41788765475762389--------98999999975497599967813589998478----0996787555777632357


Q ss_pred             CCCCCEEEEEEECCCCEEEEEEEEEECCCCCEEEEEC
Q ss_conf             8778548999953898389999995137761157531
Q gi|255764495|r  262 KPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKD  298 (309)
Q Consensus       262 ~~~~~y~li~i~~~~~~~~v~~~r~~~~~d~~~~~~~  298 (309)
T Consensus       146 ~~~PSFvLmDiqg~----~~v~YvY~lidgeVkVdki  178 (183)
T KOG3325         146 IIVPSFVLMDIQGS----TVVTYVYRLIDGEVKVDKI  178 (183)
T ss_pred             CCCCCEEEEEECCC----EEEEEEEEEECCCEEEEEE
T ss_conf             77774699971287----7999980404882788999