HHsearch alignment for GI: 255764495 and conserved domain: PHA02239

>PHA02239 putative protein phosphatase.
Probab=98.50  E-value=5.3e-07  Score=64.89  Aligned_cols=71  Identities=17%  Similarity=0.284  Sum_probs=49.0

Q ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHC-CC-CEEEECCCCCCCCCHHHHHHHH
Q ss_conf             788994111427885410002221000121000001233089999999999626-99-7999937444489989999999
Q gi|255764495|r   10 FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH-NV-DHVSITGDIVNFTCNREIFTST   87 (309)
Q Consensus        10 ~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~-~p-D~vvitGDl~~~~~~~~~~~~~   87 (309)
T Consensus         1 m~IYaigDIHG~----------------------------~d~l~~ll~~i~~~~~~~~~lv~lGDyiDRGp~S~--~vi   50 (235)
T PHA02239          1 MAIYVVPDIHGE----------------------------YQKLLTIMDKINNERKPEETIVFLGDYVDRGKRSK--DVV   50 (235)
T ss_pred             CCEEEEEECCCC----------------------------HHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCHH--HHH
T ss_conf             965898624789----------------------------99999999998743797766999533106895629--999


Q ss_pred             HHHHHH-CCCCCEEEEECCCCCCC
Q ss_conf             999861-89971899945884222
Q gi|255764495|r   88 HWLRSI-GNPHDISIVPGNHDAYI  110 (309)
Q Consensus        88 ~~~~~l-~~~~~v~~v~GNHD~~~  110 (309)
T Consensus        51 ~~l~~l~~~~~~~~~L~GNHE~ml   74 (235)
T PHA02239         51 NYIFDLMSNDDNVVTLLGNHDDEF   74 (235)
T ss_pred             HHHHHHHHCCCCEEEEECCHHHHH
T ss_conf             999987536997499107289999